data_1L8Y # _entry.id 1L8Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1L8Y pdb_00001l8y 10.2210/pdb1l8y/pdb RCSB RCSB015754 ? ? WWPDB D_1000015754 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-06-05 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2022-12-21 6 'Structure model' 1 5 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Database references' 7 6 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' struct_ref_seq_dif 7 6 'Structure model' chem_comp_atom 8 6 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 5 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1L8Y _pdbx_database_status.recvd_initial_deposition_date 2002-03-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1L8Z _pdbx_database_related.details '1L8Z contains minimized average structure of the same protein' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yang, W.' 1 'Xu, Y.' 2 'Wu, J.' 3 'Zeng, W.' 4 'Shi, Y.' 5 # _citation.id primary _citation.title ;Solution structure and DNA binding property of the fifth HMG box domain in comparison with the first HMG box domain in human upstream binding factor ; _citation.journal_abbrev Biochemistry _citation.journal_volume 42 _citation.page_first 1930 _citation.page_last 1938 _citation.year 2003 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12590579 _citation.pdbx_database_id_DOI 10.1021/bi026372x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, W.' 1 ? primary 'Xu, Y.' 2 ? primary 'Wu, J.' 3 ? primary 'Zeng, W.' 4 ? primary 'Shi, Y.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'upstream binding factor 1' _entity.formula_weight 10891.573 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'HMG box 5 domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNS SKKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNS SKKLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 LYS n 1 4 LEU n 1 5 PRO n 1 6 GLU n 1 7 SER n 1 8 PRO n 1 9 LYS n 1 10 ARG n 1 11 ALA n 1 12 GLU n 1 13 GLU n 1 14 ILE n 1 15 TRP n 1 16 GLN n 1 17 GLN n 1 18 SER n 1 19 VAL n 1 20 ILE n 1 21 GLY n 1 22 ASP n 1 23 TYR n 1 24 LEU n 1 25 ALA n 1 26 ARG n 1 27 PHE n 1 28 LYS n 1 29 ASN n 1 30 ASP n 1 31 ARG n 1 32 VAL n 1 33 LYS n 1 34 ALA n 1 35 LEU n 1 36 LYS n 1 37 ALA n 1 38 MET n 1 39 GLU n 1 40 MET n 1 41 THR n 1 42 TRP n 1 43 ASN n 1 44 ASN n 1 45 MET n 1 46 GLU n 1 47 LYS n 1 48 LYS n 1 49 GLU n 1 50 LYS n 1 51 LEU n 1 52 MET n 1 53 TRP n 1 54 ILE n 1 55 LYS n 1 56 LYS n 1 57 ALA n 1 58 ALA n 1 59 GLU n 1 60 ASP n 1 61 GLN n 1 62 LYS n 1 63 ARG n 1 64 TYR n 1 65 GLU n 1 66 ARG n 1 67 GLU n 1 68 LEU n 1 69 SER n 1 70 GLU n 1 71 MET n 1 72 ARG n 1 73 ALA n 1 74 PRO n 1 75 PRO n 1 76 ALA n 1 77 ALA n 1 78 THR n 1 79 ASN n 1 80 SER n 1 81 SER n 1 82 LYS n 1 83 LYS n 1 84 LEU n 1 85 GLU n 1 86 HIS n 1 87 HIS n 1 88 HIS n 1 89 HIS n 1 90 HIS n 1 91 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-22b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 GLY 2 1 1 GLY GLY A . n A 1 3 LYS 3 2 2 LYS LYS A . n A 1 4 LEU 4 3 3 LEU LEU A . n A 1 5 PRO 5 4 4 PRO PRO A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 SER 7 6 6 SER SER A . n A 1 8 PRO 8 7 7 PRO PRO A . n A 1 9 LYS 9 8 8 LYS LYS A . n A 1 10 ARG 10 9 9 ARG ARG A . n A 1 11 ALA 11 10 10 ALA ALA A . n A 1 12 GLU 12 11 11 GLU GLU A . n A 1 13 GLU 13 12 12 GLU GLU A . n A 1 14 ILE 14 13 13 ILE ILE A . n A 1 15 TRP 15 14 14 TRP TRP A . n A 1 16 GLN 16 15 15 GLN GLN A . n A 1 17 GLN 17 16 16 GLN GLN A . n A 1 18 SER 18 17 17 SER SER A . n A 1 19 VAL 19 18 18 VAL VAL A . n A 1 20 ILE 20 19 19 ILE ILE A . n A 1 21 GLY 21 20 20 GLY GLY A . n A 1 22 ASP 22 21 21 ASP ASP A . n A 1 23 TYR 23 22 22 TYR TYR A . n A 1 24 LEU 24 23 23 LEU LEU A . n A 1 25 ALA 25 24 24 ALA ALA A . n A 1 26 ARG 26 25 25 ARG ARG A . n A 1 27 PHE 27 26 26 PHE PHE A . n A 1 28 LYS 28 27 27 LYS LYS A . n A 1 29 ASN 29 28 28 ASN ASN A . n A 1 30 ASP 30 29 29 ASP ASP A . n A 1 31 ARG 31 30 30 ARG ARG A . n A 1 32 VAL 32 31 31 VAL VAL A . n A 1 33 LYS 33 32 32 LYS LYS A . n A 1 34 ALA 34 33 33 ALA ALA A . n A 1 35 LEU 35 34 34 LEU LEU A . n A 1 36 LYS 36 35 35 LYS LYS A . n A 1 37 ALA 37 36 36 ALA ALA A . n A 1 38 MET 38 37 37 MET MET A . n A 1 39 GLU 39 38 38 GLU GLU A . n A 1 40 MET 40 39 39 MET MET A . n A 1 41 THR 41 40 40 THR THR A . n A 1 42 TRP 42 41 41 TRP TRP A . n A 1 43 ASN 43 42 42 ASN ASN A . n A 1 44 ASN 44 43 43 ASN ASN A . n A 1 45 MET 45 44 44 MET MET A . n A 1 46 GLU 46 45 45 GLU GLU A . n A 1 47 LYS 47 46 46 LYS LYS A . n A 1 48 LYS 48 47 47 LYS LYS A . n A 1 49 GLU 49 48 48 GLU GLU A . n A 1 50 LYS 50 49 49 LYS LYS A . n A 1 51 LEU 51 50 50 LEU LEU A . n A 1 52 MET 52 51 51 MET MET A . n A 1 53 TRP 53 52 52 TRP TRP A . n A 1 54 ILE 54 53 53 ILE ILE A . n A 1 55 LYS 55 54 54 LYS LYS A . n A 1 56 LYS 56 55 55 LYS LYS A . n A 1 57 ALA 57 56 56 ALA ALA A . n A 1 58 ALA 58 57 57 ALA ALA A . n A 1 59 GLU 59 58 58 GLU GLU A . n A 1 60 ASP 60 59 59 ASP ASP A . n A 1 61 GLN 61 60 60 GLN GLN A . n A 1 62 LYS 62 61 61 LYS LYS A . n A 1 63 ARG 63 62 62 ARG ARG A . n A 1 64 TYR 64 63 63 TYR TYR A . n A 1 65 GLU 65 64 64 GLU GLU A . n A 1 66 ARG 66 65 65 ARG ARG A . n A 1 67 GLU 67 66 66 GLU GLU A . n A 1 68 LEU 68 67 67 LEU LEU A . n A 1 69 SER 69 68 68 SER SER A . n A 1 70 GLU 70 69 69 GLU GLU A . n A 1 71 MET 71 70 70 MET MET A . n A 1 72 ARG 72 71 71 ARG ARG A . n A 1 73 ALA 73 72 72 ALA ALA A . n A 1 74 PRO 74 73 73 PRO PRO A . n A 1 75 PRO 75 74 74 PRO PRO A . n A 1 76 ALA 76 75 75 ALA ALA A . n A 1 77 ALA 77 76 76 ALA ALA A . n A 1 78 THR 78 77 77 THR THR A . n A 1 79 ASN 79 78 78 ASN ASN A . n A 1 80 SER 80 79 79 SER SER A . n A 1 81 SER 81 80 80 SER SER A . n A 1 82 LYS 82 81 81 LYS LYS A . n A 1 83 LYS 83 82 82 LYS LYS A . n A 1 84 LEU 84 83 83 LEU LEU A . n A 1 85 GLU 85 84 84 GLU GLU A . n A 1 86 HIS 86 85 ? ? ? A . n A 1 87 HIS 87 86 ? ? ? A . n A 1 88 HIS 88 87 ? ? ? A . n A 1 89 HIS 89 88 ? ? ? A . n A 1 90 HIS 90 89 ? ? ? A . n A 1 91 HIS 91 90 ? ? ? A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 84 ? O ? A GLU 85 O 2 2 Y 1 A GLU 84 ? O ? A GLU 85 O 3 3 Y 1 A GLU 84 ? O ? A GLU 85 O 4 4 Y 1 A GLU 84 ? O ? A GLU 85 O 5 5 Y 1 A GLU 84 ? O ? A GLU 85 O 6 6 Y 1 A GLU 84 ? O ? A GLU 85 O 7 7 Y 1 A GLU 84 ? O ? A GLU 85 O 8 8 Y 1 A GLU 84 ? O ? A GLU 85 O 9 9 Y 1 A GLU 84 ? O ? A GLU 85 O 10 10 Y 1 A GLU 84 ? O ? A GLU 85 O 11 11 Y 1 A GLU 84 ? O ? A GLU 85 O 12 12 Y 1 A GLU 84 ? O ? A GLU 85 O 13 13 Y 1 A GLU 84 ? O ? A GLU 85 O 14 14 Y 1 A GLU 84 ? O ? A GLU 85 O 15 15 Y 1 A GLU 84 ? O ? A GLU 85 O 16 16 Y 1 A GLU 84 ? O ? A GLU 85 O 17 17 Y 1 A GLU 84 ? O ? A GLU 85 O 18 18 Y 1 A GLU 84 ? O ? A GLU 85 O 19 19 Y 1 A GLU 84 ? O ? A GLU 85 O 20 20 Y 1 A GLU 84 ? O ? A GLU 85 O 21 21 Y 1 A GLU 84 ? O ? A GLU 85 O 22 22 Y 1 A GLU 84 ? O ? A GLU 85 O 23 23 Y 1 A GLU 84 ? O ? A GLU 85 O 24 24 Y 1 A GLU 84 ? O ? A GLU 85 O 25 25 Y 1 A GLU 84 ? O ? A GLU 85 O 26 26 Y 1 A GLU 84 ? O ? A GLU 85 O 27 27 Y 1 A GLU 84 ? O ? A GLU 85 O 28 28 Y 1 A GLU 84 ? O ? A GLU 85 O 29 29 Y 1 A GLU 84 ? O ? A GLU 85 O 30 30 Y 1 A GLU 84 ? O ? A GLU 85 O # _exptl.entry_id 1L8Y _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1L8Y _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1L8Y _struct.title 'Solution structure of HMG box 5 in human upstream binding factor' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1L8Y _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'hUBF, HMG box 5, DNA binding domain, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UBF1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNS SKK ; _struct_ref.pdbx_align_begin 478 _struct_ref.pdbx_db_accession P17480 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1L8Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P17480 _struct_ref_seq.db_align_beg 479 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 560 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 82 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1L8Y MET A 1 ? UNP P17480 ? ? 'initiating methionine' 0 1 1 1L8Y LEU A 84 ? UNP P17480 ? ? 'expression tag' 83 2 1 1L8Y GLU A 85 ? UNP P17480 ? ? 'expression tag' 84 3 1 1L8Y HIS A 86 ? UNP P17480 ? ? 'expression tag' 85 4 1 1L8Y HIS A 87 ? UNP P17480 ? ? 'expression tag' 86 5 1 1L8Y HIS A 88 ? UNP P17480 ? ? 'expression tag' 87 6 1 1L8Y HIS A 89 ? UNP P17480 ? ? 'expression tag' 88 7 1 1L8Y HIS A 90 ? UNP P17480 ? ? 'expression tag' 89 8 1 1L8Y HIS A 91 ? UNP P17480 ? ? 'expression tag' 90 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 10 ? PHE A 27 ? ARG A 9 PHE A 26 1 ? 18 HELX_P HELX_P2 2 ASP A 30 ? ASN A 44 ? ASP A 29 ASN A 43 1 ? 15 HELX_P HELX_P3 3 MET A 45 ? LYS A 47 ? MET A 44 LYS A 46 5 ? 3 HELX_P HELX_P4 4 LYS A 48 ? GLU A 70 ? LYS A 47 GLU A 69 1 ? 23 HELX_P HELX_P5 5 ALA A 73 ? ALA A 77 ? ALA A 72 ALA A 76 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASP 29 ? ? H A ALA 33 ? ? 1.58 2 2 O A ALA 56 ? ? H A GLN 60 ? ? 1.52 3 2 O A MET 39 ? ? H A ASN 43 ? ? 1.59 4 2 O A ILE 53 ? ? H A ALA 57 ? ? 1.60 5 3 O A ALA 56 ? ? H A GLN 60 ? ? 1.52 6 3 O A LEU 67 ? ? H A MET 70 ? ? 1.59 7 5 O A MET 39 ? ? H A ASN 43 ? ? 1.56 8 7 H A LYS 2 ? ? O A LEU 67 ? ? 1.55 9 8 O A ASP 29 ? ? H A ALA 33 ? ? 1.58 10 9 O A ILE 19 ? ? H A LEU 23 ? ? 1.60 11 12 O A ALA 56 ? ? H A GLN 60 ? ? 1.59 12 14 O A ALA 56 ? ? H A GLN 60 ? ? 1.51 13 14 O A ILE 53 ? ? H A ALA 57 ? ? 1.60 14 15 O A MET 39 ? ? H A ASN 43 ? ? 1.58 15 17 O A ALA 56 ? ? H A GLN 60 ? ? 1.60 16 18 O A ILE 53 ? ? H A ALA 57 ? ? 1.60 17 23 O A ALA 56 ? ? H A GLN 60 ? ? 1.51 18 24 O A ALA 56 ? ? H A GLN 60 ? ? 1.51 19 24 O A ILE 53 ? ? H A ALA 57 ? ? 1.58 20 25 O A VAL 18 ? ? H A ASP 21 ? ? 1.59 21 25 O A LEU 67 ? ? H A MET 70 ? ? 1.60 22 26 O A VAL 18 ? ? H A ASP 21 ? ? 1.60 23 26 O A ALA 56 ? ? H A GLN 60 ? ? 1.60 24 27 O A MET 39 ? ? H A ASN 43 ? ? 1.51 25 30 O A MET 39 ? ? H A ASN 43 ? ? 1.53 26 30 O A TYR 63 ? ? H A LEU 67 ? ? 1.54 27 30 O A ILE 53 ? ? H A ALA 57 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 2 ? ? 172.53 -74.49 2 1 SER A 6 ? ? 57.31 86.84 3 1 PRO A 7 ? ? -56.11 -149.38 4 1 LYS A 8 ? ? -158.00 28.75 5 1 ARG A 9 ? ? 50.35 -88.75 6 1 ALA A 10 ? ? -74.03 -77.01 7 1 ILE A 19 ? ? -34.48 -34.75 8 1 ASN A 28 ? ? 114.71 31.47 9 1 ARG A 30 ? ? -18.79 -55.26 10 1 GLU A 45 ? ? 60.54 -158.37 11 1 GLU A 48 ? ? -75.71 -76.02 12 1 LYS A 49 ? ? -28.53 -70.84 13 1 GLU A 66 ? ? -68.96 -76.42 14 1 ARG A 71 ? ? -95.67 38.50 15 1 ALA A 76 ? ? -154.18 30.38 16 1 THR A 77 ? ? -174.84 -41.07 17 1 LYS A 81 ? ? 38.25 92.63 18 1 LYS A 82 ? ? -69.07 70.86 19 2 LYS A 2 ? ? 47.42 80.08 20 2 LEU A 3 ? ? -149.53 -55.65 21 2 PRO A 4 ? ? -54.00 -75.96 22 2 GLU A 5 ? ? 10.17 67.42 23 2 PRO A 7 ? ? -49.94 171.67 24 2 LYS A 8 ? ? -157.33 36.60 25 2 ARG A 9 ? ? 47.27 -90.55 26 2 ALA A 10 ? ? -70.41 -81.77 27 2 LYS A 27 ? ? 74.69 90.06 28 2 ASN A 28 ? ? 89.78 21.57 29 2 ARG A 30 ? ? -19.52 -55.17 30 2 GLU A 45 ? ? 62.23 -159.00 31 2 LYS A 49 ? ? -34.75 -75.90 32 2 GLU A 66 ? ? -74.57 -76.50 33 2 ARG A 71 ? ? -99.74 31.33 34 2 PRO A 74 ? ? -91.73 32.76 35 2 SER A 80 ? ? -179.89 -32.99 36 3 LYS A 2 ? ? -68.10 -143.25 37 3 PRO A 7 ? ? -57.05 -147.58 38 3 LYS A 8 ? ? -163.41 34.45 39 3 ARG A 9 ? ? 47.79 -89.18 40 3 ALA A 10 ? ? -72.23 -80.03 41 3 ILE A 19 ? ? -37.18 -34.36 42 3 LYS A 27 ? ? 77.29 68.93 43 3 ASN A 28 ? ? 96.35 38.71 44 3 ARG A 30 ? ? -30.28 -25.32 45 3 VAL A 31 ? ? -34.97 -37.43 46 3 GLU A 45 ? ? 52.47 -160.19 47 3 LYS A 49 ? ? -37.58 -78.82 48 3 GLU A 66 ? ? -68.24 -78.24 49 3 ALA A 72 ? ? -157.60 50.10 50 3 PRO A 74 ? ? -93.11 37.27 51 3 ALA A 75 ? ? -95.91 37.15 52 3 ASN A 78 ? ? -158.11 31.23 53 3 SER A 79 ? ? -147.18 -50.79 54 3 LYS A 81 ? ? 62.78 -81.45 55 4 LYS A 2 ? ? -70.38 -90.18 56 4 GLU A 5 ? ? -68.12 -96.22 57 4 SER A 6 ? ? 154.77 94.44 58 4 PRO A 7 ? ? -66.57 -175.82 59 4 LYS A 8 ? ? -157.51 24.40 60 4 ARG A 9 ? ? 50.04 -89.77 61 4 ALA A 10 ? ? -72.50 -71.96 62 4 ILE A 19 ? ? -35.76 -34.29 63 4 ASN A 28 ? ? 126.13 36.48 64 4 ARG A 30 ? ? -19.80 -54.88 65 4 GLU A 45 ? ? 63.14 -156.82 66 4 GLU A 48 ? ? -76.81 -74.99 67 4 LYS A 49 ? ? -24.61 -71.85 68 4 GLU A 66 ? ? -60.55 -71.96 69 4 ALA A 76 ? ? -158.74 31.37 70 4 THR A 77 ? ? -176.80 -40.40 71 4 SER A 80 ? ? -172.18 -46.20 72 4 LYS A 81 ? ? 66.96 -73.65 73 4 LYS A 82 ? ? -163.73 36.21 74 5 PRO A 4 ? ? -74.92 -97.78 75 5 SER A 6 ? ? 176.99 129.31 76 5 PRO A 7 ? ? -65.60 -141.11 77 5 LYS A 8 ? ? -163.95 32.01 78 5 ARG A 9 ? ? 47.63 -90.97 79 5 ALA A 10 ? ? -70.98 -79.84 80 5 ILE A 19 ? ? -32.36 -37.61 81 5 ARG A 25 ? ? -39.84 -37.21 82 5 ASN A 28 ? ? 115.79 32.36 83 5 ARG A 30 ? ? -19.72 -54.11 84 5 GLU A 45 ? ? 66.96 -161.04 85 5 LYS A 49 ? ? -40.72 -76.96 86 5 ARG A 71 ? ? -91.98 32.89 87 5 ALA A 72 ? ? -161.39 50.10 88 5 PRO A 74 ? ? -93.42 37.47 89 5 ALA A 76 ? ? -142.80 24.89 90 5 THR A 77 ? ? 177.83 -50.89 91 5 ASN A 78 ? ? -94.39 45.44 92 5 SER A 79 ? ? -155.67 30.76 93 5 SER A 80 ? ? -149.13 -73.20 94 5 LYS A 81 ? ? 58.80 177.57 95 5 LEU A 83 ? ? 62.03 115.87 96 6 LYS A 2 ? ? 61.84 136.80 97 6 LEU A 3 ? ? 174.19 -60.65 98 6 PRO A 4 ? ? -51.31 -77.98 99 6 GLU A 5 ? ? -133.34 -82.15 100 6 SER A 6 ? ? 80.79 90.81 101 6 PRO A 7 ? ? -54.25 -160.28 102 6 LYS A 8 ? ? -152.98 32.03 103 6 ARG A 9 ? ? 52.51 -89.59 104 6 ALA A 10 ? ? -72.49 -78.59 105 6 ILE A 19 ? ? -38.51 -33.00 106 6 ASN A 28 ? ? 146.58 36.06 107 6 ARG A 30 ? ? -28.30 -51.59 108 6 GLU A 45 ? ? 61.20 -159.46 109 6 GLU A 48 ? ? -69.80 -76.43 110 6 LYS A 49 ? ? -30.54 -73.10 111 6 ALA A 72 ? ? -155.57 49.21 112 6 PRO A 74 ? ? -92.84 30.90 113 6 ALA A 76 ? ? -145.41 29.10 114 6 THR A 77 ? ? -178.63 -49.42 115 6 SER A 80 ? ? -176.83 -63.34 116 6 LYS A 81 ? ? 64.68 -76.00 117 6 LYS A 82 ? ? -160.60 76.07 118 6 LEU A 83 ? ? 60.76 157.30 119 7 LYS A 2 ? ? -67.16 -146.99 120 7 LEU A 3 ? ? -151.39 47.17 121 7 PRO A 4 ? ? -76.11 -100.60 122 7 GLU A 5 ? ? 69.14 154.33 123 7 SER A 6 ? ? 169.92 -51.18 124 7 PRO A 7 ? ? -40.31 158.61 125 7 LYS A 8 ? ? -158.97 27.80 126 7 ARG A 9 ? ? 43.77 -93.45 127 7 ALA A 10 ? ? -68.99 -80.82 128 7 GLU A 12 ? ? -77.33 -71.80 129 7 ASN A 28 ? ? 127.66 35.36 130 7 ARG A 30 ? ? -19.83 -55.67 131 7 GLU A 45 ? ? 58.00 -160.37 132 7 LYS A 49 ? ? -40.76 -77.54 133 7 ALA A 72 ? ? -154.75 49.40 134 7 PRO A 74 ? ? -92.78 41.26 135 7 ALA A 75 ? ? -96.94 38.39 136 7 ALA A 76 ? ? -96.06 -145.42 137 7 THR A 77 ? ? -87.49 32.76 138 7 SER A 79 ? ? -51.79 -75.55 139 7 SER A 80 ? ? -146.20 -2.14 140 7 LYS A 81 ? ? 66.95 -70.67 141 7 LYS A 82 ? ? -171.08 32.32 142 7 LEU A 83 ? ? 58.50 178.15 143 8 LYS A 2 ? ? -128.58 -151.08 144 8 PRO A 4 ? ? -60.59 -95.34 145 8 GLU A 5 ? ? 52.03 165.82 146 8 SER A 6 ? ? 176.20 -58.20 147 8 PRO A 7 ? ? -49.11 168.74 148 8 LYS A 8 ? ? -154.22 34.04 149 8 ARG A 9 ? ? 47.21 -90.51 150 8 ALA A 10 ? ? -70.24 -81.43 151 8 ILE A 19 ? ? -32.31 -39.25 152 8 ASN A 28 ? ? 120.47 34.20 153 8 ARG A 30 ? ? -19.08 -55.88 154 8 GLU A 45 ? ? 60.11 -159.91 155 8 LYS A 49 ? ? -33.65 -75.90 156 8 ALA A 72 ? ? -159.23 48.77 157 8 ALA A 76 ? ? 60.27 111.48 158 8 ASN A 78 ? ? -161.45 27.78 159 8 SER A 79 ? ? -102.15 -66.71 160 8 LYS A 81 ? ? 68.88 144.03 161 9 LYS A 2 ? ? 75.24 -73.32 162 9 PRO A 4 ? ? -84.92 -103.71 163 9 GLU A 5 ? ? -162.79 -153.36 164 9 SER A 6 ? ? 178.50 131.77 165 9 PRO A 7 ? ? -68.08 -143.36 166 9 LYS A 8 ? ? -162.17 32.25 167 9 ARG A 9 ? ? 47.13 -88.86 168 9 ALA A 10 ? ? -71.95 -79.26 169 9 ASN A 28 ? ? 138.53 37.76 170 9 ARG A 30 ? ? -19.91 -61.36 171 9 MET A 44 ? ? -87.67 -93.67 172 9 GLU A 45 ? ? 157.84 -165.53 173 9 GLU A 48 ? ? -64.98 -77.87 174 9 LYS A 49 ? ? -29.18 -75.58 175 9 SER A 68 ? ? -39.96 -39.41 176 9 ARG A 71 ? ? -95.76 37.15 177 9 ALA A 72 ? ? -154.38 52.59 178 9 ALA A 76 ? ? -158.83 27.98 179 9 THR A 77 ? ? 179.57 -39.05 180 9 SER A 80 ? ? -170.08 74.62 181 9 LYS A 82 ? ? -165.27 83.42 182 10 LYS A 2 ? ? 57.18 174.61 183 10 SER A 6 ? ? 61.89 101.72 184 10 PRO A 7 ? ? -54.71 -153.26 185 10 LYS A 8 ? ? -149.35 24.94 186 10 ARG A 9 ? ? 54.52 -86.84 187 10 ALA A 10 ? ? -72.97 -78.44 188 10 ILE A 19 ? ? -37.69 -32.90 189 10 ASN A 28 ? ? 126.32 34.37 190 10 ARG A 30 ? ? -19.93 -53.52 191 10 GLU A 45 ? ? 45.89 -156.68 192 10 LYS A 46 ? ? -24.26 -36.30 193 10 LYS A 49 ? ? -28.29 -54.40 194 10 GLU A 66 ? ? -65.81 -74.83 195 10 SER A 68 ? ? -34.34 -36.25 196 10 ARG A 71 ? ? -99.40 38.62 197 10 ALA A 72 ? ? -140.68 52.74 198 10 ALA A 76 ? ? -76.63 -144.79 199 10 LEU A 83 ? ? 59.47 84.70 200 11 LYS A 2 ? ? 61.78 121.96 201 11 LEU A 3 ? ? -167.79 -66.66 202 11 PRO A 4 ? ? -44.72 -77.68 203 11 GLU A 5 ? ? -176.64 -156.94 204 11 SER A 6 ? ? 169.22 130.26 205 11 PRO A 7 ? ? -71.44 -145.18 206 11 LYS A 8 ? ? -166.10 34.16 207 11 ARG A 9 ? ? 50.01 -89.68 208 11 ALA A 10 ? ? -71.97 -81.86 209 11 ILE A 19 ? ? -34.35 -35.52 210 11 LYS A 27 ? ? 78.81 70.05 211 11 ASN A 28 ? ? 93.55 35.78 212 11 ARG A 30 ? ? -19.36 -37.83 213 11 GLU A 45 ? ? 55.13 -160.81 214 11 LYS A 49 ? ? -41.78 -77.64 215 11 ARG A 62 ? ? -60.04 -70.99 216 11 ARG A 71 ? ? -168.34 77.96 217 11 ALA A 72 ? ? 84.47 80.32 218 11 PRO A 74 ? ? -95.80 44.60 219 11 ALA A 75 ? ? -143.66 58.25 220 11 THR A 77 ? ? 79.59 30.29 221 11 LYS A 81 ? ? 38.59 -159.71 222 11 LYS A 82 ? ? -95.67 40.23 223 11 LEU A 83 ? ? 58.18 98.95 224 12 LYS A 2 ? ? -61.68 -154.21 225 12 LEU A 3 ? ? -155.72 58.72 226 12 GLU A 5 ? ? -129.59 -73.95 227 12 SER A 6 ? ? 62.82 73.97 228 12 PRO A 7 ? ? -54.55 -156.11 229 12 LYS A 8 ? ? -162.21 33.90 230 12 ARG A 9 ? ? 51.72 -89.60 231 12 ALA A 10 ? ? -73.68 -77.95 232 12 ILE A 19 ? ? -38.01 -33.34 233 12 ASN A 28 ? ? 124.70 30.74 234 12 ARG A 30 ? ? -19.74 -58.37 235 12 GLU A 45 ? ? 69.76 -147.85 236 12 GLU A 48 ? ? -64.01 -73.74 237 12 LYS A 49 ? ? -33.06 -74.12 238 12 LEU A 67 ? ? -78.25 -75.48 239 12 ALA A 72 ? ? -178.44 54.34 240 12 PRO A 74 ? ? -97.16 31.91 241 12 THR A 77 ? ? -176.63 -44.99 242 12 ASN A 78 ? ? -95.21 -72.21 243 12 LYS A 82 ? ? -116.35 66.47 244 12 LEU A 83 ? ? 62.17 112.59 245 13 LYS A 2 ? ? 70.92 146.95 246 13 LEU A 3 ? ? 72.81 92.39 247 13 GLU A 5 ? ? -66.58 -141.86 248 13 SER A 6 ? ? -177.87 51.65 249 13 PRO A 7 ? ? -59.80 -162.09 250 13 LYS A 8 ? ? -159.61 31.99 251 13 ARG A 9 ? ? 47.21 -89.38 252 13 ALA A 10 ? ? -72.77 -77.93 253 13 ILE A 19 ? ? -38.68 -32.80 254 13 ASN A 28 ? ? 104.98 45.81 255 13 ARG A 30 ? ? -19.65 -55.44 256 13 GLU A 45 ? ? 59.25 -158.96 257 13 GLU A 48 ? ? -69.21 -76.60 258 13 LYS A 49 ? ? -30.82 -73.26 259 13 GLU A 66 ? ? -56.84 -73.15 260 13 ALA A 72 ? ? -153.43 50.01 261 13 PRO A 74 ? ? -91.83 36.61 262 13 ALA A 75 ? ? -96.40 37.16 263 13 ALA A 76 ? ? -153.30 24.55 264 13 THR A 77 ? ? 178.23 -41.00 265 13 ASN A 78 ? ? -109.92 45.62 266 13 SER A 79 ? ? -141.81 -53.98 267 13 LEU A 83 ? ? 60.08 84.88 268 14 LEU A 3 ? ? 77.62 61.67 269 14 PRO A 4 ? ? -71.91 -104.60 270 14 SER A 6 ? ? 48.11 98.10 271 14 PRO A 7 ? ? -58.80 -145.87 272 14 LYS A 8 ? ? -161.85 33.82 273 14 ARG A 9 ? ? 45.82 -88.32 274 14 ALA A 10 ? ? -72.83 -77.33 275 14 PHE A 26 ? ? -144.67 34.30 276 14 LYS A 27 ? ? 33.59 29.74 277 14 ASN A 28 ? ? 156.26 35.36 278 14 GLU A 45 ? ? 69.84 -146.88 279 14 GLU A 48 ? ? -64.65 -75.08 280 14 LYS A 49 ? ? -29.57 -71.23 281 14 GLU A 66 ? ? -73.30 -77.35 282 14 ASN A 78 ? ? -164.19 31.93 283 14 SER A 79 ? ? -130.29 -45.28 284 14 LYS A 81 ? ? 70.77 -63.27 285 15 LYS A 2 ? ? 62.88 153.77 286 15 LEU A 3 ? ? -177.14 -62.42 287 15 GLU A 5 ? ? 5.01 107.93 288 15 PRO A 7 ? ? -51.27 171.85 289 15 LYS A 8 ? ? -156.53 36.96 290 15 ARG A 9 ? ? 50.92 -90.20 291 15 ALA A 10 ? ? -70.52 -82.35 292 15 ILE A 19 ? ? -32.97 -39.91 293 15 ASN A 28 ? ? 110.14 36.40 294 15 ARG A 30 ? ? -19.55 -53.34 295 15 MET A 44 ? ? -91.02 -96.71 296 15 GLU A 45 ? ? 157.77 -163.27 297 15 LYS A 49 ? ? -34.80 -78.13 298 15 ALA A 72 ? ? -153.73 49.42 299 15 PRO A 74 ? ? -91.83 30.33 300 15 ALA A 75 ? ? -99.77 39.40 301 15 ALA A 76 ? ? -105.78 65.76 302 15 THR A 77 ? ? 80.02 34.41 303 15 ASN A 78 ? ? -144.53 -50.59 304 15 LYS A 81 ? ? 68.89 -69.10 305 15 LYS A 82 ? ? -160.97 36.49 306 16 LYS A 2 ? ? 58.59 97.11 307 16 LEU A 3 ? ? -150.30 -63.86 308 16 GLU A 5 ? ? 79.26 166.24 309 16 SER A 6 ? ? 179.27 -55.46 310 16 LYS A 8 ? ? -163.03 26.63 311 16 ARG A 9 ? ? 51.30 -95.83 312 16 ALA A 10 ? ? -69.56 -77.59 313 16 GLU A 12 ? ? -78.75 -70.97 314 16 ILE A 19 ? ? -36.02 -34.25 315 16 ASN A 28 ? ? 100.05 42.99 316 16 ASP A 29 ? ? -69.77 1.32 317 16 ARG A 30 ? ? -19.52 -54.31 318 16 MET A 44 ? ? -85.80 -97.70 319 16 GLU A 45 ? ? 163.49 -164.52 320 16 GLU A 48 ? ? -68.01 -78.24 321 16 LYS A 49 ? ? -28.12 -71.85 322 16 GLU A 66 ? ? -57.06 -73.45 323 16 MET A 70 ? ? -72.26 -77.20 324 16 ALA A 72 ? ? -165.31 54.04 325 16 SER A 80 ? ? -163.50 -40.93 326 16 LYS A 81 ? ? 71.32 140.38 327 16 LYS A 82 ? ? -61.14 85.10 328 17 LYS A 2 ? ? -118.42 -150.27 329 17 LEU A 3 ? ? -142.44 34.82 330 17 PRO A 4 ? ? -70.62 -99.18 331 17 GLU A 5 ? ? 55.53 156.82 332 17 SER A 6 ? ? -166.90 -59.31 333 17 PRO A 7 ? ? -55.73 178.39 334 17 LYS A 8 ? ? -157.63 32.86 335 17 ARG A 9 ? ? 53.11 -91.60 336 17 ALA A 10 ? ? -71.91 -79.72 337 17 ILE A 19 ? ? -39.78 -37.69 338 17 ASN A 28 ? ? 132.76 35.00 339 17 ARG A 30 ? ? -20.06 -53.27 340 17 GLU A 45 ? ? 70.73 -147.09 341 17 LYS A 47 ? ? -63.38 -71.51 342 17 GLU A 48 ? ? -61.94 -74.10 343 17 LYS A 49 ? ? -34.06 -73.10 344 17 ARG A 71 ? ? -102.91 40.96 345 17 PRO A 74 ? ? -98.38 47.89 346 17 THR A 77 ? ? 174.10 -34.49 347 18 LYS A 2 ? ? 161.83 -90.12 348 18 SER A 6 ? ? 81.89 76.20 349 18 PRO A 7 ? ? -54.27 -161.67 350 18 LYS A 8 ? ? -147.14 26.34 351 18 ARG A 9 ? ? 46.55 -89.16 352 18 ALA A 10 ? ? -73.97 -77.17 353 18 ILE A 19 ? ? -33.08 -37.48 354 18 LYS A 27 ? ? 80.88 72.92 355 18 ASN A 28 ? ? 87.11 38.98 356 18 ARG A 30 ? ? -19.66 -36.39 357 18 VAL A 31 ? ? -34.97 -38.02 358 18 MET A 44 ? ? -84.84 -99.55 359 18 GLU A 45 ? ? 162.24 -160.79 360 18 GLU A 48 ? ? -68.14 -78.39 361 18 LYS A 49 ? ? -28.84 -70.83 362 18 ALA A 72 ? ? -169.71 52.38 363 18 PRO A 74 ? ? -94.52 33.84 364 18 THR A 77 ? ? 81.01 19.92 365 18 ASN A 78 ? ? -143.96 -75.99 366 18 SER A 80 ? ? -175.24 97.01 367 19 LYS A 2 ? ? 62.75 122.71 368 19 LEU A 3 ? ? -164.20 -66.57 369 19 PRO A 4 ? ? -60.03 -72.81 370 19 GLU A 5 ? ? -164.59 -164.89 371 19 SER A 6 ? ? 175.66 128.61 372 19 PRO A 7 ? ? -65.49 -145.71 373 19 LYS A 8 ? ? -163.07 31.41 374 19 ARG A 9 ? ? 48.72 -91.71 375 19 ALA A 10 ? ? -70.30 -78.90 376 19 ILE A 19 ? ? -29.83 -40.47 377 19 PHE A 26 ? ? -94.22 -74.34 378 19 LYS A 27 ? ? 159.22 52.74 379 19 ASN A 28 ? ? 105.50 41.82 380 19 ASP A 29 ? ? -64.86 10.09 381 19 ARG A 30 ? ? -19.82 -52.16 382 19 ALA A 33 ? ? -68.00 -70.57 383 19 GLU A 45 ? ? 55.16 -161.63 384 19 LYS A 49 ? ? -41.16 -77.54 385 19 ARG A 62 ? ? -61.28 -70.98 386 19 MET A 70 ? ? -51.58 -80.39 387 19 ALA A 76 ? ? -49.57 98.92 388 19 SER A 80 ? ? -178.01 -35.30 389 19 LYS A 81 ? ? 74.63 142.80 390 20 LYS A 2 ? ? -123.89 -164.36 391 20 PRO A 4 ? ? -69.64 -100.29 392 20 PRO A 7 ? ? -53.23 -168.15 393 20 LYS A 8 ? ? -153.86 32.55 394 20 ARG A 9 ? ? 52.56 -92.22 395 20 ALA A 10 ? ? -72.28 -80.37 396 20 ILE A 19 ? ? -38.07 -31.24 397 20 PHE A 26 ? ? -142.36 32.50 398 20 LYS A 27 ? ? 34.62 29.84 399 20 ASN A 28 ? ? 158.09 34.22 400 20 ASP A 29 ? ? -77.70 20.49 401 20 MET A 44 ? ? -80.70 -103.92 402 20 GLU A 45 ? ? 160.02 -161.79 403 20 GLU A 48 ? ? -100.11 -64.86 404 20 LYS A 49 ? ? -35.36 -78.40 405 20 LEU A 67 ? ? -64.62 -73.38 406 20 ALA A 72 ? ? -179.90 56.44 407 20 PRO A 74 ? ? -99.63 31.39 408 20 THR A 77 ? ? 172.10 -61.87 409 21 LYS A 2 ? ? -106.35 -155.67 410 21 LEU A 3 ? ? -142.35 49.72 411 21 PRO A 4 ? ? -64.21 -94.53 412 21 GLU A 5 ? ? -122.18 -157.38 413 21 SER A 6 ? ? 170.63 65.02 414 21 PRO A 7 ? ? -50.44 -158.43 415 21 LYS A 8 ? ? -156.25 29.90 416 21 ARG A 9 ? ? 51.39 -90.88 417 21 ALA A 10 ? ? -72.71 -79.21 418 21 ILE A 19 ? ? -37.03 -33.33 419 21 ASN A 28 ? ? 141.27 38.23 420 21 ARG A 30 ? ? -19.57 -51.90 421 21 GLU A 45 ? ? 49.77 -156.22 422 21 LYS A 46 ? ? -24.87 -39.26 423 21 GLU A 66 ? ? -98.13 -64.71 424 21 ARG A 71 ? ? -154.97 69.68 425 21 PRO A 74 ? ? -98.35 38.10 426 21 ALA A 75 ? ? -95.88 37.86 427 21 THR A 77 ? ? -173.17 -42.02 428 21 LEU A 83 ? ? 61.01 95.83 429 22 LYS A 2 ? ? 51.31 100.78 430 22 LEU A 3 ? ? -153.91 -62.69 431 22 PRO A 4 ? ? -59.08 -71.26 432 22 GLU A 5 ? ? 14.59 63.54 433 22 PRO A 7 ? ? -44.08 172.06 434 22 LYS A 8 ? ? -159.48 25.06 435 22 ARG A 9 ? ? 45.45 -91.38 436 22 ALA A 10 ? ? -72.03 -76.96 437 22 GLU A 12 ? ? -79.77 -70.38 438 22 ILE A 19 ? ? -36.04 -36.16 439 22 LYS A 27 ? ? 34.35 30.65 440 22 ASN A 28 ? ? 153.28 36.04 441 22 ARG A 30 ? ? -22.31 -68.22 442 22 ALA A 33 ? ? -73.56 -74.55 443 22 MET A 44 ? ? -74.80 -103.05 444 22 GLU A 45 ? ? 165.29 -160.20 445 22 GLU A 48 ? ? -70.53 -78.57 446 22 LYS A 49 ? ? -26.12 -72.97 447 22 GLU A 66 ? ? -61.63 -75.49 448 22 ALA A 72 ? ? 28.66 59.04 449 22 ASN A 78 ? ? -154.66 35.13 450 23 LYS A 2 ? ? -178.47 -140.34 451 23 LEU A 3 ? ? -153.92 72.49 452 23 SER A 6 ? ? 167.95 77.14 453 23 PRO A 7 ? ? -55.17 -149.73 454 23 LYS A 8 ? ? -164.30 33.27 455 23 ARG A 9 ? ? 50.06 -88.33 456 23 ALA A 10 ? ? -73.09 -78.37 457 23 ILE A 19 ? ? -35.42 -34.59 458 23 ASN A 28 ? ? 114.68 32.33 459 23 ARG A 30 ? ? -18.93 -55.25 460 23 GLU A 45 ? ? 69.11 -154.71 461 23 GLU A 48 ? ? -100.24 -69.20 462 23 LYS A 49 ? ? -36.21 -73.13 463 23 ALA A 72 ? ? -173.43 55.37 464 23 ALA A 76 ? ? -143.97 22.33 465 23 THR A 77 ? ? -166.29 -43.54 466 24 LYS A 2 ? ? -68.08 -155.67 467 24 LEU A 3 ? ? -144.94 44.97 468 24 PRO A 4 ? ? -65.96 -88.23 469 24 GLU A 5 ? ? -106.13 -77.52 470 24 SER A 6 ? ? 73.24 72.91 471 24 PRO A 7 ? ? -57.54 -155.54 472 24 LYS A 8 ? ? -160.74 33.94 473 24 ARG A 9 ? ? 46.62 -88.72 474 24 ALA A 10 ? ? -73.14 -79.94 475 24 ILE A 19 ? ? -35.87 -36.19 476 24 ASN A 28 ? ? 123.24 34.74 477 24 ARG A 30 ? ? -19.84 -53.89 478 24 GLU A 45 ? ? 49.09 -154.96 479 24 LYS A 46 ? ? -35.07 -27.35 480 24 LEU A 67 ? ? -84.48 -77.21 481 24 ALA A 72 ? ? -158.19 51.61 482 24 ALA A 76 ? ? -164.57 29.70 483 24 THR A 77 ? ? 178.14 -38.20 484 24 SER A 79 ? ? -138.49 -60.67 485 24 SER A 80 ? ? -157.70 30.37 486 24 LYS A 82 ? ? -151.19 89.78 487 24 LEU A 83 ? ? -159.77 80.40 488 25 LYS A 2 ? ? -84.69 -159.32 489 25 LEU A 3 ? ? -151.27 59.91 490 25 PRO A 4 ? ? -84.45 -75.57 491 25 GLU A 5 ? ? -121.53 -70.91 492 25 SER A 6 ? ? 70.45 75.26 493 25 PRO A 7 ? ? -55.60 -171.56 494 25 LYS A 8 ? ? -152.27 34.75 495 25 ARG A 9 ? ? 46.88 -90.11 496 25 ALA A 10 ? ? -68.99 -81.89 497 25 ILE A 19 ? ? -34.58 -35.53 498 25 LYS A 27 ? ? 78.11 71.49 499 25 ASN A 28 ? ? 92.39 37.83 500 25 ARG A 30 ? ? -19.37 -40.08 501 25 VAL A 31 ? ? -30.34 -39.58 502 25 GLU A 45 ? ? 63.05 -157.16 503 25 LYS A 47 ? ? -61.25 -71.97 504 25 LYS A 49 ? ? -31.99 -74.87 505 25 LEU A 67 ? ? -89.17 -71.03 506 25 ALA A 72 ? ? 38.64 52.12 507 25 PRO A 74 ? ? -96.65 30.09 508 25 ALA A 76 ? ? -167.81 31.14 509 25 THR A 77 ? ? 176.16 -52.20 510 25 ASN A 78 ? ? -89.92 -72.37 511 25 SER A 80 ? ? -59.21 -71.76 512 25 LYS A 81 ? ? -173.61 140.19 513 26 SER A 6 ? ? 63.36 66.30 514 26 PRO A 7 ? ? -61.43 -158.61 515 26 LYS A 8 ? ? -163.81 43.62 516 26 ARG A 9 ? ? 51.16 -138.96 517 26 ALA A 10 ? ? -19.43 -94.38 518 26 ILE A 19 ? ? -35.36 -35.96 519 26 LYS A 27 ? ? 80.24 83.41 520 26 ASN A 28 ? ? 83.76 27.38 521 26 ARG A 30 ? ? -19.75 -35.37 522 26 VAL A 31 ? ? -39.33 -33.36 523 26 MET A 44 ? ? -80.70 -100.79 524 26 GLU A 45 ? ? 159.12 -157.05 525 26 LYS A 47 ? ? -62.39 -72.00 526 26 LYS A 49 ? ? -34.70 -77.85 527 26 ALA A 72 ? ? -160.10 51.17 528 26 ALA A 75 ? ? -87.73 -83.91 529 26 ALA A 76 ? ? 63.29 87.27 530 26 LYS A 81 ? ? 66.64 76.77 531 26 LEU A 83 ? ? 59.65 108.97 532 27 LYS A 2 ? ? -46.78 -70.12 533 27 LEU A 3 ? ? -152.17 -64.52 534 27 PRO A 4 ? ? -32.98 -87.87 535 27 GLU A 5 ? ? 174.57 -153.15 536 27 SER A 6 ? ? -179.23 121.36 537 27 PRO A 7 ? ? -63.90 -154.70 538 27 LYS A 8 ? ? -157.97 32.09 539 27 ARG A 9 ? ? 46.62 -90.34 540 27 ALA A 10 ? ? -70.53 -80.35 541 27 ILE A 19 ? ? -30.70 -36.58 542 27 LYS A 27 ? ? 75.37 73.06 543 27 ASN A 28 ? ? 103.67 -8.14 544 27 ARG A 30 ? ? -19.62 -28.63 545 27 VAL A 31 ? ? -29.08 -41.41 546 27 GLU A 45 ? ? 62.20 -161.01 547 27 LYS A 49 ? ? -35.97 -77.17 548 27 ALA A 72 ? ? 48.94 71.99 549 27 ALA A 75 ? ? -148.15 22.69 550 27 ALA A 76 ? ? -69.69 71.02 551 27 SER A 80 ? ? 178.62 -34.73 552 27 LYS A 81 ? ? 73.23 173.07 553 28 LYS A 2 ? ? 60.18 158.91 554 28 GLU A 5 ? ? -114.63 -105.17 555 28 LYS A 8 ? ? -155.57 20.90 556 28 ARG A 9 ? ? 44.73 -136.70 557 28 ALA A 10 ? ? -26.96 -90.11 558 28 GLU A 12 ? ? -74.18 -74.99 559 28 ILE A 19 ? ? -34.19 -37.13 560 28 LYS A 27 ? ? 85.75 90.38 561 28 ARG A 30 ? ? -19.63 -34.32 562 28 VAL A 31 ? ? -37.09 -36.58 563 28 MET A 44 ? ? -87.42 -96.75 564 28 GLU A 45 ? ? 160.58 -160.35 565 28 GLU A 48 ? ? -66.09 -76.06 566 28 LYS A 49 ? ? -28.28 -75.23 567 28 ALA A 72 ? ? 25.33 59.95 568 28 ALA A 75 ? ? -145.10 59.85 569 28 ALA A 76 ? ? -97.56 32.51 570 28 THR A 77 ? ? 76.74 34.35 571 28 ASN A 78 ? ? -171.91 -37.37 572 28 SER A 80 ? ? -130.57 -58.12 573 28 LYS A 81 ? ? 61.23 168.76 574 29 LYS A 2 ? ? 59.89 110.32 575 29 LEU A 3 ? ? -157.44 -58.64 576 29 SER A 6 ? ? 166.85 80.30 577 29 PRO A 7 ? ? -53.22 -157.25 578 29 LYS A 8 ? ? -159.31 33.85 579 29 ARG A 9 ? ? 48.83 -88.98 580 29 ALA A 10 ? ? -72.90 -79.80 581 29 ILE A 19 ? ? -36.27 -33.85 582 29 ARG A 25 ? ? -26.25 -48.30 583 29 LYS A 27 ? ? 82.04 75.02 584 29 ASN A 28 ? ? 99.08 -0.57 585 29 ARG A 30 ? ? -19.75 -29.88 586 29 VAL A 31 ? ? -30.08 -39.51 587 29 GLU A 45 ? ? 51.31 -159.69 588 29 LYS A 49 ? ? -40.73 -79.13 589 29 LEU A 50 ? ? -33.65 -36.99 590 29 GLU A 66 ? ? -69.18 -74.75 591 29 ARG A 71 ? ? -104.91 41.12 592 29 ALA A 72 ? ? -142.79 54.77 593 29 ALA A 76 ? ? -161.09 28.18 594 29 THR A 77 ? ? -170.67 -40.87 595 29 ASN A 78 ? ? -97.06 30.40 596 29 LYS A 81 ? ? -176.79 -58.44 597 29 LYS A 82 ? ? 47.47 91.94 598 30 LYS A 2 ? ? 61.97 133.40 599 30 LEU A 3 ? ? 175.69 -61.65 600 30 PRO A 4 ? ? -43.29 -78.32 601 30 GLU A 5 ? ? -141.22 -80.91 602 30 SER A 6 ? ? 81.07 62.85 603 30 PRO A 7 ? ? -47.55 -177.56 604 30 LYS A 8 ? ? -144.40 32.32 605 30 ARG A 9 ? ? 45.65 -89.87 606 30 ALA A 10 ? ? -69.83 -81.09 607 30 GLU A 12 ? ? -78.04 -70.34 608 30 ILE A 19 ? ? -32.26 -39.64 609 30 LYS A 27 ? ? 76.42 69.45 610 30 ASN A 28 ? ? 90.04 42.04 611 30 ARG A 30 ? ? -19.94 -33.74 612 30 VAL A 31 ? ? -37.62 -35.81 613 30 MET A 44 ? ? -92.04 -99.08 614 30 GLU A 45 ? ? 160.40 -161.39 615 30 GLU A 48 ? ? -90.74 -62.65 616 30 LYS A 49 ? ? -37.61 -75.87 617 30 LEU A 67 ? ? -75.67 -77.19 618 30 ALA A 72 ? ? 177.71 57.18 619 30 PRO A 74 ? ? -95.53 45.41 620 30 ALA A 75 ? ? -106.80 43.60 621 30 ALA A 76 ? ? -94.01 42.19 622 30 THR A 77 ? ? 78.49 30.62 623 30 ASN A 78 ? ? -149.92 41.57 624 30 SER A 79 ? ? -144.73 -47.49 625 30 SER A 80 ? ? -165.53 68.31 # _pdbx_nmr_ensemble.entry_id 1L8Y _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1L8Y _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '3mM hUBF HMG box 5, U-15N, 13C; 45mM NaPO4' '90% H2O/10% D2O' 2 '3mM hUBF HMG box 5, U-15N, 13C; 45mM NaPO4' '100% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '45 mM NaPO4' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY 3 2 1 3D_13C-separated_NOESY # _pdbx_nmr_details.entry_id 1L8Y _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_refine.entry_id 1L8Y _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The structures are based on the total number constraints of 1220, including 1098 NOE-derived distance constraints, 104 dihedral angle constraints, 18 hydrogen bond constraints. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipp ? processing 'F.Delagio and A.Bax' 1 PIPP ? 'data analysis' D.S.Garrett 2 CNS 1.0 'structure solution' A.T.Brunger 3 CNS ? refinement A.T.Brunger 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A HIS 85 ? A HIS 86 3 1 Y 1 A HIS 86 ? A HIS 87 4 1 Y 1 A HIS 87 ? A HIS 88 5 1 Y 1 A HIS 88 ? A HIS 89 6 1 Y 1 A HIS 89 ? A HIS 90 7 1 Y 1 A HIS 90 ? A HIS 91 8 2 Y 1 A MET 0 ? A MET 1 9 2 Y 1 A HIS 85 ? A HIS 86 10 2 Y 1 A HIS 86 ? A HIS 87 11 2 Y 1 A HIS 87 ? A HIS 88 12 2 Y 1 A HIS 88 ? A HIS 89 13 2 Y 1 A HIS 89 ? A HIS 90 14 2 Y 1 A HIS 90 ? A HIS 91 15 3 Y 1 A MET 0 ? A MET 1 16 3 Y 1 A HIS 85 ? A HIS 86 17 3 Y 1 A HIS 86 ? A HIS 87 18 3 Y 1 A HIS 87 ? A HIS 88 19 3 Y 1 A HIS 88 ? A HIS 89 20 3 Y 1 A HIS 89 ? A HIS 90 21 3 Y 1 A HIS 90 ? A HIS 91 22 4 Y 1 A MET 0 ? A MET 1 23 4 Y 1 A HIS 85 ? A HIS 86 24 4 Y 1 A HIS 86 ? A HIS 87 25 4 Y 1 A HIS 87 ? A HIS 88 26 4 Y 1 A HIS 88 ? A HIS 89 27 4 Y 1 A HIS 89 ? A HIS 90 28 4 Y 1 A HIS 90 ? A HIS 91 29 5 Y 1 A MET 0 ? A MET 1 30 5 Y 1 A HIS 85 ? A HIS 86 31 5 Y 1 A HIS 86 ? A HIS 87 32 5 Y 1 A HIS 87 ? A HIS 88 33 5 Y 1 A HIS 88 ? A HIS 89 34 5 Y 1 A HIS 89 ? A HIS 90 35 5 Y 1 A HIS 90 ? A HIS 91 36 6 Y 1 A MET 0 ? A MET 1 37 6 Y 1 A HIS 85 ? A HIS 86 38 6 Y 1 A HIS 86 ? A HIS 87 39 6 Y 1 A HIS 87 ? A HIS 88 40 6 Y 1 A HIS 88 ? A HIS 89 41 6 Y 1 A HIS 89 ? A HIS 90 42 6 Y 1 A HIS 90 ? A HIS 91 43 7 Y 1 A MET 0 ? A MET 1 44 7 Y 1 A HIS 85 ? A HIS 86 45 7 Y 1 A HIS 86 ? A HIS 87 46 7 Y 1 A HIS 87 ? A HIS 88 47 7 Y 1 A HIS 88 ? A HIS 89 48 7 Y 1 A HIS 89 ? A HIS 90 49 7 Y 1 A HIS 90 ? A HIS 91 50 8 Y 1 A MET 0 ? A MET 1 51 8 Y 1 A HIS 85 ? A HIS 86 52 8 Y 1 A HIS 86 ? A HIS 87 53 8 Y 1 A HIS 87 ? A HIS 88 54 8 Y 1 A HIS 88 ? A HIS 89 55 8 Y 1 A HIS 89 ? A HIS 90 56 8 Y 1 A HIS 90 ? A HIS 91 57 9 Y 1 A MET 0 ? A MET 1 58 9 Y 1 A HIS 85 ? A HIS 86 59 9 Y 1 A HIS 86 ? A HIS 87 60 9 Y 1 A HIS 87 ? A HIS 88 61 9 Y 1 A HIS 88 ? A HIS 89 62 9 Y 1 A HIS 89 ? A HIS 90 63 9 Y 1 A HIS 90 ? A HIS 91 64 10 Y 1 A MET 0 ? A MET 1 65 10 Y 1 A HIS 85 ? A HIS 86 66 10 Y 1 A HIS 86 ? A HIS 87 67 10 Y 1 A HIS 87 ? A HIS 88 68 10 Y 1 A HIS 88 ? A HIS 89 69 10 Y 1 A HIS 89 ? A HIS 90 70 10 Y 1 A HIS 90 ? A HIS 91 71 11 Y 1 A MET 0 ? A MET 1 72 11 Y 1 A HIS 85 ? A HIS 86 73 11 Y 1 A HIS 86 ? A HIS 87 74 11 Y 1 A HIS 87 ? A HIS 88 75 11 Y 1 A HIS 88 ? A HIS 89 76 11 Y 1 A HIS 89 ? A HIS 90 77 11 Y 1 A HIS 90 ? A HIS 91 78 12 Y 1 A MET 0 ? A MET 1 79 12 Y 1 A HIS 85 ? A HIS 86 80 12 Y 1 A HIS 86 ? A HIS 87 81 12 Y 1 A HIS 87 ? A HIS 88 82 12 Y 1 A HIS 88 ? A HIS 89 83 12 Y 1 A HIS 89 ? A HIS 90 84 12 Y 1 A HIS 90 ? A HIS 91 85 13 Y 1 A MET 0 ? A MET 1 86 13 Y 1 A HIS 85 ? A HIS 86 87 13 Y 1 A HIS 86 ? A HIS 87 88 13 Y 1 A HIS 87 ? A HIS 88 89 13 Y 1 A HIS 88 ? A HIS 89 90 13 Y 1 A HIS 89 ? A HIS 90 91 13 Y 1 A HIS 90 ? A HIS 91 92 14 Y 1 A MET 0 ? A MET 1 93 14 Y 1 A HIS 85 ? A HIS 86 94 14 Y 1 A HIS 86 ? A HIS 87 95 14 Y 1 A HIS 87 ? A HIS 88 96 14 Y 1 A HIS 88 ? A HIS 89 97 14 Y 1 A HIS 89 ? A HIS 90 98 14 Y 1 A HIS 90 ? A HIS 91 99 15 Y 1 A MET 0 ? A MET 1 100 15 Y 1 A HIS 85 ? A HIS 86 101 15 Y 1 A HIS 86 ? A HIS 87 102 15 Y 1 A HIS 87 ? A HIS 88 103 15 Y 1 A HIS 88 ? A HIS 89 104 15 Y 1 A HIS 89 ? A HIS 90 105 15 Y 1 A HIS 90 ? A HIS 91 106 16 Y 1 A MET 0 ? A MET 1 107 16 Y 1 A HIS 85 ? A HIS 86 108 16 Y 1 A HIS 86 ? A HIS 87 109 16 Y 1 A HIS 87 ? A HIS 88 110 16 Y 1 A HIS 88 ? A HIS 89 111 16 Y 1 A HIS 89 ? A HIS 90 112 16 Y 1 A HIS 90 ? A HIS 91 113 17 Y 1 A MET 0 ? A MET 1 114 17 Y 1 A HIS 85 ? A HIS 86 115 17 Y 1 A HIS 86 ? A HIS 87 116 17 Y 1 A HIS 87 ? A HIS 88 117 17 Y 1 A HIS 88 ? A HIS 89 118 17 Y 1 A HIS 89 ? A HIS 90 119 17 Y 1 A HIS 90 ? A HIS 91 120 18 Y 1 A MET 0 ? A MET 1 121 18 Y 1 A HIS 85 ? A HIS 86 122 18 Y 1 A HIS 86 ? A HIS 87 123 18 Y 1 A HIS 87 ? A HIS 88 124 18 Y 1 A HIS 88 ? A HIS 89 125 18 Y 1 A HIS 89 ? A HIS 90 126 18 Y 1 A HIS 90 ? A HIS 91 127 19 Y 1 A MET 0 ? A MET 1 128 19 Y 1 A HIS 85 ? A HIS 86 129 19 Y 1 A HIS 86 ? A HIS 87 130 19 Y 1 A HIS 87 ? A HIS 88 131 19 Y 1 A HIS 88 ? A HIS 89 132 19 Y 1 A HIS 89 ? A HIS 90 133 19 Y 1 A HIS 90 ? A HIS 91 134 20 Y 1 A MET 0 ? A MET 1 135 20 Y 1 A HIS 85 ? A HIS 86 136 20 Y 1 A HIS 86 ? A HIS 87 137 20 Y 1 A HIS 87 ? A HIS 88 138 20 Y 1 A HIS 88 ? A HIS 89 139 20 Y 1 A HIS 89 ? A HIS 90 140 20 Y 1 A HIS 90 ? A HIS 91 141 21 Y 1 A MET 0 ? A MET 1 142 21 Y 1 A HIS 85 ? A HIS 86 143 21 Y 1 A HIS 86 ? A HIS 87 144 21 Y 1 A HIS 87 ? A HIS 88 145 21 Y 1 A HIS 88 ? A HIS 89 146 21 Y 1 A HIS 89 ? A HIS 90 147 21 Y 1 A HIS 90 ? A HIS 91 148 22 Y 1 A MET 0 ? A MET 1 149 22 Y 1 A HIS 85 ? A HIS 86 150 22 Y 1 A HIS 86 ? A HIS 87 151 22 Y 1 A HIS 87 ? A HIS 88 152 22 Y 1 A HIS 88 ? A HIS 89 153 22 Y 1 A HIS 89 ? A HIS 90 154 22 Y 1 A HIS 90 ? A HIS 91 155 23 Y 1 A MET 0 ? A MET 1 156 23 Y 1 A HIS 85 ? A HIS 86 157 23 Y 1 A HIS 86 ? A HIS 87 158 23 Y 1 A HIS 87 ? A HIS 88 159 23 Y 1 A HIS 88 ? A HIS 89 160 23 Y 1 A HIS 89 ? A HIS 90 161 23 Y 1 A HIS 90 ? A HIS 91 162 24 Y 1 A MET 0 ? A MET 1 163 24 Y 1 A HIS 85 ? A HIS 86 164 24 Y 1 A HIS 86 ? A HIS 87 165 24 Y 1 A HIS 87 ? A HIS 88 166 24 Y 1 A HIS 88 ? A HIS 89 167 24 Y 1 A HIS 89 ? A HIS 90 168 24 Y 1 A HIS 90 ? A HIS 91 169 25 Y 1 A MET 0 ? A MET 1 170 25 Y 1 A HIS 85 ? A HIS 86 171 25 Y 1 A HIS 86 ? A HIS 87 172 25 Y 1 A HIS 87 ? A HIS 88 173 25 Y 1 A HIS 88 ? A HIS 89 174 25 Y 1 A HIS 89 ? A HIS 90 175 25 Y 1 A HIS 90 ? A HIS 91 176 26 Y 1 A MET 0 ? A MET 1 177 26 Y 1 A HIS 85 ? A HIS 86 178 26 Y 1 A HIS 86 ? A HIS 87 179 26 Y 1 A HIS 87 ? A HIS 88 180 26 Y 1 A HIS 88 ? A HIS 89 181 26 Y 1 A HIS 89 ? A HIS 90 182 26 Y 1 A HIS 90 ? A HIS 91 183 27 Y 1 A MET 0 ? A MET 1 184 27 Y 1 A HIS 85 ? A HIS 86 185 27 Y 1 A HIS 86 ? A HIS 87 186 27 Y 1 A HIS 87 ? A HIS 88 187 27 Y 1 A HIS 88 ? A HIS 89 188 27 Y 1 A HIS 89 ? A HIS 90 189 27 Y 1 A HIS 90 ? A HIS 91 190 28 Y 1 A MET 0 ? A MET 1 191 28 Y 1 A HIS 85 ? A HIS 86 192 28 Y 1 A HIS 86 ? A HIS 87 193 28 Y 1 A HIS 87 ? A HIS 88 194 28 Y 1 A HIS 88 ? A HIS 89 195 28 Y 1 A HIS 89 ? A HIS 90 196 28 Y 1 A HIS 90 ? A HIS 91 197 29 Y 1 A MET 0 ? A MET 1 198 29 Y 1 A HIS 85 ? A HIS 86 199 29 Y 1 A HIS 86 ? A HIS 87 200 29 Y 1 A HIS 87 ? A HIS 88 201 29 Y 1 A HIS 88 ? A HIS 89 202 29 Y 1 A HIS 89 ? A HIS 90 203 29 Y 1 A HIS 90 ? A HIS 91 204 30 Y 1 A MET 0 ? A MET 1 205 30 Y 1 A HIS 85 ? A HIS 86 206 30 Y 1 A HIS 86 ? A HIS 87 207 30 Y 1 A HIS 87 ? A HIS 88 208 30 Y 1 A HIS 88 ? A HIS 89 209 30 Y 1 A HIS 89 ? A HIS 90 210 30 Y 1 A HIS 90 ? A HIS 91 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 1L8Y _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_