data_1LG4 # _entry.id 1LG4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1LG4 pdb_00001lg4 10.2210/pdb1lg4/pdb RCSB RCSB015919 ? ? WWPDB D_1000015919 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1I17 _pdbx_database_related.details 'NMR structure of the murine doppel protein' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LG4 _pdbx_database_status.recvd_initial_deposition_date 2002-04-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Luhrs, T.' 1 'Riek, R.' 2 'Guntert, P.' 3 'Wuthrich, K.' 4 # _citation.id primary _citation.title 'NMR Structure of the Human Doppel Protein' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 326 _citation.page_first 1549 _citation.page_last 1557 _citation.year 2003 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12595265 _citation.pdbx_database_id_DOI '10.1016/S0022-2836(02)01471-7' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Luhrs, T.' 1 ? primary 'Riek, R.' 2 ? primary 'Guntert, P.' 3 ? primary 'Wuthrich, K.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Prion-like protein' _entity.formula_weight 14843.668 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'hDpl(24-152)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Doppel protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEA FVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERG ; _entity_poly.pdbx_seq_one_letter_code_can ;VQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEA FVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 GLN n 1 3 THR n 1 4 ARG n 1 5 GLY n 1 6 ILE n 1 7 LYS n 1 8 HIS n 1 9 ARG n 1 10 ILE n 1 11 LYS n 1 12 TRP n 1 13 ASN n 1 14 ARG n 1 15 LYS n 1 16 ALA n 1 17 LEU n 1 18 PRO n 1 19 SER n 1 20 THR n 1 21 ALA n 1 22 GLN n 1 23 ILE n 1 24 THR n 1 25 GLU n 1 26 ALA n 1 27 GLN n 1 28 VAL n 1 29 ALA n 1 30 GLU n 1 31 ASN n 1 32 ARG n 1 33 PRO n 1 34 GLY n 1 35 ALA n 1 36 PHE n 1 37 ILE n 1 38 LYS n 1 39 GLN n 1 40 GLY n 1 41 ARG n 1 42 LYS n 1 43 LEU n 1 44 ASP n 1 45 ILE n 1 46 ASP n 1 47 PHE n 1 48 GLY n 1 49 ALA n 1 50 GLU n 1 51 GLY n 1 52 ASN n 1 53 ARG n 1 54 TYR n 1 55 TYR n 1 56 GLU n 1 57 ALA n 1 58 ASN n 1 59 TYR n 1 60 TRP n 1 61 GLN n 1 62 PHE n 1 63 PRO n 1 64 ASP n 1 65 GLY n 1 66 ILE n 1 67 HIS n 1 68 TYR n 1 69 ASN n 1 70 GLY n 1 71 CYS n 1 72 SER n 1 73 GLU n 1 74 ALA n 1 75 ASN n 1 76 VAL n 1 77 THR n 1 78 LYS n 1 79 GLU n 1 80 ALA n 1 81 PHE n 1 82 VAL n 1 83 THR n 1 84 GLY n 1 85 CYS n 1 86 ILE n 1 87 ASN n 1 88 ALA n 1 89 THR n 1 90 GLN n 1 91 ALA n 1 92 ALA n 1 93 ASN n 1 94 GLN n 1 95 GLY n 1 96 GLU n 1 97 PHE n 1 98 GLN n 1 99 LYS n 1 100 PRO n 1 101 ASP n 1 102 ASN n 1 103 LYS n 1 104 LEU n 1 105 HIS n 1 106 GLN n 1 107 GLN n 1 108 VAL n 1 109 LEU n 1 110 TRP n 1 111 ARG n 1 112 LEU n 1 113 VAL n 1 114 GLN n 1 115 GLU n 1 116 LEU n 1 117 CYS n 1 118 SER n 1 119 LEU n 1 120 LYS n 1 121 HIS n 1 122 CYS n 1 123 GLU n 1 124 PHE n 1 125 TRP n 1 126 LEU n 1 127 GLU n 1 128 ARG n 1 129 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene Prnd _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21/DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pRSETA _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRND_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEA FVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERG ; _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_accession Q9UKY0 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1LG4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 129 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UKY0 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 152 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 24 _struct_ref_seq.pdbx_auth_seq_align_end 152 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 2 1 3D_15N-separated_NOESY 4 3 1 '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '13C,15N labeled hDpl(24-152)' '10% D2O, 90% H2O; 10 mM perdeuterated sodium acetate' 2 '15N labeled hDpl(24-152)' '10% D2O, 90% H2O; 10 mM perdeuterated sodium acetate' 3 '13C,15N labeled hDpl(24-152)' '99.9999% D2O; 10 mM perdeuterated sodium acetate' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 750 # _pdbx_nmr_ensemble.entry_id 1LG4 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1LG4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XEASY 1.5 'data analysis' 'Bartels, C., Xia, T. H., Billeter, M., Guntert, P., and Wuthrich, K.' 1 DYANA 1.65 'structure solution' 'Guntert, P., Herrmann, T., Mumenthaler, C., and Wuthrich, K.' 2 OPALp 1.3 refinement 'Luginbuhl, P., Guntert, P., Billeter, M., and Wuthrich, K.' 3 # _exptl.entry_id 1LG4 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1LG4 _struct.title 'NMR structure of the human doppel protein fragment 24-152' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1LG4 _struct_keywords.pdbx_keywords 'Prion Protein' _struct_keywords.text 'prion, doppel, scrapie, Prion Protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 48 ? TYR A 59 ? GLY A 71 TYR A 82 1 ? 12 HELX_P HELX_P2 2 TRP A 60 ? PHE A 62 ? TRP A 83 PHE A 85 5 ? 3 HELX_P HELX_P3 3 THR A 77 ? ASN A 93 ? THR A 100 ASN A 116 1 ? 17 HELX_P HELX_P4 4 ASN A 102 ? LEU A 119 ? ASN A 125 LEU A 142 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 71 SG ? ? ? 1_555 A CYS 122 SG ? ? A CYS 94 A CYS 145 1_555 ? ? ? ? ? ? ? 2.023 ? ? disulf2 disulf ? ? A CYS 85 SG ? ? ? 1_555 A CYS 117 SG ? ? A CYS 108 A CYS 140 1_555 ? ? ? ? ? ? ? 2.015 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1LG4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1LG4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 24 ? ? ? A . n A 1 2 GLN 2 25 ? ? ? A . n A 1 3 THR 3 26 ? ? ? A . n A 1 4 ARG 4 27 ? ? ? A . n A 1 5 GLY 5 28 ? ? ? A . n A 1 6 ILE 6 29 ? ? ? A . n A 1 7 LYS 7 30 ? ? ? A . n A 1 8 HIS 8 31 ? ? ? A . n A 1 9 ARG 9 32 ? ? ? A . n A 1 10 ILE 10 33 ? ? ? A . n A 1 11 LYS 11 34 ? ? ? A . n A 1 12 TRP 12 35 ? ? ? A . n A 1 13 ASN 13 36 ? ? ? A . n A 1 14 ARG 14 37 ? ? ? A . n A 1 15 LYS 15 38 ? ? ? A . n A 1 16 ALA 16 39 ? ? ? A . n A 1 17 LEU 17 40 ? ? ? A . n A 1 18 PRO 18 41 ? ? ? A . n A 1 19 SER 19 42 ? ? ? A . n A 1 20 THR 20 43 ? ? ? A . n A 1 21 ALA 21 44 ? ? ? A . n A 1 22 GLN 22 45 ? ? ? A . n A 1 23 ILE 23 46 ? ? ? A . n A 1 24 THR 24 47 ? ? ? A . n A 1 25 GLU 25 48 ? ? ? A . n A 1 26 ALA 26 49 ? ? ? A . n A 1 27 GLN 27 50 ? ? ? A . n A 1 28 VAL 28 51 ? ? ? A . n A 1 29 ALA 29 52 52 ALA ALA A . n A 1 30 GLU 30 53 53 GLU GLU A . n A 1 31 ASN 31 54 54 ASN ASN A . n A 1 32 ARG 32 55 55 ARG ARG A . n A 1 33 PRO 33 56 56 PRO PRO A . n A 1 34 GLY 34 57 57 GLY GLY A . n A 1 35 ALA 35 58 58 ALA ALA A . n A 1 36 PHE 36 59 59 PHE PHE A . n A 1 37 ILE 37 60 60 ILE ILE A . n A 1 38 LYS 38 61 61 LYS LYS A . n A 1 39 GLN 39 62 62 GLN GLN A . n A 1 40 GLY 40 63 63 GLY GLY A . n A 1 41 ARG 41 64 64 ARG ARG A . n A 1 42 LYS 42 65 65 LYS LYS A . n A 1 43 LEU 43 66 66 LEU LEU A . n A 1 44 ASP 44 67 67 ASP ASP A . n A 1 45 ILE 45 68 68 ILE ILE A . n A 1 46 ASP 46 69 69 ASP ASP A . n A 1 47 PHE 47 70 70 PHE PHE A . n A 1 48 GLY 48 71 71 GLY GLY A . n A 1 49 ALA 49 72 72 ALA ALA A . n A 1 50 GLU 50 73 73 GLU GLU A . n A 1 51 GLY 51 74 74 GLY GLY A . n A 1 52 ASN 52 75 75 ASN ASN A . n A 1 53 ARG 53 76 76 ARG ARG A . n A 1 54 TYR 54 77 77 TYR TYR A . n A 1 55 TYR 55 78 78 TYR TYR A . n A 1 56 GLU 56 79 79 GLU GLU A . n A 1 57 ALA 57 80 80 ALA ALA A . n A 1 58 ASN 58 81 81 ASN ASN A . n A 1 59 TYR 59 82 82 TYR TYR A . n A 1 60 TRP 60 83 83 TRP TRP A . n A 1 61 GLN 61 84 84 GLN GLN A . n A 1 62 PHE 62 85 85 PHE PHE A . n A 1 63 PRO 63 86 86 PRO PRO A . n A 1 64 ASP 64 87 87 ASP ASP A . n A 1 65 GLY 65 88 88 GLY GLY A . n A 1 66 ILE 66 89 89 ILE ILE A . n A 1 67 HIS 67 90 90 HIS HIS A . n A 1 68 TYR 68 91 91 TYR TYR A . n A 1 69 ASN 69 92 92 ASN ASN A . n A 1 70 GLY 70 93 93 GLY GLY A . n A 1 71 CYS 71 94 94 CYS CYS A . n A 1 72 SER 72 95 95 SER SER A . n A 1 73 GLU 73 96 96 GLU GLU A . n A 1 74 ALA 74 97 97 ALA ALA A . n A 1 75 ASN 75 98 98 ASN ASN A . n A 1 76 VAL 76 99 99 VAL VAL A . n A 1 77 THR 77 100 100 THR THR A . n A 1 78 LYS 78 101 101 LYS LYS A . n A 1 79 GLU 79 102 102 GLU GLU A . n A 1 80 ALA 80 103 103 ALA ALA A . n A 1 81 PHE 81 104 104 PHE PHE A . n A 1 82 VAL 82 105 105 VAL VAL A . n A 1 83 THR 83 106 106 THR THR A . n A 1 84 GLY 84 107 107 GLY GLY A . n A 1 85 CYS 85 108 108 CYS CYS A . n A 1 86 ILE 86 109 109 ILE ILE A . n A 1 87 ASN 87 110 110 ASN ASN A . n A 1 88 ALA 88 111 111 ALA ALA A . n A 1 89 THR 89 112 112 THR THR A . n A 1 90 GLN 90 113 113 GLN GLN A . n A 1 91 ALA 91 114 114 ALA ALA A . n A 1 92 ALA 92 115 115 ALA ALA A . n A 1 93 ASN 93 116 116 ASN ASN A . n A 1 94 GLN 94 117 117 GLN GLN A . n A 1 95 GLY 95 118 118 GLY GLY A . n A 1 96 GLU 96 119 119 GLU GLU A . n A 1 97 PHE 97 120 120 PHE PHE A . n A 1 98 GLN 98 121 121 GLN GLN A . n A 1 99 LYS 99 122 122 LYS LYS A . n A 1 100 PRO 100 123 123 PRO PRO A . n A 1 101 ASP 101 124 124 ASP ASP A . n A 1 102 ASN 102 125 125 ASN ASN A . n A 1 103 LYS 103 126 126 LYS LYS A . n A 1 104 LEU 104 127 127 LEU LEU A . n A 1 105 HIS 105 128 128 HIS HIS A . n A 1 106 GLN 106 129 129 GLN GLN A . n A 1 107 GLN 107 130 130 GLN GLN A . n A 1 108 VAL 108 131 131 VAL VAL A . n A 1 109 LEU 109 132 132 LEU LEU A . n A 1 110 TRP 110 133 133 TRP TRP A . n A 1 111 ARG 111 134 134 ARG ARG A . n A 1 112 LEU 112 135 135 LEU LEU A . n A 1 113 VAL 113 136 136 VAL VAL A . n A 1 114 GLN 114 137 137 GLN GLN A . n A 1 115 GLU 115 138 138 GLU GLU A . n A 1 116 LEU 116 139 139 LEU LEU A . n A 1 117 CYS 117 140 140 CYS CYS A . n A 1 118 SER 118 141 141 SER SER A . n A 1 119 LEU 119 142 142 LEU LEU A . n A 1 120 LYS 120 143 143 LYS LYS A . n A 1 121 HIS 121 144 144 HIS HIS A . n A 1 122 CYS 122 145 145 CYS CYS A . n A 1 123 GLU 123 146 146 GLU GLU A . n A 1 124 PHE 124 147 147 PHE PHE A . n A 1 125 TRP 125 148 148 TRP TRP A . n A 1 126 LEU 126 149 149 LEU LEU A . n A 1 127 GLU 127 150 150 GLU GLU A . n A 1 128 ARG 128 151 ? ? ? A . n A 1 129 GLY 129 152 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-02-25 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 14 O A GLY 57 ? ? HG1 A THR 112 ? ? 1.58 2 17 HG A SER 95 ? ? OE2 A GLU 96 ? ? 1.60 3 18 O A GLY 57 ? ? HG1 A THR 112 ? ? 1.58 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 134 ? ? CZ A ARG 134 ? ? NH1 A ARG 134 ? ? 123.33 120.30 3.03 0.50 N 2 2 CB A TYR 91 ? ? CG A TYR 91 ? ? CD2 A TYR 91 ? ? 117.09 121.00 -3.91 0.60 N 3 3 CB A TYR 78 ? ? CG A TYR 78 ? ? CD2 A TYR 78 ? ? 117.27 121.00 -3.73 0.60 N 4 6 CA A VAL 105 ? ? CB A VAL 105 ? ? CG1 A VAL 105 ? ? 119.90 110.90 9.00 1.50 N 5 8 CB A TYR 78 ? ? CG A TYR 78 ? ? CD2 A TYR 78 ? ? 116.97 121.00 -4.03 0.60 N 6 13 CA A CYS 108 ? ? CB A CYS 108 ? ? SG A CYS 108 ? ? 121.81 114.20 7.61 1.10 N 7 14 CA A CYS 108 ? ? CB A CYS 108 ? ? SG A CYS 108 ? ? 121.19 114.20 6.99 1.10 N 8 19 CB A CYS 145 ? ? CA A CYS 145 ? ? C A CYS 145 ? ? 118.82 111.50 7.32 1.20 N 9 19 CA A CYS 145 ? ? CB A CYS 145 ? ? SG A CYS 145 ? ? 122.62 114.20 8.42 1.10 N 10 20 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH2 A ARG 76 ? ? 116.93 120.30 -3.37 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 54 ? ? -80.08 34.87 2 1 PRO A 56 ? ? -74.59 24.50 3 1 LEU A 66 ? ? 48.36 -167.11 4 1 ALA A 72 ? ? -49.28 -76.08 5 1 ASN A 81 ? ? -150.90 41.22 6 1 TYR A 91 ? ? -80.43 47.54 7 1 CYS A 94 ? ? 125.95 110.50 8 1 ASN A 98 ? ? -166.72 69.91 9 1 PHE A 120 ? ? -68.99 31.42 10 1 ASP A 124 ? ? -143.21 -106.60 11 1 LYS A 126 ? ? -26.25 -65.75 12 1 SER A 141 ? ? -102.58 -66.06 13 1 LEU A 142 ? ? 45.91 -163.91 14 1 LYS A 143 ? ? -29.02 -80.97 15 1 CYS A 145 ? ? -86.82 -89.68 16 1 GLU A 146 ? ? -144.45 -69.49 17 2 LYS A 61 ? ? 27.29 70.64 18 2 ASP A 67 ? ? -106.53 77.04 19 2 PHE A 70 ? ? -146.97 -10.25 20 2 HIS A 90 ? ? -77.53 -101.40 21 2 TYR A 91 ? ? 72.15 -9.18 22 2 ASN A 92 ? ? 68.61 151.76 23 2 CYS A 94 ? ? 72.95 166.66 24 2 SER A 95 ? ? -164.82 -30.33 25 2 ASN A 116 ? ? -110.62 55.34 26 2 ASP A 124 ? ? -134.43 -56.82 27 2 ASN A 125 ? ? 36.86 93.04 28 2 LYS A 126 ? ? -104.02 -87.46 29 2 CYS A 145 ? ? -73.25 -86.27 30 2 GLU A 146 ? ? -142.73 -70.62 31 2 TRP A 148 ? ? -95.47 39.44 32 3 GLN A 62 ? ? -61.11 5.14 33 3 ASP A 67 ? ? -85.30 44.38 34 3 ALA A 72 ? ? -120.16 -86.05 35 3 ASN A 81 ? ? -154.52 30.78 36 3 ASP A 87 ? ? -135.62 -45.28 37 3 ALA A 103 ? ? -101.44 -63.04 38 3 ASN A 125 ? ? -99.71 44.43 39 3 LYS A 126 ? ? -100.90 -98.66 40 3 SER A 141 ? ? -62.35 -91.27 41 3 LEU A 142 ? ? 26.04 31.97 42 3 LYS A 143 ? ? 179.75 -49.74 43 3 HIS A 144 ? ? 58.65 -175.02 44 3 CYS A 145 ? ? -147.50 -8.28 45 3 GLU A 146 ? ? -109.49 -90.14 46 3 TRP A 148 ? ? -86.47 42.56 47 4 ALA A 58 ? ? 45.46 -156.05 48 4 LYS A 61 ? ? 26.36 85.72 49 4 ASP A 67 ? ? -106.32 76.95 50 4 ALA A 72 ? ? -107.60 -74.69 51 4 ASN A 81 ? ? -143.74 15.68 52 4 HIS A 90 ? ? -116.79 68.35 53 4 TYR A 91 ? ? -160.18 88.93 54 4 GLU A 102 ? ? -79.59 -76.68 55 4 PHE A 120 ? ? -65.00 17.11 56 4 ASN A 125 ? ? 28.01 53.83 57 4 LYS A 126 ? ? -120.21 -101.00 58 4 LEU A 142 ? ? 45.15 -68.87 59 4 HIS A 144 ? ? 40.22 -97.95 60 4 CYS A 145 ? ? -157.66 -75.54 61 4 GLU A 146 ? ? -150.99 -122.88 62 4 PHE A 147 ? ? -0.03 -63.68 63 5 LEU A 66 ? ? -79.67 -169.72 64 5 ALA A 72 ? ? -121.35 -70.69 65 5 ASN A 81 ? ? -172.21 41.69 66 5 PRO A 86 ? ? -67.28 -177.40 67 5 ASP A 87 ? ? -133.95 -53.88 68 5 HIS A 90 ? ? -69.09 24.29 69 5 ASN A 92 ? ? 79.57 152.16 70 5 SER A 95 ? ? -129.87 -53.09 71 5 ASN A 98 ? ? -141.01 16.89 72 5 ASP A 124 ? ? -56.90 -79.37 73 5 LYS A 126 ? ? -80.52 -100.96 74 5 LEU A 142 ? ? -45.00 92.49 75 5 LYS A 143 ? ? 30.26 69.08 76 5 HIS A 144 ? ? 49.77 178.76 77 5 CYS A 145 ? ? -88.77 -87.59 78 5 PHE A 147 ? ? 59.40 -59.39 79 6 PRO A 56 ? ? -70.14 20.79 80 6 LEU A 66 ? ? 52.72 -159.45 81 6 ALA A 72 ? ? -120.32 -95.69 82 6 ASN A 81 ? ? -159.50 40.43 83 6 HIS A 90 ? ? -63.38 -80.71 84 6 ASN A 92 ? ? 46.89 -137.25 85 6 SER A 95 ? ? -140.18 15.72 86 6 LYS A 101 ? ? -67.66 0.49 87 6 ASN A 116 ? ? -140.71 45.07 88 6 GLN A 121 ? ? -84.91 31.24 89 6 LYS A 126 ? ? -19.93 -72.96 90 6 CYS A 145 ? ? -115.06 73.85 91 6 GLU A 146 ? ? 46.78 -156.45 92 6 PHE A 147 ? ? 52.99 -74.65 93 7 ASN A 54 ? ? -69.06 7.67 94 7 LYS A 61 ? ? 17.78 85.18 95 7 GLN A 62 ? ? -94.15 -123.00 96 7 LEU A 66 ? ? 41.93 -153.97 97 7 ALA A 72 ? ? -121.23 -76.96 98 7 ALA A 80 ? ? -52.59 -73.69 99 7 GLN A 84 ? ? -88.03 33.33 100 7 ASP A 87 ? ? -105.31 -60.79 101 7 SER A 95 ? ? -149.84 26.19 102 7 ALA A 97 ? ? -144.00 -7.69 103 7 ASN A 110 ? ? -66.02 0.02 104 7 GLN A 121 ? ? -76.35 -104.80 105 7 LYS A 122 ? ? 54.46 -179.08 106 7 ASP A 124 ? ? 100.67 109.13 107 7 LEU A 142 ? ? 34.72 68.47 108 7 HIS A 144 ? ? 77.19 160.43 109 7 GLU A 146 ? ? -116.85 -87.50 110 7 TRP A 148 ? ? -82.88 38.50 111 8 ASN A 54 ? ? -93.05 45.51 112 8 ASP A 67 ? ? -75.78 43.32 113 8 ALA A 72 ? ? -121.90 -81.72 114 8 ASN A 81 ? ? -162.43 55.23 115 8 HIS A 90 ? ? -91.18 -71.92 116 8 TYR A 91 ? ? 46.29 -154.01 117 8 CYS A 94 ? ? 74.26 88.81 118 8 SER A 95 ? ? -78.46 37.79 119 8 ASN A 98 ? ? -154.62 50.90 120 8 GLU A 102 ? ? -94.59 -62.47 121 8 GLN A 121 ? ? -86.94 -98.73 122 8 LYS A 122 ? ? 52.30 155.09 123 8 ASP A 124 ? ? -146.68 36.70 124 8 ASN A 125 ? ? -68.53 79.80 125 8 LYS A 126 ? ? -97.60 -100.16 126 8 LEU A 142 ? ? 23.60 80.16 127 8 LYS A 143 ? ? 75.54 -31.91 128 8 HIS A 144 ? ? 156.03 -67.48 129 8 CYS A 145 ? ? 150.70 -88.36 130 8 PHE A 147 ? ? 63.87 -55.81 131 8 TRP A 148 ? ? -79.68 43.16 132 9 LYS A 61 ? ? 42.89 74.08 133 9 LEU A 66 ? ? -114.72 -135.74 134 9 ASP A 67 ? ? -143.46 26.98 135 9 ALA A 72 ? ? -122.45 -76.18 136 9 ASN A 81 ? ? -161.45 46.88 137 9 ASP A 87 ? ? -150.40 10.18 138 9 HIS A 90 ? ? -80.21 -85.66 139 9 GLU A 102 ? ? -76.47 -75.99 140 9 ASN A 116 ? ? -114.28 55.92 141 9 ASP A 124 ? ? 60.11 -42.82 142 9 ASN A 125 ? ? -149.76 -143.25 143 9 LYS A 126 ? ? -120.04 -70.82 144 9 HIS A 144 ? ? -29.15 -82.69 145 9 CYS A 145 ? ? 179.77 -83.62 146 9 PHE A 147 ? ? 63.51 -66.18 147 10 LEU A 66 ? ? -105.77 -152.96 148 10 ALA A 72 ? ? -120.63 -84.49 149 10 ASN A 81 ? ? -153.86 46.25 150 10 CYS A 94 ? ? -92.12 -61.55 151 10 SER A 95 ? ? 53.12 78.04 152 10 GLU A 96 ? ? -151.08 -31.05 153 10 ALA A 97 ? ? 83.06 -9.04 154 10 ASN A 98 ? ? -157.83 35.48 155 10 GLU A 102 ? ? -85.43 -73.87 156 10 ASP A 124 ? ? 148.56 109.20 157 10 LYS A 126 ? ? -102.13 -74.40 158 10 SER A 141 ? ? -65.74 -76.58 159 10 LEU A 142 ? ? 36.37 42.35 160 10 LYS A 143 ? ? 123.55 -166.66 161 10 GLU A 146 ? ? -176.49 -57.50 162 11 LYS A 61 ? ? 29.97 62.75 163 11 LEU A 66 ? ? 47.77 -143.99 164 11 ALA A 72 ? ? -120.70 -89.83 165 11 ASN A 81 ? ? -159.17 58.37 166 11 CYS A 94 ? ? 66.24 108.93 167 11 LYS A 101 ? ? -61.24 0.89 168 11 GLN A 121 ? ? -116.98 51.07 169 11 LYS A 126 ? ? -31.75 -77.02 170 11 LEU A 142 ? ? -0.56 90.86 171 11 LYS A 143 ? ? 86.61 -132.31 172 11 CYS A 145 ? ? -107.46 -82.65 173 11 GLU A 146 ? ? -152.32 -83.47 174 12 ALA A 58 ? ? 37.89 -157.12 175 12 ALA A 72 ? ? -121.36 -77.51 176 12 ASN A 81 ? ? -169.24 43.21 177 12 PRO A 86 ? ? -68.03 -178.69 178 12 HIS A 90 ? ? -113.55 53.20 179 12 ASN A 98 ? ? -151.59 67.33 180 12 ASN A 116 ? ? -111.12 59.52 181 12 ASP A 124 ? ? -141.80 -101.38 182 12 ASN A 125 ? ? 58.52 73.77 183 12 LEU A 142 ? ? -7.54 -77.42 184 12 HIS A 144 ? ? -45.87 -77.25 185 12 CYS A 145 ? ? 173.31 -95.46 186 12 PHE A 147 ? ? 62.74 -74.79 187 13 ALA A 58 ? ? 44.91 -149.45 188 13 LYS A 61 ? ? 38.62 62.70 189 13 LEU A 66 ? ? 52.90 -171.32 190 13 ASN A 81 ? ? -140.56 37.12 191 13 GLN A 84 ? ? -96.41 30.34 192 13 ASP A 87 ? ? -127.12 -51.27 193 13 HIS A 90 ? ? -117.03 -93.28 194 13 ASN A 92 ? ? 56.55 15.38 195 13 CYS A 94 ? ? -145.58 -68.19 196 13 SER A 95 ? ? 56.94 -39.23 197 13 ASN A 98 ? ? -142.13 55.48 198 13 LYS A 101 ? ? -61.43 0.47 199 13 PHE A 120 ? ? -68.99 5.25 200 13 ASN A 125 ? ? 41.82 -3.20 201 13 LYS A 126 ? ? -78.02 -93.61 202 13 GLU A 146 ? ? -168.93 -48.64 203 14 LYS A 61 ? ? 56.64 78.36 204 14 ASP A 67 ? ? -102.23 78.83 205 14 ALA A 72 ? ? -108.64 -96.74 206 14 ASN A 81 ? ? -153.67 45.40 207 14 TRP A 83 ? ? -63.16 15.55 208 14 HIS A 90 ? ? -80.60 -118.63 209 14 TYR A 91 ? ? 70.51 140.69 210 14 ALA A 97 ? ? -150.90 16.82 211 14 GLU A 102 ? ? -84.07 -75.88 212 14 ASN A 116 ? ? -116.95 51.63 213 14 LYS A 122 ? ? 53.35 153.85 214 14 ASP A 124 ? ? -168.66 100.63 215 14 LYS A 126 ? ? -88.16 -77.48 216 14 LEU A 142 ? ? 28.79 -88.31 217 14 HIS A 144 ? ? 171.07 179.68 218 14 CYS A 145 ? ? -143.24 39.69 219 14 GLU A 146 ? ? -132.40 -129.90 220 14 TRP A 148 ? ? -79.69 48.23 221 15 ASN A 54 ? ? -62.62 0.09 222 15 LYS A 61 ? ? 38.30 75.15 223 15 ASP A 67 ? ? -111.54 55.40 224 15 ALA A 72 ? ? -120.49 -100.16 225 15 ASN A 81 ? ? -170.00 26.09 226 15 PRO A 86 ? ? -68.21 -173.18 227 15 ASP A 87 ? ? -129.47 -62.32 228 15 HIS A 90 ? ? -67.39 -90.93 229 15 TYR A 91 ? ? 48.23 71.19 230 15 GLU A 96 ? ? -144.95 -36.05 231 15 ASN A 98 ? ? -167.23 75.61 232 15 LYS A 101 ? ? -57.98 1.18 233 15 GLN A 121 ? ? -88.92 49.42 234 15 LYS A 126 ? ? -120.45 -102.82 235 15 SER A 141 ? ? -103.51 -77.62 236 15 LEU A 142 ? ? 46.48 -152.72 237 15 CYS A 145 ? ? -64.97 -83.24 238 15 GLU A 146 ? ? -151.37 -76.16 239 15 TRP A 148 ? ? -90.64 47.34 240 16 LYS A 61 ? ? 42.67 72.70 241 16 ALA A 72 ? ? -121.41 -79.76 242 16 ASN A 81 ? ? -163.05 37.56 243 16 TYR A 91 ? ? 51.98 -149.05 244 16 CYS A 94 ? ? -170.46 66.08 245 16 ASN A 98 ? ? -160.91 79.32 246 16 ASN A 125 ? ? 47.52 -5.07 247 16 LYS A 126 ? ? -82.95 -92.92 248 16 SER A 141 ? ? -72.75 -90.46 249 16 LEU A 142 ? ? 38.62 77.84 250 16 LYS A 143 ? ? 59.95 170.83 251 16 CYS A 145 ? ? -70.39 -83.13 252 16 GLU A 146 ? ? -145.36 -72.34 253 16 TRP A 148 ? ? -93.54 39.51 254 17 LYS A 61 ? ? 39.53 63.64 255 17 LEU A 66 ? ? -69.17 -157.29 256 17 ASP A 67 ? ? -147.15 32.40 257 17 ALA A 72 ? ? -62.31 -73.29 258 17 ALA A 80 ? ? -58.58 -79.01 259 17 ASP A 87 ? ? -152.73 1.89 260 17 CYS A 94 ? ? -96.85 -66.90 261 17 SER A 95 ? ? 70.82 -65.18 262 17 ASN A 98 ? ? -148.30 46.36 263 17 PHE A 120 ? ? -79.40 23.21 264 17 LYS A 126 ? ? -62.93 -77.48 265 17 LEU A 142 ? ? 6.88 67.98 266 17 LYS A 143 ? ? 57.91 119.23 267 17 PHE A 147 ? ? 54.52 -64.28 268 17 TRP A 148 ? ? -79.36 40.02 269 18 GLN A 62 ? ? -61.69 10.89 270 18 ALA A 72 ? ? -120.92 -89.74 271 18 ASN A 81 ? ? -146.76 37.46 272 18 SER A 95 ? ? -130.64 -60.12 273 18 ASN A 116 ? ? -142.54 44.09 274 18 ASN A 125 ? ? 28.36 16.50 275 18 LYS A 126 ? ? -91.57 -100.35 276 18 LEU A 135 ? ? -54.17 -72.35 277 18 SER A 141 ? ? -66.10 -78.08 278 18 LEU A 142 ? ? 36.44 -78.66 279 18 LYS A 143 ? ? -82.18 -102.61 280 18 CYS A 145 ? ? -72.07 -74.24 281 18 GLU A 146 ? ? -151.94 -82.13 282 18 TRP A 148 ? ? -79.61 42.82 283 19 PRO A 56 ? ? -69.25 -87.47 284 19 LYS A 61 ? ? 33.75 65.71 285 19 LEU A 66 ? ? -117.80 -166.47 286 19 ALA A 72 ? ? -120.35 -73.86 287 19 ASN A 81 ? ? -147.71 40.00 288 19 GLN A 84 ? ? -93.49 31.83 289 19 HIS A 90 ? ? -61.38 -81.07 290 19 TYR A 91 ? ? 49.74 -174.25 291 19 CYS A 94 ? ? 80.40 138.12 292 19 SER A 95 ? ? -169.21 92.13 293 19 GLU A 96 ? ? -168.03 -23.32 294 19 ALA A 97 ? ? 77.75 -2.24 295 19 ASN A 98 ? ? -157.58 22.21 296 19 GLU A 102 ? ? -83.17 -79.15 297 19 ASN A 116 ? ? -146.48 38.80 298 19 GLU A 119 ? ? -133.78 -53.27 299 19 HIS A 128 ? ? -29.10 -55.88 300 19 LEU A 142 ? ? 18.89 78.79 301 19 LYS A 143 ? ? 67.68 -110.67 302 19 CYS A 145 ? ? -77.92 -88.95 303 19 GLU A 146 ? ? -155.83 -65.86 304 19 TRP A 148 ? ? -96.32 39.20 305 20 PRO A 56 ? ? -72.38 27.48 306 20 LYS A 61 ? ? 35.73 66.77 307 20 ALA A 72 ? ? -108.74 -100.24 308 20 ASN A 81 ? ? -161.40 50.17 309 20 HIS A 90 ? ? -76.48 -92.88 310 20 ASN A 92 ? ? 65.99 -53.34 311 20 ASN A 98 ? ? -149.04 58.37 312 20 LYS A 101 ? ? -67.08 0.43 313 20 GLU A 119 ? ? -138.03 -45.39 314 20 GLN A 121 ? ? -95.87 34.30 315 20 ASN A 125 ? ? 29.93 42.63 316 20 LYS A 126 ? ? -120.19 -92.13 317 20 SER A 141 ? ? -52.47 -72.92 318 20 LEU A 142 ? ? 32.38 75.36 319 20 LYS A 143 ? ? 56.74 -103.22 320 20 CYS A 145 ? ? -67.61 -80.85 321 20 GLU A 146 ? ? -161.94 -63.00 322 20 TRP A 148 ? ? -103.43 54.31 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 2 GLN A 121 ? ? LYS A 122 ? ? 148.36 2 6 ASN A 92 ? ? GLY A 93 ? ? 143.25 3 6 TRP A 148 ? ? LEU A 149 ? ? 149.95 4 11 LEU A 66 ? ? ASP A 67 ? ? 149.82 5 11 ASP A 124 ? ? ASN A 125 ? ? -148.65 6 15 ASP A 87 ? ? GLY A 88 ? ? 149.38 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 ARG A 55 ? ? 0.093 'SIDE CHAIN' 2 3 ARG A 134 ? ? 0.110 'SIDE CHAIN' 3 4 TYR A 82 ? ? 0.073 'SIDE CHAIN' 4 5 ARG A 76 ? ? 0.109 'SIDE CHAIN' 5 5 TYR A 78 ? ? 0.084 'SIDE CHAIN' 6 6 ARG A 134 ? ? 0.124 'SIDE CHAIN' 7 7 TYR A 78 ? ? 0.085 'SIDE CHAIN' 8 8 TYR A 78 ? ? 0.083 'SIDE CHAIN' 9 10 TYR A 78 ? ? 0.101 'SIDE CHAIN' 10 12 ARG A 64 ? ? 0.119 'SIDE CHAIN' 11 12 TYR A 78 ? ? 0.079 'SIDE CHAIN' 12 13 ARG A 76 ? ? 0.098 'SIDE CHAIN' 13 16 ARG A 76 ? ? 0.083 'SIDE CHAIN' 14 17 ARG A 55 ? ? 0.088 'SIDE CHAIN' 15 18 ARG A 55 ? ? 0.102 'SIDE CHAIN' 16 18 ARG A 76 ? ? 0.081 'SIDE CHAIN' 17 19 TYR A 82 ? ? 0.072 'SIDE CHAIN' 18 20 ARG A 55 ? ? 0.080 'SIDE CHAIN' 19 20 ARG A 76 ? ? 0.088 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 24 ? A VAL 1 2 1 Y 1 A GLN 25 ? A GLN 2 3 1 Y 1 A THR 26 ? A THR 3 4 1 Y 1 A ARG 27 ? A ARG 4 5 1 Y 1 A GLY 28 ? A GLY 5 6 1 Y 1 A ILE 29 ? A ILE 6 7 1 Y 1 A LYS 30 ? A LYS 7 8 1 Y 1 A HIS 31 ? A HIS 8 9 1 Y 1 A ARG 32 ? A ARG 9 10 1 Y 1 A ILE 33 ? A ILE 10 11 1 Y 1 A LYS 34 ? A LYS 11 12 1 Y 1 A TRP 35 ? A TRP 12 13 1 Y 1 A ASN 36 ? A ASN 13 14 1 Y 1 A ARG 37 ? A ARG 14 15 1 Y 1 A LYS 38 ? A LYS 15 16 1 Y 1 A ALA 39 ? A ALA 16 17 1 Y 1 A LEU 40 ? A LEU 17 18 1 Y 1 A PRO 41 ? A PRO 18 19 1 Y 1 A SER 42 ? A SER 19 20 1 Y 1 A THR 43 ? A THR 20 21 1 Y 1 A ALA 44 ? A ALA 21 22 1 Y 1 A GLN 45 ? A GLN 22 23 1 Y 1 A ILE 46 ? A ILE 23 24 1 Y 1 A THR 47 ? A THR 24 25 1 Y 1 A GLU 48 ? A GLU 25 26 1 Y 1 A ALA 49 ? A ALA 26 27 1 Y 1 A GLN 50 ? A GLN 27 28 1 Y 1 A VAL 51 ? A VAL 28 29 1 Y 1 A ARG 151 ? A ARG 128 30 1 Y 1 A GLY 152 ? A GLY 129 31 2 Y 1 A VAL 24 ? A VAL 1 32 2 Y 1 A GLN 25 ? A GLN 2 33 2 Y 1 A THR 26 ? A THR 3 34 2 Y 1 A ARG 27 ? A ARG 4 35 2 Y 1 A GLY 28 ? A GLY 5 36 2 Y 1 A ILE 29 ? A ILE 6 37 2 Y 1 A LYS 30 ? A LYS 7 38 2 Y 1 A HIS 31 ? A HIS 8 39 2 Y 1 A ARG 32 ? A ARG 9 40 2 Y 1 A ILE 33 ? A ILE 10 41 2 Y 1 A LYS 34 ? A LYS 11 42 2 Y 1 A TRP 35 ? A TRP 12 43 2 Y 1 A ASN 36 ? A ASN 13 44 2 Y 1 A ARG 37 ? A ARG 14 45 2 Y 1 A LYS 38 ? A LYS 15 46 2 Y 1 A ALA 39 ? A ALA 16 47 2 Y 1 A LEU 40 ? A LEU 17 48 2 Y 1 A PRO 41 ? A PRO 18 49 2 Y 1 A SER 42 ? A SER 19 50 2 Y 1 A THR 43 ? A THR 20 51 2 Y 1 A ALA 44 ? A ALA 21 52 2 Y 1 A GLN 45 ? A GLN 22 53 2 Y 1 A ILE 46 ? A ILE 23 54 2 Y 1 A THR 47 ? A THR 24 55 2 Y 1 A GLU 48 ? A GLU 25 56 2 Y 1 A ALA 49 ? A ALA 26 57 2 Y 1 A GLN 50 ? A GLN 27 58 2 Y 1 A VAL 51 ? A VAL 28 59 2 Y 1 A ARG 151 ? A ARG 128 60 2 Y 1 A GLY 152 ? A GLY 129 61 3 Y 1 A VAL 24 ? A VAL 1 62 3 Y 1 A GLN 25 ? A GLN 2 63 3 Y 1 A THR 26 ? A THR 3 64 3 Y 1 A ARG 27 ? A ARG 4 65 3 Y 1 A GLY 28 ? A GLY 5 66 3 Y 1 A ILE 29 ? A ILE 6 67 3 Y 1 A LYS 30 ? A LYS 7 68 3 Y 1 A HIS 31 ? A HIS 8 69 3 Y 1 A ARG 32 ? A ARG 9 70 3 Y 1 A ILE 33 ? A ILE 10 71 3 Y 1 A LYS 34 ? A LYS 11 72 3 Y 1 A TRP 35 ? A TRP 12 73 3 Y 1 A ASN 36 ? A ASN 13 74 3 Y 1 A ARG 37 ? A ARG 14 75 3 Y 1 A LYS 38 ? A LYS 15 76 3 Y 1 A ALA 39 ? A ALA 16 77 3 Y 1 A LEU 40 ? A LEU 17 78 3 Y 1 A PRO 41 ? A PRO 18 79 3 Y 1 A SER 42 ? A SER 19 80 3 Y 1 A THR 43 ? A THR 20 81 3 Y 1 A ALA 44 ? A ALA 21 82 3 Y 1 A GLN 45 ? A GLN 22 83 3 Y 1 A ILE 46 ? A ILE 23 84 3 Y 1 A THR 47 ? A THR 24 85 3 Y 1 A GLU 48 ? A GLU 25 86 3 Y 1 A ALA 49 ? A ALA 26 87 3 Y 1 A GLN 50 ? A GLN 27 88 3 Y 1 A VAL 51 ? A VAL 28 89 3 Y 1 A ARG 151 ? A ARG 128 90 3 Y 1 A GLY 152 ? A GLY 129 91 4 Y 1 A VAL 24 ? A VAL 1 92 4 Y 1 A GLN 25 ? A GLN 2 93 4 Y 1 A THR 26 ? A THR 3 94 4 Y 1 A ARG 27 ? A ARG 4 95 4 Y 1 A GLY 28 ? A GLY 5 96 4 Y 1 A ILE 29 ? A ILE 6 97 4 Y 1 A LYS 30 ? A LYS 7 98 4 Y 1 A HIS 31 ? A HIS 8 99 4 Y 1 A ARG 32 ? A ARG 9 100 4 Y 1 A ILE 33 ? A ILE 10 101 4 Y 1 A LYS 34 ? A LYS 11 102 4 Y 1 A TRP 35 ? A TRP 12 103 4 Y 1 A ASN 36 ? A ASN 13 104 4 Y 1 A ARG 37 ? A ARG 14 105 4 Y 1 A LYS 38 ? A LYS 15 106 4 Y 1 A ALA 39 ? A ALA 16 107 4 Y 1 A LEU 40 ? A LEU 17 108 4 Y 1 A PRO 41 ? A PRO 18 109 4 Y 1 A SER 42 ? A SER 19 110 4 Y 1 A THR 43 ? A THR 20 111 4 Y 1 A ALA 44 ? A ALA 21 112 4 Y 1 A GLN 45 ? A GLN 22 113 4 Y 1 A ILE 46 ? A ILE 23 114 4 Y 1 A THR 47 ? A THR 24 115 4 Y 1 A GLU 48 ? A GLU 25 116 4 Y 1 A ALA 49 ? A ALA 26 117 4 Y 1 A GLN 50 ? A GLN 27 118 4 Y 1 A VAL 51 ? A VAL 28 119 4 Y 1 A ARG 151 ? A ARG 128 120 4 Y 1 A GLY 152 ? A GLY 129 121 5 Y 1 A VAL 24 ? A VAL 1 122 5 Y 1 A GLN 25 ? A GLN 2 123 5 Y 1 A THR 26 ? A THR 3 124 5 Y 1 A ARG 27 ? A ARG 4 125 5 Y 1 A GLY 28 ? A GLY 5 126 5 Y 1 A ILE 29 ? A ILE 6 127 5 Y 1 A LYS 30 ? A LYS 7 128 5 Y 1 A HIS 31 ? A HIS 8 129 5 Y 1 A ARG 32 ? A ARG 9 130 5 Y 1 A ILE 33 ? A ILE 10 131 5 Y 1 A LYS 34 ? A LYS 11 132 5 Y 1 A TRP 35 ? A TRP 12 133 5 Y 1 A ASN 36 ? A ASN 13 134 5 Y 1 A ARG 37 ? A ARG 14 135 5 Y 1 A LYS 38 ? A LYS 15 136 5 Y 1 A ALA 39 ? A ALA 16 137 5 Y 1 A LEU 40 ? A LEU 17 138 5 Y 1 A PRO 41 ? A PRO 18 139 5 Y 1 A SER 42 ? A SER 19 140 5 Y 1 A THR 43 ? A THR 20 141 5 Y 1 A ALA 44 ? A ALA 21 142 5 Y 1 A GLN 45 ? A GLN 22 143 5 Y 1 A ILE 46 ? A ILE 23 144 5 Y 1 A THR 47 ? A THR 24 145 5 Y 1 A GLU 48 ? A GLU 25 146 5 Y 1 A ALA 49 ? A ALA 26 147 5 Y 1 A GLN 50 ? A GLN 27 148 5 Y 1 A VAL 51 ? A VAL 28 149 5 Y 1 A ARG 151 ? A ARG 128 150 5 Y 1 A GLY 152 ? A GLY 129 151 6 Y 1 A VAL 24 ? A VAL 1 152 6 Y 1 A GLN 25 ? A GLN 2 153 6 Y 1 A THR 26 ? A THR 3 154 6 Y 1 A ARG 27 ? A ARG 4 155 6 Y 1 A GLY 28 ? A GLY 5 156 6 Y 1 A ILE 29 ? A ILE 6 157 6 Y 1 A LYS 30 ? A LYS 7 158 6 Y 1 A HIS 31 ? A HIS 8 159 6 Y 1 A ARG 32 ? A ARG 9 160 6 Y 1 A ILE 33 ? A ILE 10 161 6 Y 1 A LYS 34 ? A LYS 11 162 6 Y 1 A TRP 35 ? A TRP 12 163 6 Y 1 A ASN 36 ? A ASN 13 164 6 Y 1 A ARG 37 ? A ARG 14 165 6 Y 1 A LYS 38 ? A LYS 15 166 6 Y 1 A ALA 39 ? A ALA 16 167 6 Y 1 A LEU 40 ? A LEU 17 168 6 Y 1 A PRO 41 ? A PRO 18 169 6 Y 1 A SER 42 ? A SER 19 170 6 Y 1 A THR 43 ? A THR 20 171 6 Y 1 A ALA 44 ? A ALA 21 172 6 Y 1 A GLN 45 ? A GLN 22 173 6 Y 1 A ILE 46 ? A ILE 23 174 6 Y 1 A THR 47 ? A THR 24 175 6 Y 1 A GLU 48 ? A GLU 25 176 6 Y 1 A ALA 49 ? A ALA 26 177 6 Y 1 A GLN 50 ? A GLN 27 178 6 Y 1 A VAL 51 ? A VAL 28 179 6 Y 1 A ARG 151 ? A ARG 128 180 6 Y 1 A GLY 152 ? A GLY 129 181 7 Y 1 A VAL 24 ? A VAL 1 182 7 Y 1 A GLN 25 ? A GLN 2 183 7 Y 1 A THR 26 ? A THR 3 184 7 Y 1 A ARG 27 ? A ARG 4 185 7 Y 1 A GLY 28 ? A GLY 5 186 7 Y 1 A ILE 29 ? A ILE 6 187 7 Y 1 A LYS 30 ? A LYS 7 188 7 Y 1 A HIS 31 ? A HIS 8 189 7 Y 1 A ARG 32 ? A ARG 9 190 7 Y 1 A ILE 33 ? A ILE 10 191 7 Y 1 A LYS 34 ? A LYS 11 192 7 Y 1 A TRP 35 ? A TRP 12 193 7 Y 1 A ASN 36 ? A ASN 13 194 7 Y 1 A ARG 37 ? A ARG 14 195 7 Y 1 A LYS 38 ? A LYS 15 196 7 Y 1 A ALA 39 ? A ALA 16 197 7 Y 1 A LEU 40 ? A LEU 17 198 7 Y 1 A PRO 41 ? A PRO 18 199 7 Y 1 A SER 42 ? A SER 19 200 7 Y 1 A THR 43 ? A THR 20 201 7 Y 1 A ALA 44 ? A ALA 21 202 7 Y 1 A GLN 45 ? A GLN 22 203 7 Y 1 A ILE 46 ? A ILE 23 204 7 Y 1 A THR 47 ? A THR 24 205 7 Y 1 A GLU 48 ? A GLU 25 206 7 Y 1 A ALA 49 ? A ALA 26 207 7 Y 1 A GLN 50 ? A GLN 27 208 7 Y 1 A VAL 51 ? A VAL 28 209 7 Y 1 A ARG 151 ? A ARG 128 210 7 Y 1 A GLY 152 ? A GLY 129 211 8 Y 1 A VAL 24 ? A VAL 1 212 8 Y 1 A GLN 25 ? A GLN 2 213 8 Y 1 A THR 26 ? A THR 3 214 8 Y 1 A ARG 27 ? A ARG 4 215 8 Y 1 A GLY 28 ? A GLY 5 216 8 Y 1 A ILE 29 ? A ILE 6 217 8 Y 1 A LYS 30 ? A LYS 7 218 8 Y 1 A HIS 31 ? A HIS 8 219 8 Y 1 A ARG 32 ? A ARG 9 220 8 Y 1 A ILE 33 ? A ILE 10 221 8 Y 1 A LYS 34 ? A LYS 11 222 8 Y 1 A TRP 35 ? A TRP 12 223 8 Y 1 A ASN 36 ? A ASN 13 224 8 Y 1 A ARG 37 ? A ARG 14 225 8 Y 1 A LYS 38 ? A LYS 15 226 8 Y 1 A ALA 39 ? A ALA 16 227 8 Y 1 A LEU 40 ? A LEU 17 228 8 Y 1 A PRO 41 ? A PRO 18 229 8 Y 1 A SER 42 ? A SER 19 230 8 Y 1 A THR 43 ? A THR 20 231 8 Y 1 A ALA 44 ? A ALA 21 232 8 Y 1 A GLN 45 ? A GLN 22 233 8 Y 1 A ILE 46 ? A ILE 23 234 8 Y 1 A THR 47 ? A THR 24 235 8 Y 1 A GLU 48 ? A GLU 25 236 8 Y 1 A ALA 49 ? A ALA 26 237 8 Y 1 A GLN 50 ? A GLN 27 238 8 Y 1 A VAL 51 ? A VAL 28 239 8 Y 1 A ARG 151 ? A ARG 128 240 8 Y 1 A GLY 152 ? A GLY 129 241 9 Y 1 A VAL 24 ? A VAL 1 242 9 Y 1 A GLN 25 ? A GLN 2 243 9 Y 1 A THR 26 ? A THR 3 244 9 Y 1 A ARG 27 ? A ARG 4 245 9 Y 1 A GLY 28 ? A GLY 5 246 9 Y 1 A ILE 29 ? A ILE 6 247 9 Y 1 A LYS 30 ? A LYS 7 248 9 Y 1 A HIS 31 ? A HIS 8 249 9 Y 1 A ARG 32 ? A ARG 9 250 9 Y 1 A ILE 33 ? A ILE 10 251 9 Y 1 A LYS 34 ? A LYS 11 252 9 Y 1 A TRP 35 ? A TRP 12 253 9 Y 1 A ASN 36 ? A ASN 13 254 9 Y 1 A ARG 37 ? A ARG 14 255 9 Y 1 A LYS 38 ? A LYS 15 256 9 Y 1 A ALA 39 ? A ALA 16 257 9 Y 1 A LEU 40 ? A LEU 17 258 9 Y 1 A PRO 41 ? A PRO 18 259 9 Y 1 A SER 42 ? A SER 19 260 9 Y 1 A THR 43 ? A THR 20 261 9 Y 1 A ALA 44 ? A ALA 21 262 9 Y 1 A GLN 45 ? A GLN 22 263 9 Y 1 A ILE 46 ? A ILE 23 264 9 Y 1 A THR 47 ? A THR 24 265 9 Y 1 A GLU 48 ? A GLU 25 266 9 Y 1 A ALA 49 ? A ALA 26 267 9 Y 1 A GLN 50 ? A GLN 27 268 9 Y 1 A VAL 51 ? A VAL 28 269 9 Y 1 A ARG 151 ? A ARG 128 270 9 Y 1 A GLY 152 ? A GLY 129 271 10 Y 1 A VAL 24 ? A VAL 1 272 10 Y 1 A GLN 25 ? A GLN 2 273 10 Y 1 A THR 26 ? A THR 3 274 10 Y 1 A ARG 27 ? A ARG 4 275 10 Y 1 A GLY 28 ? A GLY 5 276 10 Y 1 A ILE 29 ? A ILE 6 277 10 Y 1 A LYS 30 ? A LYS 7 278 10 Y 1 A HIS 31 ? A HIS 8 279 10 Y 1 A ARG 32 ? A ARG 9 280 10 Y 1 A ILE 33 ? A ILE 10 281 10 Y 1 A LYS 34 ? A LYS 11 282 10 Y 1 A TRP 35 ? A TRP 12 283 10 Y 1 A ASN 36 ? A ASN 13 284 10 Y 1 A ARG 37 ? A ARG 14 285 10 Y 1 A LYS 38 ? A LYS 15 286 10 Y 1 A ALA 39 ? A ALA 16 287 10 Y 1 A LEU 40 ? A LEU 17 288 10 Y 1 A PRO 41 ? A PRO 18 289 10 Y 1 A SER 42 ? A SER 19 290 10 Y 1 A THR 43 ? A THR 20 291 10 Y 1 A ALA 44 ? A ALA 21 292 10 Y 1 A GLN 45 ? A GLN 22 293 10 Y 1 A ILE 46 ? A ILE 23 294 10 Y 1 A THR 47 ? A THR 24 295 10 Y 1 A GLU 48 ? A GLU 25 296 10 Y 1 A ALA 49 ? A ALA 26 297 10 Y 1 A GLN 50 ? A GLN 27 298 10 Y 1 A VAL 51 ? A VAL 28 299 10 Y 1 A ARG 151 ? A ARG 128 300 10 Y 1 A GLY 152 ? A GLY 129 301 11 Y 1 A VAL 24 ? A VAL 1 302 11 Y 1 A GLN 25 ? A GLN 2 303 11 Y 1 A THR 26 ? A THR 3 304 11 Y 1 A ARG 27 ? A ARG 4 305 11 Y 1 A GLY 28 ? A GLY 5 306 11 Y 1 A ILE 29 ? A ILE 6 307 11 Y 1 A LYS 30 ? A LYS 7 308 11 Y 1 A HIS 31 ? A HIS 8 309 11 Y 1 A ARG 32 ? A ARG 9 310 11 Y 1 A ILE 33 ? A ILE 10 311 11 Y 1 A LYS 34 ? A LYS 11 312 11 Y 1 A TRP 35 ? A TRP 12 313 11 Y 1 A ASN 36 ? A ASN 13 314 11 Y 1 A ARG 37 ? A ARG 14 315 11 Y 1 A LYS 38 ? A LYS 15 316 11 Y 1 A ALA 39 ? A ALA 16 317 11 Y 1 A LEU 40 ? A LEU 17 318 11 Y 1 A PRO 41 ? A PRO 18 319 11 Y 1 A SER 42 ? A SER 19 320 11 Y 1 A THR 43 ? A THR 20 321 11 Y 1 A ALA 44 ? A ALA 21 322 11 Y 1 A GLN 45 ? A GLN 22 323 11 Y 1 A ILE 46 ? A ILE 23 324 11 Y 1 A THR 47 ? A THR 24 325 11 Y 1 A GLU 48 ? A GLU 25 326 11 Y 1 A ALA 49 ? A ALA 26 327 11 Y 1 A GLN 50 ? A GLN 27 328 11 Y 1 A VAL 51 ? A VAL 28 329 11 Y 1 A ARG 151 ? A ARG 128 330 11 Y 1 A GLY 152 ? A GLY 129 331 12 Y 1 A VAL 24 ? A VAL 1 332 12 Y 1 A GLN 25 ? A GLN 2 333 12 Y 1 A THR 26 ? A THR 3 334 12 Y 1 A ARG 27 ? A ARG 4 335 12 Y 1 A GLY 28 ? A GLY 5 336 12 Y 1 A ILE 29 ? A ILE 6 337 12 Y 1 A LYS 30 ? A LYS 7 338 12 Y 1 A HIS 31 ? A HIS 8 339 12 Y 1 A ARG 32 ? A ARG 9 340 12 Y 1 A ILE 33 ? A ILE 10 341 12 Y 1 A LYS 34 ? A LYS 11 342 12 Y 1 A TRP 35 ? A TRP 12 343 12 Y 1 A ASN 36 ? A ASN 13 344 12 Y 1 A ARG 37 ? A ARG 14 345 12 Y 1 A LYS 38 ? A LYS 15 346 12 Y 1 A ALA 39 ? A ALA 16 347 12 Y 1 A LEU 40 ? A LEU 17 348 12 Y 1 A PRO 41 ? A PRO 18 349 12 Y 1 A SER 42 ? A SER 19 350 12 Y 1 A THR 43 ? A THR 20 351 12 Y 1 A ALA 44 ? A ALA 21 352 12 Y 1 A GLN 45 ? A GLN 22 353 12 Y 1 A ILE 46 ? A ILE 23 354 12 Y 1 A THR 47 ? A THR 24 355 12 Y 1 A GLU 48 ? A GLU 25 356 12 Y 1 A ALA 49 ? A ALA 26 357 12 Y 1 A GLN 50 ? A GLN 27 358 12 Y 1 A VAL 51 ? A VAL 28 359 12 Y 1 A ARG 151 ? A ARG 128 360 12 Y 1 A GLY 152 ? A GLY 129 361 13 Y 1 A VAL 24 ? A VAL 1 362 13 Y 1 A GLN 25 ? A GLN 2 363 13 Y 1 A THR 26 ? A THR 3 364 13 Y 1 A ARG 27 ? A ARG 4 365 13 Y 1 A GLY 28 ? A GLY 5 366 13 Y 1 A ILE 29 ? A ILE 6 367 13 Y 1 A LYS 30 ? A LYS 7 368 13 Y 1 A HIS 31 ? A HIS 8 369 13 Y 1 A ARG 32 ? A ARG 9 370 13 Y 1 A ILE 33 ? A ILE 10 371 13 Y 1 A LYS 34 ? A LYS 11 372 13 Y 1 A TRP 35 ? A TRP 12 373 13 Y 1 A ASN 36 ? A ASN 13 374 13 Y 1 A ARG 37 ? A ARG 14 375 13 Y 1 A LYS 38 ? A LYS 15 376 13 Y 1 A ALA 39 ? A ALA 16 377 13 Y 1 A LEU 40 ? A LEU 17 378 13 Y 1 A PRO 41 ? A PRO 18 379 13 Y 1 A SER 42 ? A SER 19 380 13 Y 1 A THR 43 ? A THR 20 381 13 Y 1 A ALA 44 ? A ALA 21 382 13 Y 1 A GLN 45 ? A GLN 22 383 13 Y 1 A ILE 46 ? A ILE 23 384 13 Y 1 A THR 47 ? A THR 24 385 13 Y 1 A GLU 48 ? A GLU 25 386 13 Y 1 A ALA 49 ? A ALA 26 387 13 Y 1 A GLN 50 ? A GLN 27 388 13 Y 1 A VAL 51 ? A VAL 28 389 13 Y 1 A ARG 151 ? A ARG 128 390 13 Y 1 A GLY 152 ? A GLY 129 391 14 Y 1 A VAL 24 ? A VAL 1 392 14 Y 1 A GLN 25 ? A GLN 2 393 14 Y 1 A THR 26 ? A THR 3 394 14 Y 1 A ARG 27 ? A ARG 4 395 14 Y 1 A GLY 28 ? A GLY 5 396 14 Y 1 A ILE 29 ? A ILE 6 397 14 Y 1 A LYS 30 ? A LYS 7 398 14 Y 1 A HIS 31 ? A HIS 8 399 14 Y 1 A ARG 32 ? A ARG 9 400 14 Y 1 A ILE 33 ? A ILE 10 401 14 Y 1 A LYS 34 ? A LYS 11 402 14 Y 1 A TRP 35 ? A TRP 12 403 14 Y 1 A ASN 36 ? A ASN 13 404 14 Y 1 A ARG 37 ? A ARG 14 405 14 Y 1 A LYS 38 ? A LYS 15 406 14 Y 1 A ALA 39 ? A ALA 16 407 14 Y 1 A LEU 40 ? A LEU 17 408 14 Y 1 A PRO 41 ? A PRO 18 409 14 Y 1 A SER 42 ? A SER 19 410 14 Y 1 A THR 43 ? A THR 20 411 14 Y 1 A ALA 44 ? A ALA 21 412 14 Y 1 A GLN 45 ? A GLN 22 413 14 Y 1 A ILE 46 ? A ILE 23 414 14 Y 1 A THR 47 ? A THR 24 415 14 Y 1 A GLU 48 ? A GLU 25 416 14 Y 1 A ALA 49 ? A ALA 26 417 14 Y 1 A GLN 50 ? A GLN 27 418 14 Y 1 A VAL 51 ? A VAL 28 419 14 Y 1 A ARG 151 ? A ARG 128 420 14 Y 1 A GLY 152 ? A GLY 129 421 15 Y 1 A VAL 24 ? A VAL 1 422 15 Y 1 A GLN 25 ? A GLN 2 423 15 Y 1 A THR 26 ? A THR 3 424 15 Y 1 A ARG 27 ? A ARG 4 425 15 Y 1 A GLY 28 ? A GLY 5 426 15 Y 1 A ILE 29 ? A ILE 6 427 15 Y 1 A LYS 30 ? A LYS 7 428 15 Y 1 A HIS 31 ? A HIS 8 429 15 Y 1 A ARG 32 ? A ARG 9 430 15 Y 1 A ILE 33 ? A ILE 10 431 15 Y 1 A LYS 34 ? A LYS 11 432 15 Y 1 A TRP 35 ? A TRP 12 433 15 Y 1 A ASN 36 ? A ASN 13 434 15 Y 1 A ARG 37 ? A ARG 14 435 15 Y 1 A LYS 38 ? A LYS 15 436 15 Y 1 A ALA 39 ? A ALA 16 437 15 Y 1 A LEU 40 ? A LEU 17 438 15 Y 1 A PRO 41 ? A PRO 18 439 15 Y 1 A SER 42 ? A SER 19 440 15 Y 1 A THR 43 ? A THR 20 441 15 Y 1 A ALA 44 ? A ALA 21 442 15 Y 1 A GLN 45 ? A GLN 22 443 15 Y 1 A ILE 46 ? A ILE 23 444 15 Y 1 A THR 47 ? A THR 24 445 15 Y 1 A GLU 48 ? A GLU 25 446 15 Y 1 A ALA 49 ? A ALA 26 447 15 Y 1 A GLN 50 ? A GLN 27 448 15 Y 1 A VAL 51 ? A VAL 28 449 15 Y 1 A ARG 151 ? A ARG 128 450 15 Y 1 A GLY 152 ? A GLY 129 451 16 Y 1 A VAL 24 ? A VAL 1 452 16 Y 1 A GLN 25 ? A GLN 2 453 16 Y 1 A THR 26 ? A THR 3 454 16 Y 1 A ARG 27 ? A ARG 4 455 16 Y 1 A GLY 28 ? A GLY 5 456 16 Y 1 A ILE 29 ? A ILE 6 457 16 Y 1 A LYS 30 ? A LYS 7 458 16 Y 1 A HIS 31 ? A HIS 8 459 16 Y 1 A ARG 32 ? A ARG 9 460 16 Y 1 A ILE 33 ? A ILE 10 461 16 Y 1 A LYS 34 ? A LYS 11 462 16 Y 1 A TRP 35 ? A TRP 12 463 16 Y 1 A ASN 36 ? A ASN 13 464 16 Y 1 A ARG 37 ? A ARG 14 465 16 Y 1 A LYS 38 ? A LYS 15 466 16 Y 1 A ALA 39 ? A ALA 16 467 16 Y 1 A LEU 40 ? A LEU 17 468 16 Y 1 A PRO 41 ? A PRO 18 469 16 Y 1 A SER 42 ? A SER 19 470 16 Y 1 A THR 43 ? A THR 20 471 16 Y 1 A ALA 44 ? A ALA 21 472 16 Y 1 A GLN 45 ? A GLN 22 473 16 Y 1 A ILE 46 ? A ILE 23 474 16 Y 1 A THR 47 ? A THR 24 475 16 Y 1 A GLU 48 ? A GLU 25 476 16 Y 1 A ALA 49 ? A ALA 26 477 16 Y 1 A GLN 50 ? A GLN 27 478 16 Y 1 A VAL 51 ? A VAL 28 479 16 Y 1 A ARG 151 ? A ARG 128 480 16 Y 1 A GLY 152 ? A GLY 129 481 17 Y 1 A VAL 24 ? A VAL 1 482 17 Y 1 A GLN 25 ? A GLN 2 483 17 Y 1 A THR 26 ? A THR 3 484 17 Y 1 A ARG 27 ? A ARG 4 485 17 Y 1 A GLY 28 ? A GLY 5 486 17 Y 1 A ILE 29 ? A ILE 6 487 17 Y 1 A LYS 30 ? A LYS 7 488 17 Y 1 A HIS 31 ? A HIS 8 489 17 Y 1 A ARG 32 ? A ARG 9 490 17 Y 1 A ILE 33 ? A ILE 10 491 17 Y 1 A LYS 34 ? A LYS 11 492 17 Y 1 A TRP 35 ? A TRP 12 493 17 Y 1 A ASN 36 ? A ASN 13 494 17 Y 1 A ARG 37 ? A ARG 14 495 17 Y 1 A LYS 38 ? A LYS 15 496 17 Y 1 A ALA 39 ? A ALA 16 497 17 Y 1 A LEU 40 ? A LEU 17 498 17 Y 1 A PRO 41 ? A PRO 18 499 17 Y 1 A SER 42 ? A SER 19 500 17 Y 1 A THR 43 ? A THR 20 501 17 Y 1 A ALA 44 ? A ALA 21 502 17 Y 1 A GLN 45 ? A GLN 22 503 17 Y 1 A ILE 46 ? A ILE 23 504 17 Y 1 A THR 47 ? A THR 24 505 17 Y 1 A GLU 48 ? A GLU 25 506 17 Y 1 A ALA 49 ? A ALA 26 507 17 Y 1 A GLN 50 ? A GLN 27 508 17 Y 1 A VAL 51 ? A VAL 28 509 17 Y 1 A ARG 151 ? A ARG 128 510 17 Y 1 A GLY 152 ? A GLY 129 511 18 Y 1 A VAL 24 ? A VAL 1 512 18 Y 1 A GLN 25 ? A GLN 2 513 18 Y 1 A THR 26 ? A THR 3 514 18 Y 1 A ARG 27 ? A ARG 4 515 18 Y 1 A GLY 28 ? A GLY 5 516 18 Y 1 A ILE 29 ? A ILE 6 517 18 Y 1 A LYS 30 ? A LYS 7 518 18 Y 1 A HIS 31 ? A HIS 8 519 18 Y 1 A ARG 32 ? A ARG 9 520 18 Y 1 A ILE 33 ? A ILE 10 521 18 Y 1 A LYS 34 ? A LYS 11 522 18 Y 1 A TRP 35 ? A TRP 12 523 18 Y 1 A ASN 36 ? A ASN 13 524 18 Y 1 A ARG 37 ? A ARG 14 525 18 Y 1 A LYS 38 ? A LYS 15 526 18 Y 1 A ALA 39 ? A ALA 16 527 18 Y 1 A LEU 40 ? A LEU 17 528 18 Y 1 A PRO 41 ? A PRO 18 529 18 Y 1 A SER 42 ? A SER 19 530 18 Y 1 A THR 43 ? A THR 20 531 18 Y 1 A ALA 44 ? A ALA 21 532 18 Y 1 A GLN 45 ? A GLN 22 533 18 Y 1 A ILE 46 ? A ILE 23 534 18 Y 1 A THR 47 ? A THR 24 535 18 Y 1 A GLU 48 ? A GLU 25 536 18 Y 1 A ALA 49 ? A ALA 26 537 18 Y 1 A GLN 50 ? A GLN 27 538 18 Y 1 A VAL 51 ? A VAL 28 539 18 Y 1 A ARG 151 ? A ARG 128 540 18 Y 1 A GLY 152 ? A GLY 129 541 19 Y 1 A VAL 24 ? A VAL 1 542 19 Y 1 A GLN 25 ? A GLN 2 543 19 Y 1 A THR 26 ? A THR 3 544 19 Y 1 A ARG 27 ? A ARG 4 545 19 Y 1 A GLY 28 ? A GLY 5 546 19 Y 1 A ILE 29 ? A ILE 6 547 19 Y 1 A LYS 30 ? A LYS 7 548 19 Y 1 A HIS 31 ? A HIS 8 549 19 Y 1 A ARG 32 ? A ARG 9 550 19 Y 1 A ILE 33 ? A ILE 10 551 19 Y 1 A LYS 34 ? A LYS 11 552 19 Y 1 A TRP 35 ? A TRP 12 553 19 Y 1 A ASN 36 ? A ASN 13 554 19 Y 1 A ARG 37 ? A ARG 14 555 19 Y 1 A LYS 38 ? A LYS 15 556 19 Y 1 A ALA 39 ? A ALA 16 557 19 Y 1 A LEU 40 ? A LEU 17 558 19 Y 1 A PRO 41 ? A PRO 18 559 19 Y 1 A SER 42 ? A SER 19 560 19 Y 1 A THR 43 ? A THR 20 561 19 Y 1 A ALA 44 ? A ALA 21 562 19 Y 1 A GLN 45 ? A GLN 22 563 19 Y 1 A ILE 46 ? A ILE 23 564 19 Y 1 A THR 47 ? A THR 24 565 19 Y 1 A GLU 48 ? A GLU 25 566 19 Y 1 A ALA 49 ? A ALA 26 567 19 Y 1 A GLN 50 ? A GLN 27 568 19 Y 1 A VAL 51 ? A VAL 28 569 19 Y 1 A ARG 151 ? A ARG 128 570 19 Y 1 A GLY 152 ? A GLY 129 571 20 Y 1 A VAL 24 ? A VAL 1 572 20 Y 1 A GLN 25 ? A GLN 2 573 20 Y 1 A THR 26 ? A THR 3 574 20 Y 1 A ARG 27 ? A ARG 4 575 20 Y 1 A GLY 28 ? A GLY 5 576 20 Y 1 A ILE 29 ? A ILE 6 577 20 Y 1 A LYS 30 ? A LYS 7 578 20 Y 1 A HIS 31 ? A HIS 8 579 20 Y 1 A ARG 32 ? A ARG 9 580 20 Y 1 A ILE 33 ? A ILE 10 581 20 Y 1 A LYS 34 ? A LYS 11 582 20 Y 1 A TRP 35 ? A TRP 12 583 20 Y 1 A ASN 36 ? A ASN 13 584 20 Y 1 A ARG 37 ? A ARG 14 585 20 Y 1 A LYS 38 ? A LYS 15 586 20 Y 1 A ALA 39 ? A ALA 16 587 20 Y 1 A LEU 40 ? A LEU 17 588 20 Y 1 A PRO 41 ? A PRO 18 589 20 Y 1 A SER 42 ? A SER 19 590 20 Y 1 A THR 43 ? A THR 20 591 20 Y 1 A ALA 44 ? A ALA 21 592 20 Y 1 A GLN 45 ? A GLN 22 593 20 Y 1 A ILE 46 ? A ILE 23 594 20 Y 1 A THR 47 ? A THR 24 595 20 Y 1 A GLU 48 ? A GLU 25 596 20 Y 1 A ALA 49 ? A ALA 26 597 20 Y 1 A GLN 50 ? A GLN 27 598 20 Y 1 A VAL 51 ? A VAL 28 599 20 Y 1 A ARG 151 ? A ARG 128 600 20 Y 1 A GLY 152 ? A GLY 129 #