data_1LGL # _entry.id 1LGL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1LGL pdb_00001lgl 10.2210/pdb1lgl/pdb RCSB RCSB015932 ? ? WWPDB D_1000015932 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-11-20 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' pdbx_entry_details 7 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LGL _pdbx_database_status.recvd_initial_deposition_date 2002-04-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 5184 _pdbx_database_related.details 'Proton chemical shifts and coupling constants of BeKm-1' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Korolokova, Y.V.' 1 'Bocharov, E.V.' 2 'Angelo, K.' 3 'Maslennikov, I.V.' 4 'Grinenko, O.V.' 5 'Lipkin, A.V.' 6 'Nosireva, E.D.' 7 'Pluzhnikov, K.A.' 8 'Olesen, S.-P.' 9 'Arseniev, A.S.' 10 'Grishin, E.V.' 11 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'New binding site on common molecular scaffold provides HERG channel specificity of scorpion toxin BeKm-1.' J.Biol.Chem. 277 43104 43109 2002 JBCHA3 US 0021-9258 0071 ? 12151390 10.1074/jbc.M204083200 1 'An ERG Channel Inhibitor from the Scorpion Buthus eupeus' J.Biol.Chem. 276 9868 9876 2001 JBCHA3 US 0021-9258 0071 ? ? 10.1074/jbc.M005973200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Korolkova, Y.V.' 1 ? primary 'Bocharov, E.V.' 2 ? primary 'Angelo, K.' 3 ? primary 'Maslennikov, I.V.' 4 ? primary 'Grinenko, O.V.' 5 ? primary 'Lipkin, A.V.' 6 ? primary 'Nosyreva, E.D.' 7 ? primary 'Pluzhnikov, K.A.' 8 ? primary 'Olesen, S.P.' 9 ? primary 'Arseniev, A.S.' 10 ? primary 'Grishin, E.V.' 11 ? 1 'Korolkova, Y.V.' 12 ? 1 'Kozlov, S.A.' 13 ? 1 'Lipkin, A.V.' 14 ? 1 'Pluzhnikov, K.A.' 15 ? 1 'Hadley, J.K.' 16 ? 1 'Filippov, A.K.' 17 ? 1 'Brown, D.A.' 18 ? 1 'Angelo, K.' 19 ? 1 'Strobek, D.' 20 ? 1 'Jespersen, T.' 21 ? 1 'Olesen, S.P.' 22 ? 1 'Jensen, B.S.' 23 ? 1 'Grishin, E.V.' 24 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'BeKm-1 toxin' _entity.formula_weight 4103.730 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF _entity_poly.pdbx_seq_one_letter_code_can RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 PRO n 1 3 THR n 1 4 ASP n 1 5 ILE n 1 6 LYS n 1 7 CYS n 1 8 SER n 1 9 GLU n 1 10 SER n 1 11 TYR n 1 12 GLN n 1 13 CYS n 1 14 PHE n 1 15 PRO n 1 16 VAL n 1 17 CYS n 1 18 LYS n 1 19 SER n 1 20 ARG n 1 21 PHE n 1 22 GLY n 1 23 LYS n 1 24 THR n 1 25 ASN n 1 26 GLY n 1 27 ARG n 1 28 CYS n 1 29 VAL n 1 30 ASN n 1 31 GLY n 1 32 PHE n 1 33 CYS n 1 34 ASP n 1 35 CYS n 1 36 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'lesser Asian scorpion' _entity_src_gen.gene_src_genus Mesobuthus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mesobuthus eupeus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 34648 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain HB101 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PEZZ18 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 1 1 ARG ARG A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 PHE 36 36 36 PHE PHE A . n # _exptl.entry_id 1LGL _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1LGL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1LGL _struct.title 'Solution structure of HERG-specific scorpion toxin BeKm-1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1LGL _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'ALPHA-BETA MOTIF, CYSTEINE-KNOT MOTIF, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SEKM_BUTEU _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_db_accession Q9BKB7 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1LGL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9BKB7 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 57 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 36 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 9 ? GLN A 12 ? GLU A 9 GLN A 12 5 ? 4 HELX_P HELX_P2 2 CYS A 13 ? PHE A 21 ? CYS A 13 PHE A 21 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 7 A CYS 28 1_555 ? ? ? ? ? ? ? 2.008 ? ? disulf2 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 13 A CYS 33 1_555 ? ? ? ? ? ? ? 2.177 ? ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 17 A CYS 35 1_555 ? ? ? ? ? ? ? 1.931 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 7 ? CYS A 28 ? CYS A 7 ? 1_555 CYS A 28 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 13 ? CYS A 33 ? CYS A 13 ? 1_555 CYS A 33 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 17 ? CYS A 35 ? CYS A 17 ? 1_555 CYS A 35 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PRO A 2 ? LYS A 6 ? PRO A 2 LYS A 6 A 2 PHE A 32 ? PHE A 36 ? PHE A 32 PHE A 36 A 3 ASN A 25 ? VAL A 29 ? ASN A 25 VAL A 29 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 5 ? O ILE A 5 N CYS A 33 ? N CYS A 33 A 2 3 N PHE A 36 ? N PHE A 36 O ASN A 25 ? O ASN A 25 # _pdbx_entry_details.entry_id 1LGL _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 3 ? ? -127.12 -161.28 2 2 THR A 3 ? ? -126.95 -164.54 3 3 THR A 3 ? ? -125.60 -164.29 4 6 THR A 3 ? ? -126.54 -165.06 5 8 THR A 3 ? ? -124.99 -164.67 6 10 THR A 3 ? ? -126.41 -162.36 7 12 THR A 3 ? ? -123.47 -162.14 8 15 THR A 3 ? ? -126.62 -164.11 9 16 THR A 3 ? ? -123.98 -164.44 10 18 THR A 3 ? ? -126.98 -159.58 11 20 THR A 3 ? ? -129.39 -159.61 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 10 ARG A 27 ? ? 0.101 'SIDE CHAIN' 2 15 ARG A 27 ? ? 0.113 'SIDE CHAIN' 3 16 ARG A 1 ? ? 0.110 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1LGL _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1LGL _pdbx_nmr_representative.conformer_id 5 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1 mM BeKm-1, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '1 mM BeKm-1, 99.9% D2O' '99.9% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 3.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 DQF-COSY 2 1 1 '2D TOCSY' 3 1 1 '2D NOESY' 4 2 1 DQF-COSY 5 2 1 '2D TOCSY' 6 2 1 '2D NOESY' # _pdbx_nmr_details.entry_id 1LGL _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_refine.entry_id 1LGL _pdbx_nmr_refine.method 'simulated annealing combined with torsion angle dynamics' _pdbx_nmr_refine.details ;The structures are based on a total of 653 restraints: 326/67 are NOE-derived upper/lower distance constraints, 68/46 backbone/sidechain dihedral angle restraints, 64/64 upper/lower distance restraints from 23 (18 bb-bb, 5 bb-sc) hydrogen bonds, 9/9 upper/lower distance restraints from 3 SS-bonds. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 5.3b collection VARIAN 1 VNMR 5.3b processing VARIAN 2 XEASY 1.2.11 'data analysis' Bartels 3 DYANA 1.5 'structure solution' Guentert 4 FANTOM 4 refinement Schaumann 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 ILE N N N N 124 ILE CA C N S 125 ILE C C N N 126 ILE O O N N 127 ILE CB C N S 128 ILE CG1 C N N 129 ILE CG2 C N N 130 ILE CD1 C N N 131 ILE OXT O N N 132 ILE H H N N 133 ILE H2 H N N 134 ILE HA H N N 135 ILE HB H N N 136 ILE HG12 H N N 137 ILE HG13 H N N 138 ILE HG21 H N N 139 ILE HG22 H N N 140 ILE HG23 H N N 141 ILE HD11 H N N 142 ILE HD12 H N N 143 ILE HD13 H N N 144 ILE HXT H N N 145 LYS N N N N 146 LYS CA C N S 147 LYS C C N N 148 LYS O O N N 149 LYS CB C N N 150 LYS CG C N N 151 LYS CD C N N 152 LYS CE C N N 153 LYS NZ N N N 154 LYS OXT O N N 155 LYS H H N N 156 LYS H2 H N N 157 LYS HA H N N 158 LYS HB2 H N N 159 LYS HB3 H N N 160 LYS HG2 H N N 161 LYS HG3 H N N 162 LYS HD2 H N N 163 LYS HD3 H N N 164 LYS HE2 H N N 165 LYS HE3 H N N 166 LYS HZ1 H N N 167 LYS HZ2 H N N 168 LYS HZ3 H N N 169 LYS HXT H N N 170 PHE N N N N 171 PHE CA C N S 172 PHE C C N N 173 PHE O O N N 174 PHE CB C N N 175 PHE CG C Y N 176 PHE CD1 C Y N 177 PHE CD2 C Y N 178 PHE CE1 C Y N 179 PHE CE2 C Y N 180 PHE CZ C Y N 181 PHE OXT O N N 182 PHE H H N N 183 PHE H2 H N N 184 PHE HA H N N 185 PHE HB2 H N N 186 PHE HB3 H N N 187 PHE HD1 H N N 188 PHE HD2 H N N 189 PHE HE1 H N N 190 PHE HE2 H N N 191 PHE HZ H N N 192 PHE HXT H N N 193 PRO N N N N 194 PRO CA C N S 195 PRO C C N N 196 PRO O O N N 197 PRO CB C N N 198 PRO CG C N N 199 PRO CD C N N 200 PRO OXT O N N 201 PRO H H N N 202 PRO HA H N N 203 PRO HB2 H N N 204 PRO HB3 H N N 205 PRO HG2 H N N 206 PRO HG3 H N N 207 PRO HD2 H N N 208 PRO HD3 H N N 209 PRO HXT H N N 210 SER N N N N 211 SER CA C N S 212 SER C C N N 213 SER O O N N 214 SER CB C N N 215 SER OG O N N 216 SER OXT O N N 217 SER H H N N 218 SER H2 H N N 219 SER HA H N N 220 SER HB2 H N N 221 SER HB3 H N N 222 SER HG H N N 223 SER HXT H N N 224 THR N N N N 225 THR CA C N S 226 THR C C N N 227 THR O O N N 228 THR CB C N R 229 THR OG1 O N N 230 THR CG2 C N N 231 THR OXT O N N 232 THR H H N N 233 THR H2 H N N 234 THR HA H N N 235 THR HB H N N 236 THR HG1 H N N 237 THR HG21 H N N 238 THR HG22 H N N 239 THR HG23 H N N 240 THR HXT H N N 241 TYR N N N N 242 TYR CA C N S 243 TYR C C N N 244 TYR O O N N 245 TYR CB C N N 246 TYR CG C Y N 247 TYR CD1 C Y N 248 TYR CD2 C Y N 249 TYR CE1 C Y N 250 TYR CE2 C Y N 251 TYR CZ C Y N 252 TYR OH O N N 253 TYR OXT O N N 254 TYR H H N N 255 TYR H2 H N N 256 TYR HA H N N 257 TYR HB2 H N N 258 TYR HB3 H N N 259 TYR HD1 H N N 260 TYR HD2 H N N 261 TYR HE1 H N N 262 TYR HE2 H N N 263 TYR HH H N N 264 TYR HXT H N N 265 VAL N N N N 266 VAL CA C N S 267 VAL C C N N 268 VAL O O N N 269 VAL CB C N N 270 VAL CG1 C N N 271 VAL CG2 C N N 272 VAL OXT O N N 273 VAL H H N N 274 VAL H2 H N N 275 VAL HA H N N 276 VAL HB H N N 277 VAL HG11 H N N 278 VAL HG12 H N N 279 VAL HG13 H N N 280 VAL HG21 H N N 281 VAL HG22 H N N 282 VAL HG23 H N N 283 VAL HXT H N N 284 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLN N CA sing N N 71 GLN N H sing N N 72 GLN N H2 sing N N 73 GLN CA C sing N N 74 GLN CA CB sing N N 75 GLN CA HA sing N N 76 GLN C O doub N N 77 GLN C OXT sing N N 78 GLN CB CG sing N N 79 GLN CB HB2 sing N N 80 GLN CB HB3 sing N N 81 GLN CG CD sing N N 82 GLN CG HG2 sing N N 83 GLN CG HG3 sing N N 84 GLN CD OE1 doub N N 85 GLN CD NE2 sing N N 86 GLN NE2 HE21 sing N N 87 GLN NE2 HE22 sing N N 88 GLN OXT HXT sing N N 89 GLU N CA sing N N 90 GLU N H sing N N 91 GLU N H2 sing N N 92 GLU CA C sing N N 93 GLU CA CB sing N N 94 GLU CA HA sing N N 95 GLU C O doub N N 96 GLU C OXT sing N N 97 GLU CB CG sing N N 98 GLU CB HB2 sing N N 99 GLU CB HB3 sing N N 100 GLU CG CD sing N N 101 GLU CG HG2 sing N N 102 GLU CG HG3 sing N N 103 GLU CD OE1 doub N N 104 GLU CD OE2 sing N N 105 GLU OE2 HE2 sing N N 106 GLU OXT HXT sing N N 107 GLY N CA sing N N 108 GLY N H sing N N 109 GLY N H2 sing N N 110 GLY CA C sing N N 111 GLY CA HA2 sing N N 112 GLY CA HA3 sing N N 113 GLY C O doub N N 114 GLY C OXT sing N N 115 GLY OXT HXT sing N N 116 ILE N CA sing N N 117 ILE N H sing N N 118 ILE N H2 sing N N 119 ILE CA C sing N N 120 ILE CA CB sing N N 121 ILE CA HA sing N N 122 ILE C O doub N N 123 ILE C OXT sing N N 124 ILE CB CG1 sing N N 125 ILE CB CG2 sing N N 126 ILE CB HB sing N N 127 ILE CG1 CD1 sing N N 128 ILE CG1 HG12 sing N N 129 ILE CG1 HG13 sing N N 130 ILE CG2 HG21 sing N N 131 ILE CG2 HG22 sing N N 132 ILE CG2 HG23 sing N N 133 ILE CD1 HD11 sing N N 134 ILE CD1 HD12 sing N N 135 ILE CD1 HD13 sing N N 136 ILE OXT HXT sing N N 137 LYS N CA sing N N 138 LYS N H sing N N 139 LYS N H2 sing N N 140 LYS CA C sing N N 141 LYS CA CB sing N N 142 LYS CA HA sing N N 143 LYS C O doub N N 144 LYS C OXT sing N N 145 LYS CB CG sing N N 146 LYS CB HB2 sing N N 147 LYS CB HB3 sing N N 148 LYS CG CD sing N N 149 LYS CG HG2 sing N N 150 LYS CG HG3 sing N N 151 LYS CD CE sing N N 152 LYS CD HD2 sing N N 153 LYS CD HD3 sing N N 154 LYS CE NZ sing N N 155 LYS CE HE2 sing N N 156 LYS CE HE3 sing N N 157 LYS NZ HZ1 sing N N 158 LYS NZ HZ2 sing N N 159 LYS NZ HZ3 sing N N 160 LYS OXT HXT sing N N 161 PHE N CA sing N N 162 PHE N H sing N N 163 PHE N H2 sing N N 164 PHE CA C sing N N 165 PHE CA CB sing N N 166 PHE CA HA sing N N 167 PHE C O doub N N 168 PHE C OXT sing N N 169 PHE CB CG sing N N 170 PHE CB HB2 sing N N 171 PHE CB HB3 sing N N 172 PHE CG CD1 doub Y N 173 PHE CG CD2 sing Y N 174 PHE CD1 CE1 sing Y N 175 PHE CD1 HD1 sing N N 176 PHE CD2 CE2 doub Y N 177 PHE CD2 HD2 sing N N 178 PHE CE1 CZ doub Y N 179 PHE CE1 HE1 sing N N 180 PHE CE2 CZ sing Y N 181 PHE CE2 HE2 sing N N 182 PHE CZ HZ sing N N 183 PHE OXT HXT sing N N 184 PRO N CA sing N N 185 PRO N CD sing N N 186 PRO N H sing N N 187 PRO CA C sing N N 188 PRO CA CB sing N N 189 PRO CA HA sing N N 190 PRO C O doub N N 191 PRO C OXT sing N N 192 PRO CB CG sing N N 193 PRO CB HB2 sing N N 194 PRO CB HB3 sing N N 195 PRO CG CD sing N N 196 PRO CG HG2 sing N N 197 PRO CG HG3 sing N N 198 PRO CD HD2 sing N N 199 PRO CD HD3 sing N N 200 PRO OXT HXT sing N N 201 SER N CA sing N N 202 SER N H sing N N 203 SER N H2 sing N N 204 SER CA C sing N N 205 SER CA CB sing N N 206 SER CA HA sing N N 207 SER C O doub N N 208 SER C OXT sing N N 209 SER CB OG sing N N 210 SER CB HB2 sing N N 211 SER CB HB3 sing N N 212 SER OG HG sing N N 213 SER OXT HXT sing N N 214 THR N CA sing N N 215 THR N H sing N N 216 THR N H2 sing N N 217 THR CA C sing N N 218 THR CA CB sing N N 219 THR CA HA sing N N 220 THR C O doub N N 221 THR C OXT sing N N 222 THR CB OG1 sing N N 223 THR CB CG2 sing N N 224 THR CB HB sing N N 225 THR OG1 HG1 sing N N 226 THR CG2 HG21 sing N N 227 THR CG2 HG22 sing N N 228 THR CG2 HG23 sing N N 229 THR OXT HXT sing N N 230 TYR N CA sing N N 231 TYR N H sing N N 232 TYR N H2 sing N N 233 TYR CA C sing N N 234 TYR CA CB sing N N 235 TYR CA HA sing N N 236 TYR C O doub N N 237 TYR C OXT sing N N 238 TYR CB CG sing N N 239 TYR CB HB2 sing N N 240 TYR CB HB3 sing N N 241 TYR CG CD1 doub Y N 242 TYR CG CD2 sing Y N 243 TYR CD1 CE1 sing Y N 244 TYR CD1 HD1 sing N N 245 TYR CD2 CE2 doub Y N 246 TYR CD2 HD2 sing N N 247 TYR CE1 CZ doub Y N 248 TYR CE1 HE1 sing N N 249 TYR CE2 CZ sing Y N 250 TYR CE2 HE2 sing N N 251 TYR CZ OH sing N N 252 TYR OH HH sing N N 253 TYR OXT HXT sing N N 254 VAL N CA sing N N 255 VAL N H sing N N 256 VAL N H2 sing N N 257 VAL CA C sing N N 258 VAL CA CB sing N N 259 VAL CA HA sing N N 260 VAL C O doub N N 261 VAL C OXT sing N N 262 VAL CB CG1 sing N N 263 VAL CB CG2 sing N N 264 VAL CB HB sing N N 265 VAL CG1 HG11 sing N N 266 VAL CG1 HG12 sing N N 267 VAL CG1 HG13 sing N N 268 VAL CG2 HG21 sing N N 269 VAL CG2 HG22 sing N N 270 VAL CG2 HG23 sing N N 271 VAL OXT HXT sing N N 272 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model UNITY _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1LGL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_