data_1LIE # _entry.id 1LIE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1LIE WWPDB D_1000174732 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LIE _pdbx_database_status.recvd_initial_deposition_date 1993-12-21 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lalonde, J.M.' 1 'Bernlohr, D.A.' 2 'Banaszak, L.J.' 3 # _citation.id primary _citation.title ;X-ray crystallographic structures of adipocyte lipid-binding protein complexed with palmitate and hexadecanesulfonic acid. Properties of cavity binding sites. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 33 _citation.page_first 4885 _citation.page_last 4895 _citation.year 1994 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 8161548 _citation.pdbx_database_id_DOI 10.1021/bi00182a017 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'LaLonde, J.M.' 1 primary 'Bernlohr, D.A.' 2 primary 'Banaszak, L.J.' 3 # _cell.entry_id 1LIE _cell.length_a 119.540 _cell.length_b 37.860 _cell.length_c 28.570 _cell.angle_alpha 90.00 _cell.angle_beta 92.66 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1LIE _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ADIPOCYTE LIPID-BINDING PROTEIN' 14587.687 1 ? ? ? ? 2 non-polymer syn 'PALMITIC ACID' 256.424 1 ? ? ? ? 3 non-polymer syn 'PROPANOIC ACID' 74.079 1 ? ? ? ? 4 water nat water 18.015 82 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;CDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDLVTIRSESTFKNTEISFKLGVEFDEITADDRKV KSIITLDGGALVQVQKWDGKSTTIKRKRDGDKLVVE(OCS)VMKGVTSTRVYERA ; _entity_poly.pdbx_seq_one_letter_code_can ;CDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDLVTIRSESTFKNTEISFKLGVEFDEITADDRKV KSIITLDGGALVQVQKWDGKSTTIKRKRDGDKLVVECVMKGVTSTRVYERA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 ASP n 1 3 ALA n 1 4 PHE n 1 5 VAL n 1 6 GLY n 1 7 THR n 1 8 TRP n 1 9 LYS n 1 10 LEU n 1 11 VAL n 1 12 SER n 1 13 SER n 1 14 GLU n 1 15 ASN n 1 16 PHE n 1 17 ASP n 1 18 ASP n 1 19 TYR n 1 20 MET n 1 21 LYS n 1 22 GLU n 1 23 VAL n 1 24 GLY n 1 25 VAL n 1 26 GLY n 1 27 PHE n 1 28 ALA n 1 29 THR n 1 30 ARG n 1 31 LYS n 1 32 VAL n 1 33 ALA n 1 34 GLY n 1 35 MET n 1 36 ALA n 1 37 LYS n 1 38 PRO n 1 39 ASN n 1 40 MET n 1 41 ILE n 1 42 ILE n 1 43 SER n 1 44 VAL n 1 45 ASN n 1 46 GLY n 1 47 ASP n 1 48 LEU n 1 49 VAL n 1 50 THR n 1 51 ILE n 1 52 ARG n 1 53 SER n 1 54 GLU n 1 55 SER n 1 56 THR n 1 57 PHE n 1 58 LYS n 1 59 ASN n 1 60 THR n 1 61 GLU n 1 62 ILE n 1 63 SER n 1 64 PHE n 1 65 LYS n 1 66 LEU n 1 67 GLY n 1 68 VAL n 1 69 GLU n 1 70 PHE n 1 71 ASP n 1 72 GLU n 1 73 ILE n 1 74 THR n 1 75 ALA n 1 76 ASP n 1 77 ASP n 1 78 ARG n 1 79 LYS n 1 80 VAL n 1 81 LYS n 1 82 SER n 1 83 ILE n 1 84 ILE n 1 85 THR n 1 86 LEU n 1 87 ASP n 1 88 GLY n 1 89 GLY n 1 90 ALA n 1 91 LEU n 1 92 VAL n 1 93 GLN n 1 94 VAL n 1 95 GLN n 1 96 LYS n 1 97 TRP n 1 98 ASP n 1 99 GLY n 1 100 LYS n 1 101 SER n 1 102 THR n 1 103 THR n 1 104 ILE n 1 105 LYS n 1 106 ARG n 1 107 LYS n 1 108 ARG n 1 109 ASP n 1 110 GLY n 1 111 ASP n 1 112 LYS n 1 113 LEU n 1 114 VAL n 1 115 VAL n 1 116 GLU n 1 117 OCS n 1 118 VAL n 1 119 MET n 1 120 LYS n 1 121 GLY n 1 122 VAL n 1 123 THR n 1 124 SER n 1 125 THR n 1 126 ARG n 1 127 VAL n 1 128 TYR n 1 129 GLU n 1 130 ARG n 1 131 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FABPA_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P04117 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;CDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDLVTIRSESTFKNTEISFKLGVEFDEITADDRKV KSIITLDGGALVQVQKWDGKSTTIKRKRDGDKLVVECVMKGVTSTRVYERA ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1LIE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 131 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04117 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 131 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 131 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 OCS 'L-peptide linking' n 'CYSTEINESULFONIC ACID' ? 'C3 H7 N O5 S' 169.156 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PLM non-polymer . 'PALMITIC ACID' ? 'C16 H32 O2' 256.424 PPI non-polymer . 'PROPANOIC ACID' ? 'C3 H6 O2' 74.079 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1LIE _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_percent_sol 44.61 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1LIE _refine.ls_number_reflns_obs 15995 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.0 _refine.ls_d_res_high 1.6 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.1980000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1980000 _refine.ls_R_factor_R_free 0.2390000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1023 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.number_atoms_solvent 82 _refine_hist.number_atoms_total 1128 _refine_hist.d_res_high 1.6 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.021 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.65 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1LIE _struct.title ;X-RAY CRYSTALLOGRAPHIC STRUCTURES OF ADIPOCYTE LIPID BINDING PROTEIN COMPLEXED WITH PALMITATE AND HEXADECANESULFONIC ACID. PROPERTIES OF CAVITY BINDING SITES ; _struct.pdbx_descriptor 'ADIPOCYTE LIPID-BINDING PROTEIN COMPLEXED WITH PALMITIC ACID' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1LIE _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' _struct_keywords.text 'LIPID-BINDING PROTEIN, LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 PHE A 16 ? VAL A 23 ? PHE A 16 VAL A 23 1 ? 8 HELX_P HELX_P2 H2 PHE A 27 ? MET A 35 ? PHE A 27 MET A 35 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A GLU 116 C ? ? ? 1_555 A OCS 117 N ? ? A GLU 116 A OCS 117 1_555 ? ? ? ? ? ? ? 1.324 ? covale2 covale ? ? A OCS 117 C ? ? ? 1_555 A VAL 118 N ? ? A OCS 117 A VAL 118 1_555 ? ? ? ? ? ? ? 1.327 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 11 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? parallel S1 2 3 ? parallel S1 3 4 ? parallel S1 4 5 ? parallel S1 5 6 ? parallel S1 6 7 ? parallel S1 7 8 ? parallel S1 8 9 ? parallel S1 9 10 ? parallel S1 10 11 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 GLY A 6 ? GLU A 14 ? GLY A 6 GLU A 14 S1 2 ASN A 39 ? ASN A 45 ? ASN A 39 ASN A 45 S1 3 LEU A 48 ? GLU A 54 ? LEU A 48 GLU A 54 S1 4 ASN A 59 ? PHE A 64 ? ASN A 59 PHE A 64 S1 5 PHE A 70 ? ILE A 73 ? PHE A 70 ILE A 73 S1 6 LYS A 79 ? ASP A 87 ? LYS A 79 ASP A 87 S1 7 ALA A 90 ? TRP A 97 ? ALA A 90 TRP A 97 S1 8 LYS A 100 ? ASP A 109 ? LYS A 100 ASP A 109 S1 9 LYS A 112 ? MET A 119 ? LYS A 112 MET A 119 S1 10 VAL A 122 ? ARG A 130 ? VAL A 122 ARG A 130 S1 11 GLY A 6 ? GLU A 14 ? GLY A 6 GLU A 14 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PLM A 133' AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PPI A 134' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 THR A 29 ? THR A 29 . ? 1_555 ? 2 AC1 10 ALA A 33 ? ALA A 33 . ? 1_555 ? 3 AC1 10 MET A 40 ? MET A 40 . ? 1_555 ? 4 AC1 10 LYS A 58 ? LYS A 58 . ? 1_555 ? 5 AC1 10 ALA A 75 ? ALA A 75 . ? 1_555 ? 6 AC1 10 ASP A 76 ? ASP A 76 . ? 1_555 ? 7 AC1 10 OCS A 117 ? OCS A 117 . ? 1_555 ? 8 AC1 10 ARG A 126 ? ARG A 126 . ? 1_555 ? 9 AC1 10 TYR A 128 ? TYR A 128 . ? 1_555 ? 10 AC1 10 HOH D . ? HOH A 1106 . ? 1_555 ? 11 AC2 5 SER A 13 ? SER A 13 . ? 1_555 ? 12 AC2 5 GLU A 14 ? GLU A 14 . ? 1_555 ? 13 AC2 5 ASN A 15 ? ASN A 15 . ? 1_555 ? 14 AC2 5 PHE A 16 ? PHE A 16 . ? 1_555 ? 15 AC2 5 ASP A 17 ? ASP A 17 . ? 1_555 ? # _database_PDB_matrix.entry_id 1LIE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1LIE _atom_sites.fract_transf_matrix[1][1] 0.008365 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000389 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026413 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.035040 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 TRP 97 97 97 TRP TRP A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 OCS 117 117 117 OCS OCS A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 MET 119 119 119 MET MET A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 ALA 131 131 131 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PLM 1 133 133 PLM PLM A . C 3 PPI 1 134 134 PPI PPI A . D 4 HOH 1 1002 1002 HOH HOH A . D 4 HOH 2 1003 1003 HOH HOH A . D 4 HOH 3 1007 1007 HOH HOH A . D 4 HOH 4 1013 1013 HOH HOH A . D 4 HOH 5 1014 1014 HOH HOH A . D 4 HOH 6 1017 1017 HOH HOH A . D 4 HOH 7 1018 1018 HOH HOH A . D 4 HOH 8 1024 1024 HOH HOH A . D 4 HOH 9 1027 1027 HOH HOH A . D 4 HOH 10 1030 1030 HOH HOH A . D 4 HOH 11 1039 1039 HOH HOH A . D 4 HOH 12 1041 1041 HOH HOH A . D 4 HOH 13 1042 1042 HOH HOH A . D 4 HOH 14 1043 1043 HOH HOH A . D 4 HOH 15 1044 1044 HOH HOH A . D 4 HOH 16 1045 1045 HOH HOH A . D 4 HOH 17 1047 1047 HOH HOH A . D 4 HOH 18 1048 1048 HOH HOH A . D 4 HOH 19 1053 1053 HOH HOH A . D 4 HOH 20 1054 1054 HOH HOH A . D 4 HOH 21 1055 1055 HOH HOH A . D 4 HOH 22 1059 1059 HOH HOH A . D 4 HOH 23 1060 1060 HOH HOH A . D 4 HOH 24 1061 1061 HOH HOH A . D 4 HOH 25 1063 1063 HOH HOH A . D 4 HOH 26 1065 1065 HOH HOH A . D 4 HOH 27 1068 1068 HOH HOH A . D 4 HOH 28 1071 1071 HOH HOH A . D 4 HOH 29 1072 1072 HOH HOH A . D 4 HOH 30 1073 1073 HOH HOH A . D 4 HOH 31 1075 1075 HOH HOH A . D 4 HOH 32 1076 1076 HOH HOH A . D 4 HOH 33 1077 1077 HOH HOH A . D 4 HOH 34 1079 1079 HOH HOH A . D 4 HOH 35 1081 1081 HOH HOH A . D 4 HOH 36 1085 1085 HOH HOH A . D 4 HOH 37 1087 1087 HOH HOH A . D 4 HOH 38 1088 1088 HOH HOH A . D 4 HOH 39 1089 1089 HOH HOH A . D 4 HOH 40 1095 1095 HOH HOH A . D 4 HOH 41 1098 1098 HOH HOH A . D 4 HOH 42 1100 1100 HOH HOH A . D 4 HOH 43 1101 1101 HOH HOH A . D 4 HOH 44 1103 1103 HOH HOH A . D 4 HOH 45 1105 1105 HOH HOH A . D 4 HOH 46 1106 1106 HOH HOH A . D 4 HOH 47 1109 1109 HOH HOH A . D 4 HOH 48 1111 1111 HOH HOH A . D 4 HOH 49 1116 1116 HOH HOH A . D 4 HOH 50 1123 1123 HOH HOH A . D 4 HOH 51 1125 1125 HOH HOH A . D 4 HOH 52 1126 1126 HOH HOH A . D 4 HOH 53 1128 1128 HOH HOH A . D 4 HOH 54 1130 1130 HOH HOH A . D 4 HOH 55 2002 2002 HOH HOH A . D 4 HOH 56 2003 2003 HOH HOH A . D 4 HOH 57 2007 2007 HOH HOH A . D 4 HOH 58 2013 2013 HOH HOH A . D 4 HOH 59 2018 2018 HOH HOH A . D 4 HOH 60 2044 2044 HOH HOH A . D 4 HOH 61 2060 2060 HOH HOH A . D 4 HOH 62 2063 2063 HOH HOH A . D 4 HOH 63 2071 2071 HOH HOH A . D 4 HOH 64 2072 2072 HOH HOH A . D 4 HOH 65 2073 2073 HOH HOH A . D 4 HOH 66 2087 2087 HOH HOH A . D 4 HOH 67 2089 2089 HOH HOH A . D 4 HOH 68 2095 2095 HOH HOH A . D 4 HOH 69 2101 2101 HOH HOH A . D 4 HOH 70 2106 2106 HOH HOH A . D 4 HOH 71 2111 2111 HOH HOH A . D 4 HOH 72 2123 2123 HOH HOH A . D 4 HOH 73 2130 2130 HOH HOH A . D 4 HOH 74 3071 3071 HOH HOH A . D 4 HOH 75 3089 3089 HOH HOH A . D 4 HOH 76 4071 4071 HOH HOH A . D 4 HOH 77 8003 8003 HOH HOH A . D 4 HOH 78 9003 9003 HOH HOH A . D 4 HOH 79 9015 9015 HOH HOH A . D 4 HOH 80 9065 9065 HOH HOH A . D 4 HOH 81 9071 9071 HOH HOH A . D 4 HOH 82 9130 9130 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id OCS _pdbx_struct_mod_residue.label_seq_id 117 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id OCS _pdbx_struct_mod_residue.auth_seq_id 117 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'CYSTEINESULFONIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_455 -x-1,y,-z -1.0000000000 0.0000000000 0.0000000000 -119.5400000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-04-30 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' Advisory 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 3 4 'Structure model' struct_conf 4 4 'Structure model' struct_conf_type 5 4 'Structure model' struct_keywords # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 4 'Structure model' '_struct_keywords.text' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 17 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NZ _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LYS _pdbx_validate_close_contact.auth_seq_id_2 21 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CG _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 MET _pdbx_validate_rmsd_angle.auth_seq_id_1 35 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 SD _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 MET _pdbx_validate_rmsd_angle.auth_seq_id_2 35 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CE _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 MET _pdbx_validate_rmsd_angle.auth_seq_id_3 35 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 109.99 _pdbx_validate_rmsd_angle.angle_target_value 100.20 _pdbx_validate_rmsd_angle.angle_deviation 9.79 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.60 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id OCS _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 117 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id OD3 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id A _pdbx_unobs_or_zero_occ_atoms.label_comp_id OCS _pdbx_unobs_or_zero_occ_atoms.label_seq_id 117 _pdbx_unobs_or_zero_occ_atoms.label_atom_id OD3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PALMITIC ACID' PLM 3 'PROPANOIC ACID' PPI 4 water HOH #