data_1LKN # _entry.id 1LKN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1LKN pdb_00001lkn 10.2210/pdb1lkn/pdb RCSB RCSB016032 ? ? WWPDB D_1000016032 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id vt74 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LKN _pdbx_database_status.recvd_initial_deposition_date 2002-04-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_mr REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xia, Y.' 1 'Yee, A.' 2 'Semesi, A.' 3 'Arrowsmith, C.H.' 4 'Northeast Structural Genomics Consortium (NESG)' 5 # _citation.id primary _citation.title 'Solution Structure of Hypothetical Protein tm1112' _citation.journal_abbrev 'to be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xia, Y.' 1 ? primary 'Yee, A.' 2 ? primary 'Semesi, A.' 3 ? primary 'Arrowsmith, C.H.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'hypothetical protein tm1112' _entity.formula_weight 10774.417 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLE PVRKHYNLF ; _entity_poly.pdbx_seq_one_letter_code_can ;MEVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLE PVRKHYNLF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier VT74 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 VAL n 1 4 LYS n 1 5 ILE n 1 6 GLU n 1 7 LYS n 1 8 PRO n 1 9 THR n 1 10 PRO n 1 11 GLU n 1 12 LYS n 1 13 LEU n 1 14 LYS n 1 15 GLU n 1 16 LEU n 1 17 SER n 1 18 VAL n 1 19 GLU n 1 20 LYS n 1 21 TRP n 1 22 PRO n 1 23 ILE n 1 24 TRP n 1 25 GLU n 1 26 LYS n 1 27 GLU n 1 28 VAL n 1 29 SER n 1 30 GLU n 1 31 PHE n 1 32 ASP n 1 33 TRP n 1 34 TYR n 1 35 TYR n 1 36 ASP n 1 37 THR n 1 38 ASN n 1 39 GLU n 1 40 THR n 1 41 CYS n 1 42 TYR n 1 43 ILE n 1 44 LEU n 1 45 GLU n 1 46 GLY n 1 47 LYS n 1 48 VAL n 1 49 GLU n 1 50 VAL n 1 51 THR n 1 52 THR n 1 53 GLU n 1 54 ASP n 1 55 GLY n 1 56 LYS n 1 57 LYS n 1 58 TYR n 1 59 VAL n 1 60 ILE n 1 61 GLU n 1 62 LYS n 1 63 GLY n 1 64 ASP n 1 65 LEU n 1 66 VAL n 1 67 THR n 1 68 PHE n 1 69 PRO n 1 70 LYS n 1 71 GLY n 1 72 LEU n 1 73 ARG n 1 74 CYS n 1 75 ARG n 1 76 TRP n 1 77 LYS n 1 78 VAL n 1 79 LEU n 1 80 GLU n 1 81 PRO n 1 82 VAL n 1 83 ARG n 1 84 LYS n 1 85 HIS n 1 86 TYR n 1 87 ASN n 1 88 LEU n 1 89 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermotoga _entity_src_gen.pdbx_gene_src_gene tm1112 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermotoga maritima' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2336 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'bl21de3(magic gold)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pet15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9X0J6_THEMA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLE PVRKHYNLF ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession Q9X0J6 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1LKN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9X0J6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 89 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 89 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C/15N-separated_NOESY 2 1 1 3D_15N/15N-separated_NOESY 3 1 1 HNHA # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20uM Zn2+' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM tm1112 U-15N,13C; 25mM phosphate buffer NA; 95% H2O, 5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 500 2 ? Varian INOVA 600 # _pdbx_nmr_refine.entry_id 1LKN _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The structures are based on a total of 2619 restraints, in which 2508 are NOE-derived distance constraints, 111 are dihedral angle restraints from TALOS analysis and HNHA experiment. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1LKN _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_ensemble.entry_id 1LKN _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted,back calculated data agree with experimental NOESY spectrum,structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1LKN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 2.1 processing 'F. Delaglio' 1 Sparky 'SPARKY 3' 'data analysis' 'T. D. Goddard and D. G. Kneller' 2 'ARIA BASED ON XPLOR3.851' ? 'structure solution' 'M. NILGES, A.T. Brunger' 3 'ARIA BASED ON XPLOR3.851' ? refinement 'M. NILGES, A.T. Brunger' 4 # _exptl.entry_id 1LKN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1LKN _struct.title ;Solution NMR Structure of Protein TM_1112 from Thermotoga maritima. Ontario Centre for Structural Proteomics Target TM1112_1_89; Northeast Structural Genomics Consortium Target VT74. ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1LKN _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text ;BETA BARREL, structural genomics, OCSP, NESG, PROTEIN STRUCTURE INITIATIVE, PSI, Northeast Structural Genomics Consortium, unknown function ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 9 ? LEU A 16 ? THR A 9 LEU A 16 1 ? 8 HELX_P HELX_P2 2 SER A 17 ? TRP A 21 ? SER A 17 TRP A 21 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id THR _struct_mon_prot_cis.label_seq_id 9 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id THR _struct_mon_prot_cis.auth_seq_id 9 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 10 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 10 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 9 _struct_mon_prot_cis.pdbx_omega_angle 10.19 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 23 ? LYS A 26 ? ILE A 23 LYS A 26 A 2 ARG A 73 ? LEU A 88 ? ARG A 73 LEU A 88 A 3 GLU A 30 ? TYR A 34 ? GLU A 30 TYR A 34 A 4 ARG A 73 ? LEU A 88 ? ARG A 73 LEU A 88 A 5 GLU A 39 ? THR A 52 ? GLU A 39 THR A 52 A 6 LYS A 57 ? GLU A 61 ? LYS A 57 GLU A 61 A 7 GLU A 39 ? THR A 52 ? GLU A 39 THR A 52 A 8 LEU A 65 ? THR A 67 ? LEU A 65 THR A 67 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 26 ? O LYS A 26 N VAL A 82 ? N VAL A 82 A 2 3 N TRP A 76 ? N TRP A 76 O PHE A 31 ? O PHE A 31 A 3 4 N TRP A 33 ? N TRP A 33 O CYS A 74 ? O CYS A 74 A 4 5 O ASN A 87 ? O ASN A 87 N THR A 40 ? N THR A 40 A 5 6 N VAL A 50 ? N VAL A 50 O TYR A 58 ? O TYR A 58 A 6 7 N ILE A 60 ? N ILE A 60 O VAL A 48 ? O VAL A 48 A 7 8 O CYS A 41 ? O CYS A 41 N VAL A 66 ? N VAL A 66 # _database_PDB_matrix.entry_id 1LKN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1LKN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 PHE 89 89 89 PHE PHE A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-06-24 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_related 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_related.db_name' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A TYR 42 ? ? H A HIS 85 ? ? 1.59 2 2 H A ILE 43 ? ? O A ASP 64 ? ? 1.59 3 3 O A TYR 42 ? ? H A HIS 85 ? ? 1.55 4 3 O A VAL 18 ? ? H A TRP 21 ? ? 1.59 5 4 HG22 A THR 52 ? ? HH A TYR 58 ? ? 1.30 6 4 O A PHE 31 ? ? H A TRP 76 ? ? 1.59 7 5 O A TYR 42 ? ? H A HIS 85 ? ? 1.55 8 5 O A GLU 27 ? ? H A SER 29 ? ? 1.58 9 6 O A GLU 27 ? ? H A SER 29 ? ? 1.57 10 6 O A LYS 47 ? ? H A LEU 79 ? ? 1.57 11 6 O A TYR 42 ? ? H A HIS 85 ? ? 1.58 12 7 HG22 A THR 52 ? ? HH A TYR 58 ? ? 1.31 13 7 O A GLU 27 ? ? H A SER 29 ? ? 1.56 14 7 O A TYR 42 ? ? H A HIS 85 ? ? 1.60 15 8 H A PHE 31 ? ? O A TRP 76 ? ? 1.56 16 8 O A TYR 42 ? ? H A HIS 85 ? ? 1.58 17 9 HG21 A THR 52 ? ? HH A TYR 58 ? ? 1.33 18 9 H A LEU 44 ? ? O A ARG 83 ? ? 1.60 19 10 HH A TYR 35 ? ? H A GLU 39 ? ? 0.92 20 10 OH A TYR 35 ? ? H A GLU 39 ? ? 1.25 21 10 O A GLU 49 ? ? HZ3 A LYS 77 ? ? 1.49 22 10 O A TYR 42 ? ? H A HIS 85 ? ? 1.55 23 10 HH A TYR 35 ? ? N A GLU 39 ? ? 1.58 24 10 O A GLU 27 ? ? H A SER 29 ? ? 1.59 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 10 CE1 A TYR 35 ? ? CZ A TYR 35 ? ? 1.459 1.381 0.078 0.013 N 2 10 CZ A TYR 35 ? ? CE2 A TYR 35 ? ? 1.300 1.381 -0.081 0.013 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 10 ? ? -37.37 -30.62 2 1 SER A 17 ? ? -28.68 88.02 3 1 PRO A 22 ? ? -53.74 -179.73 4 1 VAL A 28 ? ? -53.73 62.97 5 1 SER A 29 ? ? -94.93 -155.86 6 1 ASP A 36 ? ? -159.45 26.16 7 1 THR A 37 ? ? 170.31 141.56 8 1 ASN A 38 ? ? -58.40 93.61 9 1 GLU A 45 ? ? 177.15 100.79 10 1 LYS A 62 ? ? 47.65 110.82 11 1 PRO A 81 ? ? -34.53 121.23 12 1 ASN A 87 ? ? -164.07 73.24 13 2 PRO A 10 ? ? -39.47 -30.13 14 2 SER A 17 ? ? -29.59 88.65 15 2 PRO A 22 ? ? -49.90 179.24 16 2 VAL A 28 ? ? -63.57 45.57 17 2 GLU A 45 ? ? -169.55 100.68 18 2 LYS A 62 ? ? 49.78 115.77 19 2 LEU A 72 ? ? -45.18 93.39 20 2 PRO A 81 ? ? -35.07 118.45 21 2 ASN A 87 ? ? -157.50 54.19 22 3 GLU A 2 ? ? -174.50 39.13 23 3 SER A 17 ? ? -26.22 89.51 24 3 PRO A 22 ? ? -52.38 -171.55 25 3 VAL A 28 ? ? 26.54 43.22 26 3 ASP A 36 ? ? -152.35 20.14 27 3 GLU A 45 ? ? -172.03 106.29 28 3 LYS A 62 ? ? 58.57 106.71 29 3 ASN A 87 ? ? -151.27 73.43 30 4 PRO A 10 ? ? -39.71 -29.64 31 4 SER A 17 ? ? -29.10 88.66 32 4 PRO A 22 ? ? -48.32 174.54 33 4 VAL A 28 ? ? -64.34 47.65 34 4 ASP A 36 ? ? -152.09 17.73 35 4 GLU A 45 ? ? 179.16 137.05 36 4 LYS A 62 ? ? 25.77 111.59 37 4 LEU A 72 ? ? -46.84 91.53 38 4 PRO A 81 ? ? -35.01 117.79 39 4 ASN A 87 ? ? -170.86 60.56 40 5 SER A 17 ? ? -29.50 88.28 41 5 PRO A 22 ? ? -51.16 -174.62 42 5 VAL A 28 ? ? -49.06 59.11 43 5 SER A 29 ? ? -95.51 -158.65 44 5 ASP A 36 ? ? -150.15 21.43 45 5 ASN A 38 ? ? -69.92 97.12 46 5 GLU A 45 ? ? -171.87 104.65 47 5 LYS A 62 ? ? 30.96 110.82 48 5 LYS A 70 ? ? -44.09 107.96 49 5 PRO A 81 ? ? -42.37 107.89 50 5 ASN A 87 ? ? -150.10 57.05 51 6 SER A 17 ? ? -27.32 88.47 52 6 PRO A 22 ? ? -56.60 170.45 53 6 VAL A 28 ? ? -59.65 51.00 54 6 ASP A 36 ? ? -177.18 35.44 55 6 THR A 37 ? ? 176.44 121.83 56 6 ASN A 38 ? ? -52.95 92.96 57 6 GLU A 45 ? ? 178.41 105.69 58 6 LYS A 62 ? ? 31.75 108.71 59 6 PRO A 81 ? ? -39.67 115.04 60 6 ASN A 87 ? ? -162.56 54.39 61 7 GLU A 2 ? ? 173.13 118.90 62 7 SER A 17 ? ? -28.66 88.20 63 7 PRO A 22 ? ? -56.32 172.76 64 7 VAL A 28 ? ? -56.61 52.68 65 7 ASP A 36 ? ? -149.94 30.91 66 7 GLU A 45 ? ? -178.44 102.28 67 7 LYS A 62 ? ? 51.59 114.47 68 7 GLU A 80 ? ? -170.39 148.39 69 7 PRO A 81 ? ? -39.71 115.58 70 7 ASN A 87 ? ? -161.90 62.36 71 8 GLU A 2 ? ? -104.58 48.28 72 8 PRO A 10 ? ? -38.75 -31.31 73 8 SER A 17 ? ? -27.27 94.49 74 8 VAL A 18 ? ? -92.00 33.79 75 8 VAL A 28 ? ? -56.70 61.10 76 8 SER A 29 ? ? -94.08 -158.13 77 8 ASP A 36 ? ? -161.61 28.94 78 8 THR A 37 ? ? 170.26 164.99 79 8 GLU A 45 ? ? 175.32 107.02 80 8 LYS A 62 ? ? 19.67 112.97 81 8 LEU A 72 ? ? -46.66 101.29 82 8 PRO A 81 ? ? -38.15 117.92 83 8 ASN A 87 ? ? -150.10 61.65 84 9 PRO A 8 ? ? -49.25 152.88 85 9 SER A 17 ? ? -27.18 91.41 86 9 VAL A 28 ? ? -63.32 46.21 87 9 ASP A 36 ? ? -175.97 33.03 88 9 THR A 37 ? ? 166.43 158.96 89 9 GLU A 45 ? ? 176.54 104.82 90 9 LYS A 62 ? ? 12.12 111.91 91 9 PRO A 81 ? ? -34.77 121.34 92 9 ASN A 87 ? ? -158.06 59.80 93 10 GLU A 2 ? ? -169.33 53.94 94 10 SER A 17 ? ? -28.29 88.49 95 10 VAL A 28 ? ? -56.71 56.37 96 10 SER A 29 ? ? -97.43 -156.73 97 10 ASN A 38 ? ? -40.98 109.48 98 10 GLU A 45 ? ? -176.24 112.77 99 10 LYS A 62 ? ? 51.80 116.43 100 10 LYS A 70 ? ? -31.60 111.84 101 10 LEU A 72 ? ? -37.44 126.60 102 10 ASN A 87 ? ? -169.58 69.64 #