data_1LMJ # _entry.id 1LMJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1LMJ pdb_00001lmj 10.2210/pdb1lmj/pdb RCSB RCSB016086 ? ? WWPDB D_1000016086 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-04-29 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.value' 14 4 'Structure model' '_struct_conn.pdbx_dist_value' 15 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 16 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 27 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LMJ _pdbx_database_status.recvd_initial_deposition_date 2002-05-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1EMO 'Fibrillin-1 cbEGF32-33' unspecified PDB 1HJ7 'LDL Receptor cbEGF AB' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Smallridge, R.S.' 1 'Whiteman, P.' 2 'Werner, J.M.' 3 'Campbell, I.D.' 4 'Handford, P.A.' 5 'Downing, A.K.' 6 # _citation.id primary _citation.title ;Solution Structure and Dynamics of a Calcium Binding Epidermal Growth Factor-like Domain Pair from the Neonatal Region of Human Fibrillin-1. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 278 _citation.page_first 12199 _citation.page_last 12206 _citation.year 2003 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12511552 _citation.pdbx_database_id_DOI 10.1074/jbc.M208266200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Smallridge, R.S.' 1 ? primary 'Whiteman, P.' 2 ? primary 'Werner, J.M.' 3 ? primary 'Campbell, I.D.' 4 ? primary 'Handford, P.A.' 5 ? primary 'Downing, A.K.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'fibrillin 1' 9509.739 1 ? ? cbEGF12-13 ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSP NISACI ; _entity_poly.pdbx_seq_one_letter_code_can ;TDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSP NISACI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 ASP n 1 3 ILE n 1 4 ASP n 1 5 GLU n 1 6 CYS n 1 7 ARG n 1 8 ILE n 1 9 SER n 1 10 PRO n 1 11 ASP n 1 12 LEU n 1 13 CYS n 1 14 GLY n 1 15 ARG n 1 16 GLY n 1 17 GLN n 1 18 CYS n 1 19 VAL n 1 20 ASN n 1 21 THR n 1 22 PRO n 1 23 GLY n 1 24 ASP n 1 25 PHE n 1 26 GLU n 1 27 CYS n 1 28 LYS n 1 29 CYS n 1 30 ASP n 1 31 GLU n 1 32 GLY n 1 33 TYR n 1 34 GLU n 1 35 SER n 1 36 GLY n 1 37 PHE n 1 38 MET n 1 39 MET n 1 40 MET n 1 41 LYS n 1 42 ASN n 1 43 CYS n 1 44 MET n 1 45 ASP n 1 46 ILE n 1 47 ASP n 1 48 GLU n 1 49 CYS n 1 50 GLN n 1 51 ARG n 1 52 ASP n 1 53 PRO n 1 54 LEU n 1 55 LEU n 1 56 CYS n 1 57 ARG n 1 58 GLY n 1 59 GLY n 1 60 VAL n 1 61 CYS n 1 62 HIS n 1 63 ASN n 1 64 THR n 1 65 GLU n 1 66 GLY n 1 67 SER n 1 68 TYR n 1 69 ARG n 1 70 CYS n 1 71 GLU n 1 72 CYS n 1 73 PRO n 1 74 PRO n 1 75 GLY n 1 76 HIS n 1 77 GLN n 1 78 LEU n 1 79 SER n 1 80 PRO n 1 81 ASN n 1 82 ILE n 1 83 SER n 1 84 ALA n 1 85 CYS n 1 86 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene FBN1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'NM554 and BL21' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pQE30 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 3 3 THR THR A . n A 1 2 ASP 2 4 4 ASP ASP A . n A 1 3 ILE 3 5 5 ILE ILE A . n A 1 4 ASP 4 6 6 ASP ASP A . n A 1 5 GLU 5 7 7 GLU GLU A . n A 1 6 CYS 6 8 8 CYS CYS A . n A 1 7 ARG 7 9 9 ARG ARG A . n A 1 8 ILE 8 10 10 ILE ILE A . n A 1 9 SER 9 11 11 SER SER A . n A 1 10 PRO 10 12 12 PRO PRO A . n A 1 11 ASP 11 13 13 ASP ASP A . n A 1 12 LEU 12 14 14 LEU LEU A . n A 1 13 CYS 13 15 15 CYS CYS A . n A 1 14 GLY 14 16 16 GLY GLY A . n A 1 15 ARG 15 17 17 ARG ARG A . n A 1 16 GLY 16 18 18 GLY GLY A . n A 1 17 GLN 17 19 19 GLN GLN A . n A 1 18 CYS 18 20 20 CYS CYS A . n A 1 19 VAL 19 21 21 VAL VAL A . n A 1 20 ASN 20 22 22 ASN ASN A . n A 1 21 THR 21 23 23 THR THR A . n A 1 22 PRO 22 24 24 PRO PRO A . n A 1 23 GLY 23 25 25 GLY GLY A . n A 1 24 ASP 24 26 26 ASP ASP A . n A 1 25 PHE 25 27 27 PHE PHE A . n A 1 26 GLU 26 28 28 GLU GLU A . n A 1 27 CYS 27 29 29 CYS CYS A . n A 1 28 LYS 28 30 30 LYS LYS A . n A 1 29 CYS 29 31 31 CYS CYS A . n A 1 30 ASP 30 32 32 ASP ASP A . n A 1 31 GLU 31 33 33 GLU GLU A . n A 1 32 GLY 32 34 34 GLY GLY A . n A 1 33 TYR 33 35 35 TYR TYR A . n A 1 34 GLU 34 36 36 GLU GLU A . n A 1 35 SER 35 37 37 SER SER A . n A 1 36 GLY 36 38 38 GLY GLY A . n A 1 37 PHE 37 39 39 PHE PHE A . n A 1 38 MET 38 40 40 MET MET A . n A 1 39 MET 39 41 41 MET MET A . n A 1 40 MET 40 42 42 MET MET A . n A 1 41 LYS 41 43 43 LYS LYS A . n A 1 42 ASN 42 44 44 ASN ASN A . n A 1 43 CYS 43 45 45 CYS CYS A . n A 1 44 MET 44 46 46 MET MET A . n A 1 45 ASP 45 47 47 ASP ASP A . n A 1 46 ILE 46 48 48 ILE ILE A . n A 1 47 ASP 47 49 49 ASP ASP A . n A 1 48 GLU 48 50 50 GLU GLU A . n A 1 49 CYS 49 51 51 CYS CYS A . n A 1 50 GLN 50 52 52 GLN GLN A . n A 1 51 ARG 51 53 53 ARG ARG A . n A 1 52 ASP 52 54 54 ASP ASP A . n A 1 53 PRO 53 55 55 PRO PRO A . n A 1 54 LEU 54 56 56 LEU LEU A . n A 1 55 LEU 55 57 57 LEU LEU A . n A 1 56 CYS 56 58 58 CYS CYS A . n A 1 57 ARG 57 59 59 ARG ARG A . n A 1 58 GLY 58 60 60 GLY GLY A . n A 1 59 GLY 59 61 61 GLY GLY A . n A 1 60 VAL 60 62 62 VAL VAL A . n A 1 61 CYS 61 63 63 CYS CYS A . n A 1 62 HIS 62 64 64 HIS HIS A . n A 1 63 ASN 63 65 65 ASN ASN A . n A 1 64 THR 64 66 66 THR THR A . n A 1 65 GLU 65 67 67 GLU GLU A . n A 1 66 GLY 66 68 68 GLY GLY A . n A 1 67 SER 67 69 69 SER SER A . n A 1 68 TYR 68 70 70 TYR TYR A . n A 1 69 ARG 69 71 71 ARG ARG A . n A 1 70 CYS 70 72 72 CYS CYS A . n A 1 71 GLU 71 73 73 GLU GLU A . n A 1 72 CYS 72 74 74 CYS CYS A . n A 1 73 PRO 73 75 75 PRO PRO A . n A 1 74 PRO 74 76 76 PRO PRO A . n A 1 75 GLY 75 77 77 GLY GLY A . n A 1 76 HIS 76 78 78 HIS HIS A . n A 1 77 GLN 77 79 79 GLN GLN A . n A 1 78 LEU 78 80 80 LEU LEU A . n A 1 79 SER 79 81 81 SER SER A . n A 1 80 PRO 80 82 82 PRO PRO A . n A 1 81 ASN 81 83 83 ASN ASN A . n A 1 82 ILE 82 84 84 ILE ILE A . n A 1 83 SER 83 85 85 SER SER A . n A 1 84 ALA 84 86 86 ALA ALA A . n A 1 85 CYS 85 87 87 CYS CYS A . n A 1 86 ILE 86 88 88 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 101 101 CA CA A . C 2 CA 1 102 102 CA CA A . # _exptl.entry_id 1LMJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1LMJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1LMJ _struct.title 'NMR Study of the Fibrillin-1 cbEGF12-13 Pair of Ca2+ Binding Epidermal Growth Factor-like Domains' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1LMJ _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text 'EGF, calcium, microfibril, neonatal, Marfan syndrome, connective tissue, extracellular matrix, STRUCTURAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FBN1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSP NISACI ; _struct_ref.pdbx_align_begin 1200 _struct_ref.pdbx_db_accession P35555 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1LMJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P35555 _struct_ref_seq.db_align_beg 1200 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1285 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 88 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 47 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 52 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 49 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 54 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 18 SG ? ? A CYS 8 A CYS 20 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 15 A CYS 29 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf3 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 43 SG ? ? A CYS 31 A CYS 45 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf4 disulf ? ? A CYS 49 SG ? ? ? 1_555 A CYS 61 SG ? ? A CYS 51 A CYS 63 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf5 disulf ? ? A CYS 56 SG ? ? ? 1_555 A CYS 70 SG ? ? A CYS 58 A CYS 72 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf6 disulf ? ? A CYS 72 SG ? ? ? 1_555 A CYS 85 SG ? ? A CYS 74 A CYS 87 1_555 ? ? ? ? ? ? ? 2.032 ? ? metalc1 metalc ? ? A ASP 2 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 4 A CA 101 1_555 ? ? ? ? ? ? ? 2.580 ? ? metalc2 metalc ? ? A ILE 3 O ? ? ? 1_555 B CA . CA ? ? A ILE 5 A CA 101 1_555 ? ? ? ? ? ? ? 2.446 ? ? metalc3 metalc ? ? A GLU 5 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 7 A CA 101 1_555 ? ? ? ? ? ? ? 2.609 ? ? metalc4 metalc ? ? A GLU 5 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 7 A CA 101 1_555 ? ? ? ? ? ? ? 2.450 ? ? metalc5 metalc ? ? A ASN 20 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 22 A CA 101 1_555 ? ? ? ? ? ? ? 2.602 ? ? metalc6 metalc ? ? A ASN 20 ND2 ? ? ? 1_555 B CA . CA ? ? A ASN 22 A CA 101 1_555 ? ? ? ? ? ? ? 2.785 ? ? metalc7 metalc ? ? A THR 21 O ? ? ? 1_555 B CA . CA ? ? A THR 23 A CA 101 1_555 ? ? ? ? ? ? ? 2.448 ? ? metalc8 metalc ? ? A THR 21 N ? ? ? 1_555 B CA . CA ? ? A THR 23 A CA 101 1_555 ? ? ? ? ? ? ? 3.227 ? ? metalc9 metalc ? ? A ASP 24 O ? ? ? 1_555 B CA . CA ? ? A ASP 26 A CA 101 1_555 ? ? ? ? ? ? ? 3.337 ? ? metalc10 metalc ? ? A ASP 45 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 47 A CA 102 1_555 ? ? ? ? ? ? ? 2.447 ? ? metalc11 metalc ? ? A ILE 46 O ? ? ? 1_555 C CA . CA ? ? A ILE 48 A CA 102 1_555 ? ? ? ? ? ? ? 2.444 ? ? metalc12 metalc ? ? A GLU 48 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 50 A CA 102 1_555 ? ? ? ? ? ? ? 2.435 ? ? metalc13 metalc ? ? A GLU 48 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 50 A CA 102 1_555 ? ? ? ? ? ? ? 2.609 ? ? metalc14 metalc ? ? A ASN 63 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 65 A CA 102 1_555 ? ? ? ? ? ? ? 2.447 ? ? metalc15 metalc ? ? A ASN 63 ND2 ? ? ? 1_555 C CA . CA ? ? A ASN 65 A CA 102 1_555 ? ? ? ? ? ? ? 2.869 ? ? metalc16 metalc ? ? A THR 64 O ? ? ? 1_555 C CA . CA ? ? A THR 66 A CA 102 1_555 ? ? ? ? ? ? ? 2.609 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 2 ? A ASP 4 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ILE 3 ? A ILE 5 ? 1_555 115.3 ? 2 OD1 ? A ASP 2 ? A ASP 4 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 5 ? A GLU 7 ? 1_555 139.8 ? 3 O ? A ILE 3 ? A ILE 5 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 5 ? A GLU 7 ? 1_555 54.9 ? 4 OD1 ? A ASP 2 ? A ASP 4 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 5 ? A GLU 7 ? 1_555 168.4 ? 5 O ? A ILE 3 ? A ILE 5 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 5 ? A GLU 7 ? 1_555 66.9 ? 6 OE2 ? A GLU 5 ? A GLU 7 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 5 ? A GLU 7 ? 1_555 51.4 ? 7 OD1 ? A ASP 2 ? A ASP 4 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASN 20 ? A ASN 22 ? 1_555 68.8 ? 8 O ? A ILE 3 ? A ILE 5 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASN 20 ? A ASN 22 ? 1_555 89.5 ? 9 OE2 ? A GLU 5 ? A GLU 7 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASN 20 ? A ASN 22 ? 1_555 139.5 ? 10 OE1 ? A GLU 5 ? A GLU 7 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASN 20 ? A ASN 22 ? 1_555 100.2 ? 11 OD1 ? A ASP 2 ? A ASP 4 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 ND2 ? A ASN 20 ? A ASN 22 ? 1_555 115.8 ? 12 O ? A ILE 3 ? A ILE 5 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 ND2 ? A ASN 20 ? A ASN 22 ? 1_555 57.4 ? 13 OE2 ? A GLU 5 ? A GLU 7 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 ND2 ? A ASN 20 ? A ASN 22 ? 1_555 91.9 ? 14 OE1 ? A GLU 5 ? A GLU 7 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 ND2 ? A ASN 20 ? A ASN 22 ? 1_555 54.8 ? 15 OD1 ? A ASN 20 ? A ASN 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 ND2 ? A ASN 20 ? A ASN 22 ? 1_555 49.1 ? 16 OD1 ? A ASP 2 ? A ASP 4 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A THR 21 ? A THR 23 ? 1_555 78.0 ? 17 O ? A ILE 3 ? A ILE 5 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A THR 21 ? A THR 23 ? 1_555 155.3 ? 18 OE2 ? A GLU 5 ? A GLU 7 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A THR 21 ? A THR 23 ? 1_555 101.2 ? 19 OE1 ? A GLU 5 ? A GLU 7 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A THR 21 ? A THR 23 ? 1_555 104.5 ? 20 OD1 ? A ASN 20 ? A ASN 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A THR 21 ? A THR 23 ? 1_555 115.1 ? 21 ND2 ? A ASN 20 ? A ASN 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A THR 21 ? A THR 23 ? 1_555 137.9 ? 22 OD1 ? A ASP 2 ? A ASP 4 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 N ? A THR 21 ? A THR 23 ? 1_555 93.6 ? 23 O ? A ILE 3 ? A ILE 5 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 N ? A THR 21 ? A THR 23 ? 1_555 137.6 ? 24 OE2 ? A GLU 5 ? A GLU 7 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 N ? A THR 21 ? A THR 23 ? 1_555 119.7 ? 25 OE1 ? A GLU 5 ? A GLU 7 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 N ? A THR 21 ? A THR 23 ? 1_555 79.0 ? 26 OD1 ? A ASN 20 ? A ASN 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 N ? A THR 21 ? A THR 23 ? 1_555 72.0 ? 27 ND2 ? A ASN 20 ? A ASN 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 N ? A THR 21 ? A THR 23 ? 1_555 82.8 ? 28 O ? A THR 21 ? A THR 23 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 N ? A THR 21 ? A THR 23 ? 1_555 55.9 ? 29 OD1 ? A ASP 2 ? A ASP 4 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ASP 24 ? A ASP 26 ? 1_555 122.2 ? 30 O ? A ILE 3 ? A ILE 5 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ASP 24 ? A ASP 26 ? 1_555 120.3 ? 31 OE2 ? A GLU 5 ? A GLU 7 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ASP 24 ? A ASP 26 ? 1_555 70.8 ? 32 OE1 ? A GLU 5 ? A GLU 7 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ASP 24 ? A ASP 26 ? 1_555 60.3 ? 33 OD1 ? A ASN 20 ? A ASN 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ASP 24 ? A ASP 26 ? 1_555 124.6 ? 34 ND2 ? A ASN 20 ? A ASN 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ASP 24 ? A ASP 26 ? 1_555 106.7 ? 35 O ? A THR 21 ? A THR 23 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ASP 24 ? A ASP 26 ? 1_555 44.4 ? 36 N ? A THR 21 ? A THR 23 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A ASP 24 ? A ASP 26 ? 1_555 54.2 ? 37 OD2 ? A ASP 45 ? A ASP 47 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A ILE 46 ? A ILE 48 ? 1_555 108.2 ? 38 OD2 ? A ASP 45 ? A ASP 47 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 48 ? A GLU 50 ? 1_555 138.4 ? 39 O ? A ILE 46 ? A ILE 48 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 48 ? A GLU 50 ? 1_555 103.0 ? 40 OD2 ? A ASP 45 ? A ASP 47 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 48 ? A GLU 50 ? 1_555 154.8 ? 41 O ? A ILE 46 ? A ILE 48 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 48 ? A GLU 50 ? 1_555 86.2 ? 42 OE1 ? A GLU 48 ? A GLU 50 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 48 ? A GLU 50 ? 1_555 51.5 ? 43 OD2 ? A ASP 45 ? A ASP 47 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASN 63 ? A ASN 65 ? 1_555 66.0 ? 44 O ? A ILE 46 ? A ILE 48 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASN 63 ? A ASN 65 ? 1_555 98.3 ? 45 OE1 ? A GLU 48 ? A GLU 50 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASN 63 ? A ASN 65 ? 1_555 83.0 ? 46 OE2 ? A GLU 48 ? A GLU 50 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASN 63 ? A ASN 65 ? 1_555 133.8 ? 47 OD2 ? A ASP 45 ? A ASP 47 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 ND2 ? A ASN 63 ? A ASN 65 ? 1_555 105.2 ? 48 O ? A ILE 46 ? A ILE 48 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 ND2 ? A ASN 63 ? A ASN 65 ? 1_555 57.9 ? 49 OE1 ? A GLU 48 ? A GLU 50 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 ND2 ? A ASN 63 ? A ASN 65 ? 1_555 69.5 ? 50 OE2 ? A GLU 48 ? A GLU 50 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 ND2 ? A ASN 63 ? A ASN 65 ? 1_555 100.0 ? 51 OD1 ? A ASN 63 ? A ASN 65 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 ND2 ? A ASN 63 ? A ASN 65 ? 1_555 49.2 ? 52 OD2 ? A ASP 45 ? A ASP 47 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A THR 64 ? A THR 66 ? 1_555 54.9 ? 53 O ? A ILE 46 ? A ILE 48 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A THR 64 ? A THR 66 ? 1_555 161.6 ? 54 OE1 ? A GLU 48 ? A GLU 50 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A THR 64 ? A THR 66 ? 1_555 89.2 ? 55 OE2 ? A GLU 48 ? A GLU 50 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A THR 64 ? A THR 66 ? 1_555 112.2 ? 56 OD1 ? A ASN 63 ? A ASN 65 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A THR 64 ? A THR 66 ? 1_555 69.2 ? 57 ND2 ? A ASN 63 ? A ASN 65 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A THR 64 ? A THR 66 ? 1_555 115.8 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 6 ? CYS A 18 ? CYS A 8 ? 1_555 CYS A 20 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 13 ? CYS A 27 ? CYS A 15 ? 1_555 CYS A 29 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 29 ? CYS A 43 ? CYS A 31 ? 1_555 CYS A 45 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 49 ? CYS A 61 ? CYS A 51 ? 1_555 CYS A 63 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 56 ? CYS A 70 ? CYS A 58 ? 1_555 CYS A 72 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS A 72 ? CYS A 85 ? CYS A 74 ? 1_555 CYS A 87 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 1 1.00 2 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 2 1.26 3 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 3 1.15 4 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 4 1.05 5 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 5 1.17 6 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 6 1.28 7 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 7 1.07 8 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 8 0.99 9 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 9 1.43 10 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 10 1.01 11 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 11 1.46 12 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 12 0.83 13 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 13 0.96 14 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 14 1.18 15 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 15 0.86 16 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 16 1.38 17 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 17 1.04 18 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 18 1.10 19 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 19 1.02 20 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 20 1.07 21 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 21 0.98 22 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 22 0.92 23 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 23 1.18 24 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 24 1.13 25 CYS 72 A . ? CYS 74 A PRO 73 A ? PRO 75 A 25 1.09 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 18 ? THR A 21 ? CYS A 20 THR A 23 A 2 ASP A 24 ? CYS A 27 ? ASP A 26 CYS A 29 B 1 TYR A 33 ? SER A 35 ? TYR A 35 SER A 37 B 2 CYS A 43 ? ASP A 45 ? CYS A 45 ASP A 47 C 1 VAL A 60 ? THR A 64 ? VAL A 62 THR A 66 C 2 SER A 67 ? GLU A 71 ? SER A 69 GLU A 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 19 ? N VAL A 21 O GLU A 26 ? O GLU A 28 B 1 2 N GLU A 34 ? N GLU A 36 O MET A 44 ? O MET A 46 C 1 2 N HIS A 62 ? N HIS A 64 O ARG A 69 ? O ARG A 71 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 101 ? 6 'BINDING SITE FOR RESIDUE CA A 101' AC2 Software A CA 102 ? 6 'BINDING SITE FOR RESIDUE CA A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 2 ? ASP A 4 . ? 1_555 ? 2 AC1 6 ILE A 3 ? ILE A 5 . ? 1_555 ? 3 AC1 6 GLU A 5 ? GLU A 7 . ? 1_555 ? 4 AC1 6 ASN A 20 ? ASN A 22 . ? 1_555 ? 5 AC1 6 THR A 21 ? THR A 23 . ? 1_555 ? 6 AC1 6 ASP A 24 ? ASP A 26 . ? 1_555 ? 7 AC2 6 ASP A 45 ? ASP A 47 . ? 1_555 ? 8 AC2 6 ILE A 46 ? ILE A 48 . ? 1_555 ? 9 AC2 6 GLU A 48 ? GLU A 50 . ? 1_555 ? 10 AC2 6 ASN A 63 ? ASN A 65 . ? 1_555 ? 11 AC2 6 THR A 64 ? THR A 66 . ? 1_555 ? 12 AC2 6 SER A 67 ? SER A 69 . ? 1_555 ? # _pdbx_entry_details.entry_id 1LMJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASP 49 ? ? H A GLN 52 ? ? 1.52 2 1 O A GLY 34 ? ? H A ILE 48 ? ? 1.54 3 1 O A GLY 38 ? ? H A MET 42 ? ? 1.56 4 1 O A ASP 13 ? ? H A GLY 16 ? ? 1.57 5 1 O A ILE 5 ? ? HD22 A ASN 22 ? ? 1.58 6 2 O A ASP 49 ? ? H A GLN 52 ? ? 1.56 7 2 O A CYS 58 ? ? H A GLY 60 ? ? 1.57 8 2 OD1 A ASP 6 ? ? H A ARG 9 ? ? 1.57 9 2 O A GLY 34 ? ? H A ILE 48 ? ? 1.57 10 3 O A ASP 49 ? ? H A GLN 52 ? ? 1.55 11 4 O A ASP 49 ? ? H A GLN 52 ? ? 1.51 12 4 O A GLY 34 ? ? H A ILE 48 ? ? 1.55 13 4 O A ILE 5 ? ? HD22 A ASN 22 ? ? 1.58 14 5 O A ASP 49 ? ? H A GLN 52 ? ? 1.53 15 5 O A GLY 34 ? ? H A ILE 48 ? ? 1.54 16 5 O A ILE 48 ? ? HD22 A ASN 65 ? ? 1.57 17 5 O A ASP 13 ? ? H A GLY 16 ? ? 1.57 18 5 H A VAL 21 ? ? O A GLU 28 ? ? 1.58 19 6 O A ASP 49 ? ? H A GLN 52 ? ? 1.53 20 6 O A ASP 13 ? ? H A GLY 16 ? ? 1.55 21 6 O A GLY 34 ? ? H A ILE 48 ? ? 1.57 22 6 H A GLY 38 ? ? O A ASN 44 ? ? 1.58 23 7 O A ASP 49 ? ? H A GLN 52 ? ? 1.55 24 7 H A VAL 21 ? ? O A GLU 28 ? ? 1.56 25 7 O A GLY 34 ? ? H A ILE 48 ? ? 1.57 26 7 O A ASP 13 ? ? H A GLY 16 ? ? 1.58 27 7 OD1 A ASP 6 ? ? H A ARG 9 ? ? 1.59 28 8 O A ASP 13 ? ? H A GLY 16 ? ? 1.54 29 8 O A ASP 49 ? ? H A GLN 52 ? ? 1.54 30 8 O A GLY 34 ? ? H A ILE 48 ? ? 1.56 31 9 O A ASP 49 ? ? H A GLN 52 ? ? 1.53 32 9 O A GLY 34 ? ? H A ILE 48 ? ? 1.53 33 9 H A VAL 21 ? ? O A GLU 28 ? ? 1.54 34 9 O A ASP 13 ? ? H A GLY 16 ? ? 1.56 35 9 O A ILE 48 ? ? HD22 A ASN 65 ? ? 1.56 36 9 OD1 A ASP 6 ? ? H A ARG 9 ? ? 1.58 37 10 O A GLY 34 ? ? H A ILE 48 ? ? 1.54 38 10 O A ASP 49 ? ? H A GLN 52 ? ? 1.55 39 10 O A ASP 13 ? ? H A GLY 16 ? ? 1.56 40 10 OD1 A ASP 6 ? ? H A ARG 9 ? ? 1.58 41 10 O A CYS 58 ? ? H A GLY 61 ? ? 1.59 42 10 O A ILE 48 ? ? HD22 A ASN 65 ? ? 1.59 43 11 O A GLY 34 ? ? H A ILE 48 ? ? 1.46 44 11 O A ASP 49 ? ? H A GLN 52 ? ? 1.56 45 11 O A ILE 48 ? ? HD22 A ASN 65 ? ? 1.56 46 11 H A VAL 21 ? ? O A GLU 28 ? ? 1.57 47 12 O A GLY 34 ? ? H A ILE 48 ? ? 1.49 48 12 H A VAL 21 ? ? O A GLU 28 ? ? 1.52 49 12 O A ASP 49 ? ? H A GLN 52 ? ? 1.54 50 12 O A ASP 13 ? ? H A GLY 16 ? ? 1.55 51 13 O A GLY 34 ? ? H A ILE 48 ? ? 1.51 52 13 O A ILE 48 ? ? HD22 A ASN 65 ? ? 1.54 53 13 O A ASP 49 ? ? H A GLN 52 ? ? 1.56 54 13 O A CYS 15 ? ? H A CYS 45 ? ? 1.56 55 13 O A CYS 58 ? ? H A GLY 61 ? ? 1.57 56 13 O A THR 3 ? ? H A ILE 5 ? ? 1.59 57 14 O A GLY 34 ? ? H A ILE 48 ? ? 1.52 58 14 O A ASP 49 ? ? H A GLN 52 ? ? 1.54 59 14 O A ASP 13 ? ? H A GLY 16 ? ? 1.55 60 14 O A ILE 48 ? ? HD22 A ASN 65 ? ? 1.58 61 14 H A VAL 21 ? ? O A GLU 28 ? ? 1.58 62 14 OD1 A ASP 6 ? ? H A ARG 9 ? ? 1.58 63 15 O A ASP 49 ? ? H A GLN 52 ? ? 1.51 64 15 O A ILE 48 ? ? HD22 A ASN 65 ? ? 1.58 65 15 O A PHE 27 ? ? HZ2 A LYS 43 ? ? 1.59 66 16 O A GLY 34 ? ? H A ILE 48 ? ? 1.48 67 16 O A ASP 49 ? ? H A GLN 52 ? ? 1.53 68 16 O A ILE 48 ? ? HD22 A ASN 65 ? ? 1.55 69 16 O A ASP 13 ? ? H A GLY 16 ? ? 1.55 70 16 O A ILE 5 ? ? HD22 A ASN 22 ? ? 1.57 71 16 O A CYS 58 ? ? H A GLY 61 ? ? 1.58 72 17 O A ASP 13 ? ? H A GLY 16 ? ? 1.54 73 17 O A ASP 49 ? ? H A GLN 52 ? ? 1.54 74 17 O A GLY 34 ? ? H A ILE 48 ? ? 1.55 75 17 H A GLN 79 ? ? O A ILE 88 ? ? 1.58 76 18 O A GLY 34 ? ? H A ILE 48 ? ? 1.53 77 18 O A ASP 49 ? ? H A GLN 52 ? ? 1.54 78 18 O A ASP 13 ? ? H A GLY 16 ? ? 1.57 79 18 O A CYS 58 ? ? H A GLY 61 ? ? 1.57 80 19 O A GLY 34 ? ? H A ILE 48 ? ? 1.53 81 19 H A VAL 21 ? ? O A GLU 28 ? ? 1.54 82 19 O A ASP 13 ? ? H A GLY 16 ? ? 1.56 83 19 O A CYS 58 ? ? H A GLY 60 ? ? 1.57 84 19 O A ASP 49 ? ? H A GLN 52 ? ? 1.57 85 20 O A GLY 34 ? ? H A ILE 48 ? ? 1.48 86 20 O A ASP 49 ? ? H A GLN 52 ? ? 1.54 87 20 O A ASP 13 ? ? H A GLY 16 ? ? 1.55 88 21 O A GLY 34 ? ? H A ILE 48 ? ? 1.51 89 21 O A ILE 48 ? ? HD22 A ASN 65 ? ? 1.54 90 21 O A ASP 49 ? ? H A GLN 52 ? ? 1.58 91 21 H A VAL 21 ? ? O A GLU 28 ? ? 1.58 92 21 O A CYS 58 ? ? H A GLY 60 ? ? 1.58 93 22 O A ASP 49 ? ? H A GLN 52 ? ? 1.56 94 22 H A VAL 21 ? ? O A GLU 28 ? ? 1.57 95 22 O A CYS 58 ? ? H A GLY 61 ? ? 1.57 96 22 O A ASP 13 ? ? H A GLY 16 ? ? 1.58 97 22 O A MET 42 ? ? HZ3 A LYS 43 ? ? 1.59 98 22 O A GLY 34 ? ? H A ILE 48 ? ? 1.60 99 23 O A GLY 34 ? ? H A ILE 48 ? ? 1.53 100 23 O A ASP 13 ? ? H A GLY 16 ? ? 1.54 101 23 H A GLN 79 ? ? OXT A ILE 88 ? ? 1.54 102 23 O A ASP 49 ? ? H A GLN 52 ? ? 1.56 103 23 O A CYS 15 ? ? H A CYS 45 ? ? 1.57 104 23 O A PHE 27 ? ? HZ2 A LYS 43 ? ? 1.59 105 24 O A ASP 49 ? ? H A GLN 52 ? ? 1.54 106 24 O A GLY 34 ? ? H A ILE 48 ? ? 1.57 107 24 O A ASP 13 ? ? H A GLY 16 ? ? 1.58 108 24 O A ILE 48 ? ? HD22 A ASN 65 ? ? 1.59 109 25 O A GLY 34 ? ? H A ILE 48 ? ? 1.50 110 25 O A ASP 49 ? ? H A GLN 52 ? ? 1.52 111 25 O A ILE 48 ? ? HD22 A ASN 65 ? ? 1.54 112 25 H A VAL 21 ? ? O A GLU 28 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 4 ? ? 39.20 68.52 2 1 ARG A 17 ? ? 173.21 -50.39 3 1 ASP A 26 ? ? 167.30 -178.38 4 1 LYS A 30 ? ? -117.88 74.33 5 1 CYS A 31 ? ? -46.06 -179.71 6 1 ASP A 32 ? ? -106.62 -141.53 7 1 GLU A 33 ? ? -23.10 -92.32 8 1 SER A 37 ? ? -33.96 114.76 9 1 MET A 42 ? ? 178.73 -81.23 10 1 LYS A 43 ? ? 178.01 33.49 11 1 ASN A 44 ? ? -85.21 -157.97 12 1 ASP A 47 ? ? -10.91 131.01 13 1 CYS A 58 ? ? 44.01 26.98 14 1 THR A 66 ? ? -120.01 -165.55 15 1 SER A 69 ? ? 169.95 -178.67 16 1 PRO A 75 ? ? -71.85 -169.30 17 1 PRO A 76 ? ? -43.22 178.81 18 1 HIS A 78 ? ? -104.23 -127.95 19 1 GLN A 79 ? ? -150.53 59.90 20 1 ASN A 83 ? ? -146.95 21.21 21 1 SER A 85 ? ? 75.57 91.93 22 1 ALA A 86 ? ? 150.61 103.81 23 2 GLU A 7 ? ? 68.53 -52.91 24 2 ILE A 10 ? ? -39.92 -37.69 25 2 ARG A 17 ? ? 178.42 -50.79 26 2 ASP A 26 ? ? 169.13 -167.39 27 2 GLU A 28 ? ? -144.74 -145.59 28 2 LYS A 30 ? ? -105.82 67.82 29 2 CYS A 31 ? ? -45.40 175.90 30 2 ASP A 32 ? ? -72.86 -93.15 31 2 GLU A 33 ? ? -141.95 -39.87 32 2 MET A 40 ? ? 176.69 -31.79 33 2 MET A 42 ? ? 104.62 -21.15 34 2 LYS A 43 ? ? -171.38 100.32 35 2 ASN A 44 ? ? -158.98 33.72 36 2 CYS A 45 ? ? 9.52 106.74 37 2 ASP A 47 ? ? -2.10 105.30 38 2 ILE A 48 ? ? -50.55 174.46 39 2 CYS A 58 ? ? 48.97 24.66 40 2 ARG A 59 ? ? -65.22 61.52 41 2 ASN A 65 ? ? -47.83 109.77 42 2 SER A 69 ? ? 158.06 178.61 43 2 PRO A 76 ? ? -35.37 -28.18 44 2 HIS A 78 ? ? -91.85 -129.20 45 2 ASN A 83 ? ? 72.62 -1.24 46 2 SER A 85 ? ? 65.77 84.79 47 2 ALA A 86 ? ? 156.59 98.45 48 3 ASP A 4 ? ? -177.90 66.54 49 3 ARG A 17 ? ? 174.11 -29.70 50 3 ASP A 26 ? ? 167.42 -174.22 51 3 CYS A 31 ? ? -39.29 166.10 52 3 ASP A 32 ? ? -55.73 -96.57 53 3 PHE A 39 ? ? -131.57 -46.10 54 3 MET A 41 ? ? 84.91 37.04 55 3 MET A 42 ? ? -145.36 15.38 56 3 LYS A 43 ? ? 34.75 45.56 57 3 ASN A 44 ? ? -88.22 35.00 58 3 CYS A 45 ? ? 22.50 102.72 59 3 ASP A 47 ? ? 11.86 89.37 60 3 ILE A 48 ? ? -33.45 155.81 61 3 ARG A 59 ? ? -60.96 71.55 62 3 THR A 66 ? ? -115.84 -161.93 63 3 SER A 69 ? ? 156.32 -175.80 64 3 PRO A 76 ? ? -33.65 -28.54 65 3 HIS A 78 ? ? -89.40 -125.42 66 3 SER A 85 ? ? 74.08 69.18 67 3 ALA A 86 ? ? 166.40 100.73 68 4 ASP A 4 ? ? -176.44 85.92 69 4 GLU A 7 ? ? 72.99 -56.94 70 4 ARG A 17 ? ? 177.35 -37.92 71 4 ASP A 26 ? ? 168.75 -160.38 72 4 GLU A 28 ? ? -104.77 -146.88 73 4 CYS A 31 ? ? -50.04 -173.78 74 4 ASP A 32 ? ? -136.74 -151.71 75 4 GLU A 33 ? ? -0.71 -86.32 76 4 SER A 37 ? ? -28.54 113.98 77 4 PHE A 39 ? ? 88.17 -24.47 78 4 MET A 42 ? ? 164.40 -51.10 79 4 LYS A 43 ? ? 174.38 104.81 80 4 ASN A 44 ? ? -159.66 49.77 81 4 CYS A 45 ? ? 15.65 110.46 82 4 ASP A 47 ? ? -25.45 126.53 83 4 ILE A 48 ? ? -54.68 -174.15 84 4 ASP A 49 ? ? -101.55 73.05 85 4 CYS A 58 ? ? 46.71 25.67 86 4 SER A 69 ? ? 172.78 168.73 87 4 PRO A 76 ? ? -35.40 -28.36 88 4 HIS A 78 ? ? -93.72 -130.44 89 4 ASN A 83 ? ? 73.39 -3.21 90 4 SER A 85 ? ? 72.23 87.50 91 4 ALA A 86 ? ? 153.78 100.85 92 5 ASP A 4 ? ? 178.93 84.51 93 5 ASP A 6 ? ? -61.31 84.00 94 5 ARG A 17 ? ? -134.90 -46.74 95 5 CYS A 20 ? ? -40.22 150.90 96 5 ASP A 26 ? ? 168.68 -179.73 97 5 GLU A 28 ? ? -162.56 -147.52 98 5 CYS A 29 ? ? -170.40 -176.83 99 5 CYS A 31 ? ? -40.61 167.60 100 5 ASP A 32 ? ? -60.24 -99.04 101 5 MET A 41 ? ? 86.53 38.11 102 5 LYS A 43 ? ? 51.93 96.68 103 5 ASN A 44 ? ? -157.20 44.32 104 5 CYS A 45 ? ? 5.20 107.82 105 5 ASP A 47 ? ? -21.81 102.49 106 5 ILE A 48 ? ? -46.91 -178.37 107 5 ASP A 49 ? ? -106.82 71.04 108 5 ARG A 59 ? ? -36.95 -36.61 109 5 GLU A 67 ? ? -49.84 -102.81 110 5 SER A 69 ? ? 170.44 -161.11 111 5 PRO A 76 ? ? -37.32 -29.74 112 5 HIS A 78 ? ? -87.01 -127.17 113 5 ASN A 83 ? ? -149.76 33.33 114 5 SER A 85 ? ? 82.73 84.08 115 5 ALA A 86 ? ? 158.63 102.68 116 6 ASP A 4 ? ? 167.23 91.24 117 6 GLU A 7 ? ? 72.07 -55.89 118 6 ARG A 17 ? ? 153.63 -40.86 119 6 ASP A 26 ? ? 169.43 -168.22 120 6 ASP A 32 ? ? -60.63 -91.42 121 6 GLU A 33 ? ? -145.39 -38.58 122 6 MET A 40 ? ? 158.52 -27.18 123 6 MET A 42 ? ? 179.10 -87.18 124 6 LYS A 43 ? ? -162.13 37.63 125 6 ASP A 47 ? ? -6.50 109.84 126 6 ILE A 48 ? ? -53.85 -177.31 127 6 CYS A 58 ? ? 47.83 24.61 128 6 THR A 66 ? ? -111.89 -162.56 129 6 SER A 69 ? ? 166.00 178.15 130 6 PRO A 76 ? ? -36.45 -26.94 131 6 HIS A 78 ? ? -90.06 -127.80 132 6 ASN A 83 ? ? -158.24 32.93 133 6 SER A 85 ? ? 67.62 85.32 134 6 ALA A 86 ? ? 150.45 101.73 135 7 ARG A 17 ? ? 166.04 -59.99 136 7 ASP A 26 ? ? 166.55 -178.07 137 7 GLU A 28 ? ? -123.32 -167.61 138 7 CYS A 31 ? ? -60.15 -179.20 139 7 ASP A 32 ? ? -90.66 -151.95 140 7 GLU A 33 ? ? -33.13 -74.89 141 7 PHE A 39 ? ? -111.94 -76.69 142 7 MET A 42 ? ? 123.27 -43.39 143 7 LYS A 43 ? ? -158.72 20.32 144 7 ASP A 47 ? ? -21.36 103.06 145 7 ILE A 48 ? ? -46.52 -177.44 146 7 ARG A 59 ? ? -38.49 -38.46 147 7 THR A 66 ? ? -109.35 -161.98 148 7 SER A 69 ? ? 168.20 -172.70 149 7 PRO A 76 ? ? -84.39 -155.54 150 7 HIS A 78 ? ? 161.00 -165.20 151 7 LEU A 80 ? ? -56.98 107.81 152 7 SER A 85 ? ? 91.75 79.51 153 7 ALA A 86 ? ? 154.18 102.02 154 8 ASP A 4 ? ? 41.58 90.56 155 8 GLU A 7 ? ? 73.11 -55.49 156 8 ARG A 17 ? ? 162.15 -37.03 157 8 PRO A 24 ? ? -50.51 103.14 158 8 ASP A 26 ? ? 178.80 -166.21 159 8 PHE A 27 ? ? -172.45 139.86 160 8 GLU A 28 ? ? -105.97 -147.50 161 8 CYS A 31 ? ? -49.59 -174.47 162 8 ASP A 32 ? ? -125.96 -156.44 163 8 GLU A 33 ? ? 8.32 -75.52 164 8 MET A 40 ? ? 158.14 -25.05 165 8 MET A 42 ? ? 166.00 -63.64 166 8 LYS A 43 ? ? -177.01 29.72 167 8 ASP A 47 ? ? -21.83 101.58 168 8 ILE A 48 ? ? -48.42 -173.92 169 8 CYS A 58 ? ? 49.22 21.66 170 8 ARG A 59 ? ? -62.29 87.87 171 8 SER A 69 ? ? 164.69 174.31 172 8 PRO A 75 ? ? -73.74 -168.54 173 8 PRO A 76 ? ? -40.57 172.96 174 8 HIS A 78 ? ? -139.74 -136.86 175 8 GLN A 79 ? ? -150.08 84.50 176 8 ASN A 83 ? ? -163.24 24.93 177 8 SER A 85 ? ? 87.15 87.68 178 8 ALA A 86 ? ? 153.48 84.32 179 8 CYS A 87 ? ? -38.34 152.90 180 9 ASP A 4 ? ? 158.66 82.99 181 9 ARG A 17 ? ? 174.39 -60.75 182 9 PRO A 24 ? ? -55.24 107.53 183 9 ASP A 26 ? ? 173.75 -167.54 184 9 GLU A 28 ? ? -117.21 -167.41 185 9 LYS A 30 ? ? -101.58 76.26 186 9 CYS A 31 ? ? -41.23 169.57 187 9 ASP A 32 ? ? -91.78 -151.23 188 9 GLU A 33 ? ? -33.12 -95.91 189 9 MET A 40 ? ? 158.65 -22.22 190 9 MET A 42 ? ? 131.69 -41.23 191 9 LYS A 43 ? ? 177.98 104.14 192 9 ASN A 44 ? ? -166.97 50.52 193 9 CYS A 45 ? ? 5.93 100.07 194 9 ASP A 47 ? ? -20.89 101.61 195 9 ILE A 48 ? ? -42.13 176.61 196 9 ASN A 65 ? ? -44.53 109.13 197 9 SER A 69 ? ? -167.72 -169.00 198 9 TYR A 70 ? ? -171.47 139.76 199 9 PRO A 76 ? ? -35.36 -27.94 200 9 HIS A 78 ? ? -89.65 -126.47 201 9 GLN A 79 ? ? -143.19 58.08 202 9 SER A 85 ? ? 65.70 87.74 203 9 ALA A 86 ? ? 154.36 102.11 204 10 ASP A 4 ? ? -177.34 107.76 205 10 ARG A 17 ? ? 172.58 -44.34 206 10 ASP A 26 ? ? 168.96 -162.92 207 10 GLU A 28 ? ? -101.61 -150.97 208 10 CYS A 31 ? ? -44.83 177.65 209 10 ASP A 32 ? ? -93.87 -73.44 210 10 GLU A 33 ? ? -131.95 -74.28 211 10 SER A 37 ? ? -45.49 81.97 212 10 MET A 40 ? ? 107.97 -22.41 213 10 MET A 42 ? ? -162.31 -75.05 214 10 LYS A 43 ? ? 179.97 -24.53 215 10 ASN A 44 ? ? -46.00 90.00 216 10 CYS A 45 ? ? -36.15 103.56 217 10 ASP A 47 ? ? -22.39 118.22 218 10 ILE A 48 ? ? -58.47 -170.75 219 10 SER A 69 ? ? 172.90 158.75 220 10 PRO A 76 ? ? -39.94 173.55 221 10 HIS A 78 ? ? -101.12 -126.02 222 10 GLN A 79 ? ? -151.30 64.64 223 10 ASN A 83 ? ? 71.10 -1.18 224 10 SER A 85 ? ? 85.03 84.27 225 10 ALA A 86 ? ? 151.34 96.77 226 11 ASP A 4 ? ? 43.27 73.56 227 11 CYS A 15 ? ? -89.51 36.84 228 11 ARG A 17 ? ? 116.53 13.15 229 11 ASP A 26 ? ? 165.31 -169.47 230 11 GLU A 28 ? ? -167.88 -155.07 231 11 ASP A 32 ? ? -68.39 -88.80 232 11 GLU A 33 ? ? -122.61 -80.75 233 11 MET A 40 ? ? 155.47 -38.75 234 11 MET A 42 ? ? -163.09 -94.49 235 11 LYS A 43 ? ? -168.47 96.92 236 11 ASP A 47 ? ? -15.77 104.24 237 11 ILE A 48 ? ? -45.04 179.45 238 11 CYS A 58 ? ? 47.64 24.98 239 11 HIS A 64 ? ? -104.45 67.88 240 11 SER A 69 ? ? -169.74 -168.99 241 11 PRO A 76 ? ? -39.86 -24.92 242 11 HIS A 78 ? ? -83.39 -121.08 243 11 SER A 85 ? ? 66.57 86.00 244 11 ALA A 86 ? ? 147.64 98.77 245 12 ASP A 4 ? ? 37.37 69.39 246 12 ASP A 6 ? ? -69.58 90.72 247 12 ARG A 17 ? ? 175.09 -52.55 248 12 ASP A 26 ? ? 171.11 -175.61 249 12 CYS A 31 ? ? -39.03 165.02 250 12 ASP A 32 ? ? -77.15 -144.90 251 12 GLU A 33 ? ? -28.15 -93.41 252 12 SER A 37 ? ? -42.31 100.39 253 12 PHE A 39 ? ? 87.39 -22.16 254 12 MET A 42 ? ? 179.31 -69.77 255 12 LYS A 43 ? ? 173.31 34.77 256 12 ASN A 44 ? ? -62.44 -177.03 257 12 ASP A 47 ? ? -9.14 125.89 258 12 ILE A 48 ? ? -64.94 -174.54 259 12 ASP A 49 ? ? -100.44 73.54 260 12 CYS A 58 ? ? 45.93 25.89 261 12 ARG A 59 ? ? -62.31 70.54 262 12 THR A 66 ? ? -112.70 -161.08 263 12 SER A 69 ? ? 157.61 -176.07 264 12 PRO A 76 ? ? -83.38 -154.27 265 12 HIS A 78 ? ? 163.51 -162.38 266 12 LEU A 80 ? ? -63.83 91.60 267 12 ASN A 83 ? ? 75.97 34.26 268 12 SER A 85 ? ? 88.74 69.27 269 12 ALA A 86 ? ? 156.03 116.90 270 13 ASP A 4 ? ? -64.54 63.79 271 13 ARG A 17 ? ? -173.57 -44.26 272 13 PRO A 24 ? ? -55.59 105.88 273 13 ASP A 26 ? ? 175.57 -168.17 274 13 LYS A 30 ? ? -113.36 71.66 275 13 CYS A 31 ? ? -50.74 -175.10 276 13 ASP A 32 ? ? -140.62 -158.25 277 13 GLU A 33 ? ? 19.88 -82.89 278 13 MET A 40 ? ? 159.70 -28.93 279 13 MET A 42 ? ? 124.26 -19.98 280 13 LYS A 43 ? ? -164.80 -80.09 281 13 ASN A 44 ? ? 21.94 102.52 282 13 CYS A 45 ? ? -39.21 95.05 283 13 ASP A 47 ? ? -5.51 123.24 284 13 ILE A 48 ? ? -63.20 -171.46 285 13 ARG A 59 ? ? -39.42 -31.15 286 13 THR A 66 ? ? -119.43 -162.07 287 13 SER A 69 ? ? 172.89 -169.80 288 13 PRO A 76 ? ? -39.29 172.94 289 13 HIS A 78 ? ? -99.48 -126.12 290 13 GLN A 79 ? ? -151.67 64.52 291 13 ASN A 83 ? ? 71.83 -0.61 292 13 SER A 85 ? ? 85.98 81.95 293 13 ALA A 86 ? ? 155.02 101.02 294 14 ASP A 6 ? ? -42.39 -84.21 295 14 GLU A 7 ? ? 95.37 -52.79 296 14 ILE A 10 ? ? -38.18 -36.57 297 14 ARG A 17 ? ? 163.29 -59.33 298 14 ASP A 26 ? ? 171.41 177.91 299 14 LYS A 30 ? ? -112.76 75.73 300 14 CYS A 31 ? ? -45.87 155.78 301 14 ASP A 32 ? ? -57.30 -81.56 302 14 GLU A 33 ? ? -145.11 -40.19 303 14 MET A 40 ? ? 168.32 -29.74 304 14 MET A 42 ? ? 99.17 -15.08 305 14 LYS A 43 ? ? 172.87 99.46 306 14 ASN A 44 ? ? -168.14 72.53 307 14 CYS A 45 ? ? -28.65 108.88 308 14 ASP A 47 ? ? 0.08 106.79 309 14 ILE A 48 ? ? -56.53 -175.92 310 14 CYS A 58 ? ? 58.00 16.79 311 14 HIS A 64 ? ? -89.03 47.78 312 14 THR A 66 ? ? -115.39 -162.27 313 14 SER A 69 ? ? 168.58 168.83 314 14 PRO A 76 ? ? -85.13 -156.78 315 14 HIS A 78 ? ? 160.52 -165.87 316 14 ASN A 83 ? ? -145.36 13.81 317 14 SER A 85 ? ? 65.34 103.45 318 14 ALA A 86 ? ? 127.55 106.77 319 15 ASP A 4 ? ? -178.70 51.52 320 15 ILE A 10 ? ? -37.97 -37.49 321 15 LEU A 14 ? ? -29.68 -57.84 322 15 PRO A 24 ? ? -53.00 104.16 323 15 ASP A 26 ? ? 178.62 -168.68 324 15 PHE A 27 ? ? -173.61 139.50 325 15 GLU A 28 ? ? -106.48 -148.75 326 15 LYS A 30 ? ? -100.87 67.30 327 15 CYS A 31 ? ? -52.52 171.31 328 15 ASP A 32 ? ? -68.58 -84.72 329 15 GLU A 33 ? ? -128.07 -65.95 330 15 MET A 40 ? ? 160.89 -36.05 331 15 MET A 42 ? ? 127.45 -20.28 332 15 LYS A 43 ? ? -148.75 -89.60 333 15 ASN A 44 ? ? 36.27 67.05 334 15 CYS A 45 ? ? -29.70 96.12 335 15 ASP A 47 ? ? -20.87 138.92 336 15 ASP A 49 ? ? -104.07 72.98 337 15 CYS A 58 ? ? 46.80 26.10 338 15 HIS A 64 ? ? -89.99 49.37 339 15 GLU A 67 ? ? -50.50 -98.09 340 15 SER A 69 ? ? 156.80 -173.83 341 15 PRO A 76 ? ? -41.00 176.39 342 15 HIS A 78 ? ? -101.68 -126.97 343 15 GLN A 79 ? ? -151.22 64.80 344 15 ASN A 83 ? ? -147.15 28.52 345 15 SER A 85 ? ? 74.98 89.86 346 15 ALA A 86 ? ? 151.87 99.12 347 16 ASP A 4 ? ? -165.80 86.97 348 16 GLU A 7 ? ? 73.60 -56.90 349 16 ARG A 17 ? ? 172.81 -55.74 350 16 ASP A 26 ? ? 170.01 -163.81 351 16 GLU A 28 ? ? -109.98 -168.12 352 16 CYS A 31 ? ? -41.84 170.32 353 16 ASP A 32 ? ? -80.83 -73.30 354 16 GLU A 33 ? ? -131.21 -85.01 355 16 MET A 40 ? ? 156.14 -34.47 356 16 MET A 42 ? ? 176.75 -65.67 357 16 LYS A 43 ? ? -167.82 23.57 358 16 ASP A 47 ? ? 2.57 115.65 359 16 ILE A 48 ? ? -53.31 -173.07 360 16 SER A 69 ? ? 179.30 -166.01 361 16 TYR A 70 ? ? -173.63 144.85 362 16 PRO A 76 ? ? -28.39 152.09 363 16 HIS A 78 ? ? -120.53 -131.93 364 16 GLN A 79 ? ? -150.32 72.42 365 16 ASN A 83 ? ? -153.69 33.54 366 16 SER A 85 ? ? 65.41 86.88 367 16 ALA A 86 ? ? 150.73 104.23 368 17 ASP A 4 ? ? 173.60 99.81 369 17 GLU A 7 ? ? 71.71 -55.32 370 17 ARG A 17 ? ? 175.95 -51.55 371 17 ASP A 26 ? ? 168.05 -165.74 372 17 ASP A 32 ? ? -89.89 -157.01 373 17 GLU A 33 ? ? 9.42 -77.12 374 17 SER A 37 ? ? -42.96 100.06 375 17 PHE A 39 ? ? 84.48 -12.35 376 17 MET A 42 ? ? 169.22 36.50 377 17 ASN A 44 ? ? -77.21 -152.45 378 17 ASP A 47 ? ? -12.57 110.47 379 17 ILE A 48 ? ? -48.76 -173.61 380 17 ASP A 49 ? ? -101.51 72.92 381 17 LEU A 57 ? ? -30.39 134.74 382 17 CYS A 58 ? ? 38.49 36.13 383 17 THR A 66 ? ? -116.08 -163.47 384 17 SER A 69 ? ? 166.55 177.13 385 17 PRO A 76 ? ? -30.85 -32.87 386 17 HIS A 78 ? ? -103.03 -134.92 387 17 PRO A 82 ? ? -32.96 -115.55 388 17 ASN A 83 ? ? -89.42 39.74 389 17 SER A 85 ? ? 72.04 89.23 390 17 ALA A 86 ? ? 157.37 74.55 391 17 CYS A 87 ? ? -35.89 146.22 392 18 ASP A 4 ? ? 64.06 97.73 393 18 ARG A 17 ? ? -142.34 -40.90 394 18 ASP A 26 ? ? 169.53 176.06 395 18 GLU A 28 ? ? -114.46 -144.99 396 18 CYS A 31 ? ? -42.09 171.88 397 18 ASP A 32 ? ? -85.66 -92.96 398 18 MET A 40 ? ? 160.74 -24.27 399 18 MET A 42 ? ? 109.67 -18.56 400 18 LYS A 43 ? ? 163.25 104.58 401 18 ASN A 44 ? ? -170.01 47.09 402 18 CYS A 45 ? ? -1.60 116.94 403 18 ASP A 47 ? ? -20.93 113.59 404 18 ILE A 48 ? ? -58.48 -173.93 405 18 ASP A 49 ? ? -101.67 72.25 406 18 THR A 66 ? ? -117.33 -162.96 407 18 SER A 69 ? ? 159.39 -172.11 408 18 PRO A 76 ? ? -28.08 150.93 409 18 HIS A 78 ? ? -115.76 -131.09 410 18 GLN A 79 ? ? -150.97 71.39 411 18 ASN A 83 ? ? 73.68 33.29 412 18 SER A 85 ? ? 77.40 72.18 413 18 ALA A 86 ? ? 155.40 99.37 414 19 ASP A 4 ? ? 161.29 91.26 415 19 GLU A 7 ? ? 72.45 -55.46 416 19 ARG A 17 ? ? 176.82 -33.22 417 19 PRO A 24 ? ? -49.77 107.89 418 19 ASP A 26 ? ? 171.99 -165.94 419 19 CYS A 31 ? ? -44.09 174.41 420 19 ASP A 32 ? ? -65.61 -95.12 421 19 GLU A 33 ? ? -114.21 -77.10 422 19 MET A 40 ? ? 156.37 -35.84 423 19 MET A 42 ? ? 179.67 -87.09 424 19 LYS A 43 ? ? -161.20 32.98 425 19 ASP A 47 ? ? -6.09 124.25 426 19 CYS A 58 ? ? 49.76 25.96 427 19 ARG A 59 ? ? -64.72 61.73 428 19 THR A 66 ? ? -108.27 -161.76 429 19 SER A 69 ? ? 158.14 -176.90 430 19 PRO A 76 ? ? -36.74 -29.50 431 19 HIS A 78 ? ? -89.74 -129.34 432 19 ASN A 83 ? ? -143.98 27.92 433 19 SER A 85 ? ? 67.93 91.19 434 19 ALA A 86 ? ? 156.53 99.75 435 20 ASP A 4 ? ? -61.80 79.82 436 20 GLU A 7 ? ? 72.06 -56.38 437 20 ARG A 17 ? ? 173.61 -54.83 438 20 ASP A 26 ? ? 169.17 -165.79 439 20 CYS A 31 ? ? -31.66 152.57 440 20 ASP A 32 ? ? -61.03 -72.77 441 20 GLU A 33 ? ? -155.78 -34.65 442 20 SER A 37 ? ? -8.10 120.08 443 20 MET A 42 ? ? 166.95 -61.92 444 20 LYS A 43 ? ? 172.47 65.35 445 20 CYS A 45 ? ? -10.61 117.60 446 20 ASP A 47 ? ? 7.70 112.33 447 20 ILE A 48 ? ? -48.59 -175.00 448 20 ASP A 49 ? ? -102.32 72.54 449 20 CYS A 58 ? ? 45.98 26.12 450 20 THR A 66 ? ? -111.85 -163.68 451 20 SER A 69 ? ? 171.52 163.40 452 20 PRO A 76 ? ? -36.33 -27.88 453 20 HIS A 78 ? ? -91.03 -128.21 454 20 ASN A 83 ? ? -148.06 24.46 455 20 SER A 85 ? ? 72.92 89.61 456 20 ALA A 86 ? ? 156.80 98.85 457 21 ASP A 4 ? ? 175.55 82.80 458 21 ARG A 17 ? ? 177.53 -32.31 459 21 ASP A 26 ? ? 168.41 -169.68 460 21 CYS A 31 ? ? -42.29 170.72 461 21 ASP A 32 ? ? -63.87 -96.70 462 21 GLU A 33 ? ? -116.94 -74.55 463 21 SER A 37 ? ? -59.64 77.33 464 21 PHE A 39 ? ? 97.66 -14.53 465 21 MET A 40 ? ? 156.12 -24.00 466 21 MET A 42 ? ? 155.02 -59.07 467 21 LYS A 43 ? ? 179.35 105.07 468 21 ASN A 44 ? ? -161.21 27.75 469 21 CYS A 45 ? ? 42.72 106.00 470 21 ASP A 47 ? ? 0.27 117.32 471 21 ILE A 48 ? ? -65.64 -173.29 472 21 CYS A 58 ? ? 45.02 26.62 473 21 ARG A 59 ? ? -64.89 62.88 474 21 THR A 66 ? ? -114.26 -161.63 475 21 SER A 69 ? ? 171.68 177.86 476 21 PRO A 76 ? ? -36.26 -30.32 477 21 HIS A 78 ? ? -88.70 -127.62 478 21 ASN A 83 ? ? -145.51 25.57 479 21 SER A 85 ? ? 73.79 90.42 480 21 ALA A 86 ? ? 156.25 101.46 481 22 ASP A 4 ? ? 61.89 105.75 482 22 GLU A 7 ? ? 67.43 -53.05 483 22 ARG A 17 ? ? 157.33 -60.16 484 22 ASP A 26 ? ? 168.81 -164.07 485 22 GLU A 28 ? ? -111.45 -167.64 486 22 CYS A 31 ? ? -42.41 169.10 487 22 ASP A 32 ? ? -64.82 -93.43 488 22 MET A 40 ? ? 158.93 -32.90 489 22 MET A 42 ? ? 156.27 -59.43 490 22 LYS A 43 ? ? -158.13 22.63 491 22 ASN A 44 ? ? -63.62 76.02 492 22 CYS A 45 ? ? -37.48 100.45 493 22 ASP A 47 ? ? -21.20 100.23 494 22 ILE A 48 ? ? -47.55 -176.46 495 22 CYS A 58 ? ? 56.30 18.59 496 22 THR A 66 ? ? -111.38 -161.61 497 22 SER A 69 ? ? 168.11 174.05 498 22 PRO A 76 ? ? -85.37 -155.87 499 22 HIS A 78 ? ? 168.43 -168.87 500 22 ASN A 83 ? ? -154.30 19.42 501 22 SER A 85 ? ? 63.94 90.82 502 22 ALA A 86 ? ? 137.38 112.85 503 23 ASP A 4 ? ? 168.01 88.64 504 23 GLU A 7 ? ? 71.73 -56.01 505 23 ARG A 17 ? ? 173.24 -45.66 506 23 PRO A 24 ? ? -50.83 109.25 507 23 ASP A 26 ? ? 172.65 -163.62 508 23 LYS A 30 ? ? -109.55 64.22 509 23 ASP A 32 ? ? -37.69 -90.72 510 23 GLU A 33 ? ? -140.03 -37.31 511 23 MET A 40 ? ? 158.80 -31.00 512 23 MET A 42 ? ? 159.13 -56.96 513 23 LYS A 43 ? ? -160.68 21.95 514 23 ASP A 47 ? ? -1.21 105.90 515 23 ASN A 65 ? ? -48.64 108.26 516 23 THR A 66 ? ? -105.87 -161.51 517 23 SER A 69 ? ? 156.52 -171.90 518 23 PRO A 76 ? ? -41.70 171.69 519 23 HIS A 78 ? ? -153.83 -159.91 520 23 SER A 85 ? ? 82.34 100.81 521 23 ALA A 86 ? ? 129.33 133.99 522 24 ASP A 4 ? ? 179.17 96.63 523 24 GLU A 7 ? ? 69.69 -53.32 524 24 ARG A 17 ? ? 153.65 -39.24 525 24 ASP A 26 ? ? 172.01 -172.56 526 24 LYS A 30 ? ? -110.83 69.73 527 24 CYS A 31 ? ? -33.00 144.54 528 24 ASP A 32 ? ? -51.59 -71.60 529 24 GLU A 33 ? ? -153.51 -62.26 530 24 MET A 40 ? ? 155.75 -30.22 531 24 MET A 42 ? ? 171.37 -40.64 532 24 LYS A 43 ? ? 156.96 87.36 533 24 CYS A 45 ? ? -36.20 103.10 534 24 ASP A 47 ? ? -18.29 101.94 535 24 ILE A 48 ? ? -49.67 -173.71 536 24 ASP A 49 ? ? -101.05 72.45 537 24 CYS A 58 ? ? 49.28 23.95 538 24 SER A 69 ? ? 158.40 177.76 539 24 PRO A 76 ? ? -36.61 -29.46 540 24 HIS A 78 ? ? -88.45 -127.50 541 24 ASN A 83 ? ? -148.75 26.25 542 24 SER A 85 ? ? 73.60 90.37 543 24 ALA A 86 ? ? 156.20 100.70 544 25 ASP A 4 ? ? 178.08 71.32 545 25 ASP A 6 ? ? -62.39 74.35 546 25 ARG A 17 ? ? 177.35 -31.72 547 25 ASP A 26 ? ? 171.58 -174.09 548 25 CYS A 31 ? ? -48.68 -174.72 549 25 ASP A 32 ? ? -104.33 -144.26 550 25 GLU A 33 ? ? -29.61 -95.48 551 25 MET A 40 ? ? 158.98 -23.73 552 25 MET A 42 ? ? 100.51 -13.88 553 25 LYS A 43 ? ? 168.35 100.24 554 25 ASN A 44 ? ? -166.72 34.50 555 25 CYS A 45 ? ? 34.66 98.30 556 25 ASP A 47 ? ? -6.24 123.56 557 25 ILE A 48 ? ? -66.84 -173.68 558 25 LEU A 56 ? ? -144.01 11.02 559 25 ARG A 59 ? ? -39.52 -29.01 560 25 HIS A 64 ? ? -88.98 48.84 561 25 SER A 69 ? ? 171.78 156.85 562 25 PRO A 76 ? ? -40.92 173.83 563 25 HIS A 78 ? ? -101.08 -125.92 564 25 GLN A 79 ? ? -151.05 65.85 565 25 SER A 85 ? ? 66.35 89.12 566 25 ALA A 86 ? ? 155.18 93.48 # _pdbx_nmr_ensemble.entry_id 1LMJ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1LMJ _pdbx_nmr_representative.conformer_id 6 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '20 mM CaCl2, 4.55 mM Tris, 3 mM protein' '90% H2O/10% D2O' 2 '20 mM CaCl2, 4.55 mM Tris, 3.6 mM protein' '99.9% D2O' 3 '20 mM CaCl2, 4.55 mM Tris, 3.8 mM 15N-protein' '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 306 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20 mM CaCl2, 4.55 mM Tris' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 2 1 '2D NOESY' 2 3 1 3D_15N-separated_NOESY 3 3 1 HMQC-J 4 3 1 'HSQC (slow HN)' # _pdbx_nmr_refine.entry_id 1LMJ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;1892 distance constraints including 411 ambiguous constraints, 26 torsion angle phi restraints, 24 restraints for 12 hydrogen bonds RMSD from experimental restraints All 0.013+/-0.001 (1932) Intraresidue 0.009+/-0.002 (504) Sequential 0.011+/-0.002 (388) Short-range (i-j<=4) (211) 0.015+/-0.003 Long-range 0.013+/-0.002 (378) Ambiguous 0.015+/-0.002 (411) H-bonds 0.014+/-0.004 (24) Calcium 0.012+/-0.005 (16) RMSD Phi rest. 0.177+/-0.093 (26) ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.81 'structure solution' Brunger 1 X-PLOR 3.81 refinement Brunger 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 ILE N N N N 159 ILE CA C N S 160 ILE C C N N 161 ILE O O N N 162 ILE CB C N S 163 ILE CG1 C N N 164 ILE CG2 C N N 165 ILE CD1 C N N 166 ILE OXT O N N 167 ILE H H N N 168 ILE H2 H N N 169 ILE HA H N N 170 ILE HB H N N 171 ILE HG12 H N N 172 ILE HG13 H N N 173 ILE HG21 H N N 174 ILE HG22 H N N 175 ILE HG23 H N N 176 ILE HD11 H N N 177 ILE HD12 H N N 178 ILE HD13 H N N 179 ILE HXT H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TYR N N N N 319 TYR CA C N S 320 TYR C C N N 321 TYR O O N N 322 TYR CB C N N 323 TYR CG C Y N 324 TYR CD1 C Y N 325 TYR CD2 C Y N 326 TYR CE1 C Y N 327 TYR CE2 C Y N 328 TYR CZ C Y N 329 TYR OH O N N 330 TYR OXT O N N 331 TYR H H N N 332 TYR H2 H N N 333 TYR HA H N N 334 TYR HB2 H N N 335 TYR HB3 H N N 336 TYR HD1 H N N 337 TYR HD2 H N N 338 TYR HE1 H N N 339 TYR HE2 H N N 340 TYR HH H N N 341 TYR HXT H N N 342 VAL N N N N 343 VAL CA C N S 344 VAL C C N N 345 VAL O O N N 346 VAL CB C N N 347 VAL CG1 C N N 348 VAL CG2 C N N 349 VAL OXT O N N 350 VAL H H N N 351 VAL H2 H N N 352 VAL HA H N N 353 VAL HB H N N 354 VAL HG11 H N N 355 VAL HG12 H N N 356 VAL HG13 H N N 357 VAL HG21 H N N 358 VAL HG22 H N N 359 VAL HG23 H N N 360 VAL HXT H N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? GE OMEGA 500 2 ? GE OMEGA 600 3 ? GE OMEGA 750 # _atom_sites.entry_id 1LMJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ #