data_1LMO # _entry.id 1LMO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.374 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1LMO pdb_00001lmo 10.2210/pdb1lmo/pdb WWPDB D_1000174763 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LMO _pdbx_database_status.recvd_initial_deposition_date 1994-10-25 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Karlsen, S.' 1 'Hough, E.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Crystal structures of three complexes between chito-oligosaccharides and lysozyme from the rainbow trout. How distorted is the NAG sugar in site D? ; 'Acta Crystallogr.,Sect.D' 51 962 978 1995 ABCRE6 DK 0907-4449 0766 ? 15299765 10.1107/S0907444995005105 1 'The Refined Crystal Structure of Lysozyme from Rainbow Trout (Oncorhynchus Mykiss)' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 2 'Purification and Characterization of Two Lysozymes from Rainbow Trout (Salmo Gairdneri)' Eur.J.Biochem. 173 269 ? 1988 EJBCAI IX 0014-2956 0262 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Karlsen, S.' 1 ? primary 'Hough, E.' 2 ? 1 'Karlsen, S.' 3 ? 1 'Eliassen, B.E.' 4 ? 1 'Hansen, L.Kr.' 5 ? 1 'Larsen, R.L.' 6 ? 1 'Riise, B.W.' 7 ? 1 'Smalaas, A.O.' 8 ? 1 'Hough, E.' 9 ? 1 'Grinde, B.' 10 ? 2 'Grinde, B.' 11 ? 2 'Jolles, J.' 12 ? 2 'Jolles, P.' 13 ? # _cell.entry_id 1LMO _cell.length_a 76.460 _cell.length_b 76.460 _cell.length_c 54.220 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1LMO _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat LYSOZYME 14303.068 1 3.2.1.17 ? ? ? 2 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 1 ? ? ? ? 3 water nat water 18.015 113 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MUCOPEPTIDE N-ACETYLMURAMYLHYDROLASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KVYDRCELARALKASGMDGYAGNSLPNWVCLSKWESSYNTQATNRNTDGSTDYGIFQINSRYWCDDGRTPGAKNVCGIRC SQLLTDDLTVAIRCAKRVVLDPNGIGAWVAWRLHCQNQDLRSYVAGCGV ; _entity_poly.pdbx_seq_one_letter_code_can ;KVYDRCELARALKASGMDGYAGNSLPNWVCLSKWESSYNTQATNRNTDGSTDYGIFQINSRYWCDDGRTPGAKNVCGIRC SQLLTDDLTVAIRCAKRVVLDPNGIGAWVAWRLHCQNQDLRSYVAGCGV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 VAL n 1 3 TYR n 1 4 ASP n 1 5 ARG n 1 6 CYS n 1 7 GLU n 1 8 LEU n 1 9 ALA n 1 10 ARG n 1 11 ALA n 1 12 LEU n 1 13 LYS n 1 14 ALA n 1 15 SER n 1 16 GLY n 1 17 MET n 1 18 ASP n 1 19 GLY n 1 20 TYR n 1 21 ALA n 1 22 GLY n 1 23 ASN n 1 24 SER n 1 25 LEU n 1 26 PRO n 1 27 ASN n 1 28 TRP n 1 29 VAL n 1 30 CYS n 1 31 LEU n 1 32 SER n 1 33 LYS n 1 34 TRP n 1 35 GLU n 1 36 SER n 1 37 SER n 1 38 TYR n 1 39 ASN n 1 40 THR n 1 41 GLN n 1 42 ALA n 1 43 THR n 1 44 ASN n 1 45 ARG n 1 46 ASN n 1 47 THR n 1 48 ASP n 1 49 GLY n 1 50 SER n 1 51 THR n 1 52 ASP n 1 53 TYR n 1 54 GLY n 1 55 ILE n 1 56 PHE n 1 57 GLN n 1 58 ILE n 1 59 ASN n 1 60 SER n 1 61 ARG n 1 62 TYR n 1 63 TRP n 1 64 CYS n 1 65 ASP n 1 66 ASP n 1 67 GLY n 1 68 ARG n 1 69 THR n 1 70 PRO n 1 71 GLY n 1 72 ALA n 1 73 LYS n 1 74 ASN n 1 75 VAL n 1 76 CYS n 1 77 GLY n 1 78 ILE n 1 79 ARG n 1 80 CYS n 1 81 SER n 1 82 GLN n 1 83 LEU n 1 84 LEU n 1 85 THR n 1 86 ASP n 1 87 ASP n 1 88 LEU n 1 89 THR n 1 90 VAL n 1 91 ALA n 1 92 ILE n 1 93 ARG n 1 94 CYS n 1 95 ALA n 1 96 LYS n 1 97 ARG n 1 98 VAL n 1 99 VAL n 1 100 LEU n 1 101 ASP n 1 102 PRO n 1 103 ASN n 1 104 GLY n 1 105 ILE n 1 106 GLY n 1 107 ALA n 1 108 TRP n 1 109 VAL n 1 110 ALA n 1 111 TRP n 1 112 ARG n 1 113 LEU n 1 114 HIS n 1 115 CYS n 1 116 GLN n 1 117 ASN n 1 118 GLN n 1 119 ASP n 1 120 LEU n 1 121 ARG n 1 122 SER n 1 123 TYR n 1 124 VAL n 1 125 ALA n 1 126 GLY n 1 127 CYS n 1 128 GLY n 1 129 VAL n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'rainbow trout' _entity_src_nat.pdbx_organism_scientific 'Oncorhynchus mykiss' _entity_src_nat.pdbx_ncbi_taxonomy_id 8022 _entity_src_nat.genus Oncorhynchus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ KIDNEY _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LYC2_ONCMY _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P11941 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MRAVVVLLLVAVASAKVYDRCELARALKASGMDGYAGNSLPNWVCLSKWESSYNTQATNRNTDGSTDYGIFQINSRYWCD DGRTPGAKNVCGIRCSQLLTADLTVAIRCAKRVVLDPNGIGAWVAWRLHCQNQDLRSYVAGCGV ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1LMO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 129 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P11941 _struct_ref_seq.db_align_beg 16 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 144 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 129 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1LMO _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 86 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P11941 _struct_ref_seq_dif.db_mon_id ALA _struct_ref_seq_dif.pdbx_seq_db_seq_num 101 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 86 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1LMO _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.20 _exptl_crystal.density_percent_sol 61.54 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector DIFFRACTOMETER _diffrn_detector.type 'ENRAF-NONIUS FAST' _diffrn_detector.pdbx_collection_date 1993-10 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source ? _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 1LMO _reflns.observed_criterion_sigma_I 3. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high ? _reflns.number_obs 15737 _reflns.number_all ? _reflns.percent_possible_obs 91.3 _reflns.pdbx_Rmerge_I_obs 0.033 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 1LMO _refine.ls_number_reflns_obs 15737 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 3.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.0 _refine.ls_d_res_high 1.8 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.166 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 999 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.number_atoms_solvent 113 _refine_hist.number_atoms_total 1141 _refine_hist.d_res_high 1.8 _refine_hist.d_res_low 8.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.013 0.020 ? ? 'X-RAY DIFFRACTION' ? p_angle_d 0.045 0.040 ? ? 'X-RAY DIFFRACTION' ? p_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_d 0.074 0.050 ? ? 'X-RAY DIFFRACTION' ? p_hb_or_metal_coord ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_plane_restr 0.013 0.020 ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr 0.039 0.060 ? ? 'X-RAY DIFFRACTION' ? p_singtor_nbd 0.181 0.030 ? ? 'X-RAY DIFFRACTION' ? p_multtor_nbd 0.189 0.300 ? ? 'X-RAY DIFFRACTION' ? p_xhyhbond_nbd 0.232 0.300 ? ? 'X-RAY DIFFRACTION' ? p_xyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_tor 4.5 3.0 ? ? 'X-RAY DIFFRACTION' ? p_staggered_tor 16.6 15.0 ? ? 'X-RAY DIFFRACTION' ? p_orthonormal_tor 16.8 20.0 ? ? 'X-RAY DIFFRACTION' ? p_transverse_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_special_tor ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1LMO _struct.title 'THE CRYSTAL STRUCTURES OF THREE COMPLEXES BETWEEN CHITOOLIGOSACCHARIDES AND LYSOZYME FROM THE RAINBOW TROUT' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1LMO _struct_keywords.pdbx_keywords 'HYDROLASE (O-GLYCOSYL)' _struct_keywords.text 'HYDROLASE (O-GLYCOSYL)' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 5 ? ALA A 14 ? ARG A 5 ALA A 14 1 ? 10 HELX_P HELX_P2 2 TYR A 20 ? GLY A 22 ? TYR A 20 GLY A 22 5 ? 3 HELX_P HELX_P3 3 LEU A 25 ? SER A 36 ? LEU A 25 SER A 36 1 ? 12 HELX_P HELX_P4 4 CYS A 80 ? LEU A 83 ? CYS A 80 LEU A 83 5 ? 4 HELX_P HELX_P5 5 THR A 89 ? LEU A 100 ? THR A 89 LEU A 100 1 ? 12 HELX_P HELX_P6 6 GLY A 104 ? ALA A 107 ? GLY A 104 ALA A 107 5 ? 4 HELX_P HELX_P7 7 VAL A 109 ? HIS A 114 ? VAL A 109 HIS A 114 1 ? 6 HELX_P HELX_P8 8 ARG A 121 ? TYR A 123 ? ARG A 121 TYR A 123 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 127 SG ? ? A CYS 6 A CYS 127 1_555 ? ? ? ? ? ? ? 2.002 ? ? disulf2 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 115 SG ? ? A CYS 30 A CYS 115 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf3 disulf ? ? A CYS 64 SG ? ? ? 1_555 A CYS 80 SG ? ? A CYS 64 A CYS 80 1_555 ? ? ? ? ? ? ? 2.038 ? ? disulf4 disulf ? ? A CYS 76 SG ? ? ? 1_555 A CYS 94 SG ? ? A CYS 76 A CYS 94 1_555 ? ? ? ? ? ? ? 2.026 ? ? covale1 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.390 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 43 ? ARG A 45 ? THR A 43 ARG A 45 A 2 THR A 51 ? TYR A 53 ? THR A 51 TYR A 53 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id ASN _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 44 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id ASN _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 44 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id ASP _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 52 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id ASP _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 52 # _database_PDB_matrix.entry_id 1LMO _database_PDB_matrix.origx[1][1] 0.866025 _database_PDB_matrix.origx[1][2] 0.500000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx[2][1] -0.500000 _database_PDB_matrix.origx[2][2] 0.866025 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _atom_sites.entry_id 1LMO _atom_sites.fract_transf_matrix[1][1] 0.013079 _atom_sites.fract_transf_matrix[1][2] 0.007551 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015102 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018443 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _database_PDB_caveat.text 'NAG B 2 HAS WRONG CHIRALITY AT ATOM C2' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 TRP 63 63 63 TRP TRP A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 CYS 94 94 94 CYS CYS A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 TRP 108 108 108 TRP TRP A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 TRP 111 111 111 TRP TRP A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 CYS 115 115 115 CYS CYS A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 CYS 127 127 127 CYS CYS A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 VAL 129 129 129 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 134 134 HOH HOH A . C 3 HOH 2 135 135 HOH HOH A . C 3 HOH 3 136 136 HOH HOH A . C 3 HOH 4 137 137 HOH HOH A . C 3 HOH 5 138 138 HOH HOH A . C 3 HOH 6 139 139 HOH HOH A . C 3 HOH 7 140 140 HOH HOH A . C 3 HOH 8 141 141 HOH HOH A . C 3 HOH 9 142 142 HOH HOH A . C 3 HOH 10 143 143 HOH HOH A . C 3 HOH 11 144 144 HOH HOH A . C 3 HOH 12 145 145 HOH HOH A . C 3 HOH 13 146 146 HOH HOH A . C 3 HOH 14 147 147 HOH HOH A . C 3 HOH 15 148 148 HOH HOH A . C 3 HOH 16 149 149 HOH HOH A . C 3 HOH 17 150 150 HOH HOH A . C 3 HOH 18 151 151 HOH HOH A . C 3 HOH 19 152 152 HOH HOH A . C 3 HOH 20 153 153 HOH HOH A . C 3 HOH 21 154 154 HOH HOH A . C 3 HOH 22 155 155 HOH HOH A . C 3 HOH 23 156 156 HOH HOH A . C 3 HOH 24 157 157 HOH HOH A . C 3 HOH 25 158 158 HOH HOH A . C 3 HOH 26 159 159 HOH HOH A . C 3 HOH 27 160 160 HOH HOH A . C 3 HOH 28 161 161 HOH HOH A . C 3 HOH 29 162 162 HOH HOH A . C 3 HOH 30 163 163 HOH HOH A . C 3 HOH 31 164 164 HOH HOH A . C 3 HOH 32 165 165 HOH HOH A . C 3 HOH 33 166 166 HOH HOH A . C 3 HOH 34 167 167 HOH HOH A . C 3 HOH 35 168 168 HOH HOH A . C 3 HOH 36 169 169 HOH HOH A . C 3 HOH 37 170 170 HOH HOH A . C 3 HOH 38 171 171 HOH HOH A . C 3 HOH 39 172 172 HOH HOH A . C 3 HOH 40 173 173 HOH HOH A . C 3 HOH 41 174 174 HOH HOH A . C 3 HOH 42 175 175 HOH HOH A . C 3 HOH 43 176 176 HOH HOH A . C 3 HOH 44 177 177 HOH HOH A . C 3 HOH 45 178 178 HOH HOH A . C 3 HOH 46 179 179 HOH HOH A . C 3 HOH 47 180 180 HOH HOH A . C 3 HOH 48 181 181 HOH HOH A . C 3 HOH 49 182 182 HOH HOH A . C 3 HOH 50 183 183 HOH HOH A . C 3 HOH 51 184 184 HOH HOH A . C 3 HOH 52 185 185 HOH HOH A . C 3 HOH 53 186 186 HOH HOH A . C 3 HOH 54 187 187 HOH HOH A . C 3 HOH 55 188 188 HOH HOH A . C 3 HOH 56 189 189 HOH HOH A . C 3 HOH 57 190 190 HOH HOH A . C 3 HOH 58 191 191 HOH HOH A . C 3 HOH 59 192 192 HOH HOH A . C 3 HOH 60 193 193 HOH HOH A . C 3 HOH 61 194 194 HOH HOH A . C 3 HOH 62 195 195 HOH HOH A . C 3 HOH 63 196 196 HOH HOH A . C 3 HOH 64 197 197 HOH HOH A . C 3 HOH 65 198 198 HOH HOH A . C 3 HOH 66 199 199 HOH HOH A . C 3 HOH 67 200 200 HOH HOH A . C 3 HOH 68 201 201 HOH HOH A . C 3 HOH 69 202 202 HOH HOH A . C 3 HOH 70 203 203 HOH HOH A . C 3 HOH 71 204 204 HOH HOH A . C 3 HOH 72 205 205 HOH HOH A . C 3 HOH 73 206 206 HOH HOH A . C 3 HOH 74 207 207 HOH HOH A . C 3 HOH 75 208 208 HOH HOH A . C 3 HOH 76 209 209 HOH HOH A . C 3 HOH 77 210 210 HOH HOH A . C 3 HOH 78 211 211 HOH HOH A . C 3 HOH 79 212 212 HOH HOH A . C 3 HOH 80 213 213 HOH HOH A . C 3 HOH 81 214 214 HOH HOH A . C 3 HOH 82 215 215 HOH HOH A . C 3 HOH 83 216 216 HOH HOH A . C 3 HOH 84 217 217 HOH HOH A . C 3 HOH 85 218 218 HOH HOH A . C 3 HOH 86 219 219 HOH HOH A . C 3 HOH 87 220 220 HOH HOH A . C 3 HOH 88 221 221 HOH HOH A . C 3 HOH 89 222 222 HOH HOH A . C 3 HOH 90 223 223 HOH HOH A . C 3 HOH 91 224 224 HOH HOH A . C 3 HOH 92 225 225 HOH HOH A . C 3 HOH 93 226 226 HOH HOH A . C 3 HOH 94 227 227 HOH HOH A . C 3 HOH 95 228 228 HOH HOH A . C 3 HOH 96 229 229 HOH HOH A . C 3 HOH 97 230 230 HOH HOH A . C 3 HOH 98 231 231 HOH HOH A . C 3 HOH 99 232 232 HOH HOH A . C 3 HOH 100 233 233 HOH HOH A . C 3 HOH 101 234 234 HOH HOH A . C 3 HOH 102 235 235 HOH HOH A . C 3 HOH 103 236 236 HOH HOH A . C 3 HOH 104 237 237 HOH HOH A . C 3 HOH 105 238 238 HOH HOH A . C 3 HOH 106 239 239 HOH HOH A . C 3 HOH 107 240 240 HOH HOH A . C 3 HOH 108 241 241 HOH HOH A . C 3 HOH 109 242 242 HOH HOH A . C 3 HOH 110 243 243 HOH HOH A . C 3 HOH 111 244 244 HOH HOH A . C 3 HOH 112 245 245 HOH HOH A . C 3 HOH 113 246 246 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-01-01 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-04-18 5 'Structure model' 2 0 2020-07-29 6 'Structure model' 3 0 2023-07-26 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? 3 6 'Structure model' repository Remediation ? 'Coordinates and associated ncs operations (if present) transformed into standard crystal frame' # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' Other 6 5 'Structure model' Advisory 7 5 'Structure model' 'Atomic model' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Derived calculations' 11 5 'Structure model' 'Structure summary' 12 6 'Structure model' Advisory 13 6 'Structure model' 'Atomic model' 14 6 'Structure model' 'Data collection' 15 6 'Structure model' 'Database references' 16 6 'Structure model' 'Derived calculations' 17 6 'Structure model' Other 18 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn_detector 2 4 'Structure model' pdbx_database_status 3 5 'Structure model' atom_site 4 5 'Structure model' chem_comp 5 5 'Structure model' database_PDB_caveat 6 5 'Structure model' entity 7 5 'Structure model' pdbx_branch_scheme 8 5 'Structure model' pdbx_chem_comp_identifier 9 5 'Structure model' pdbx_entity_branch 10 5 'Structure model' pdbx_entity_branch_descriptor 11 5 'Structure model' pdbx_entity_branch_link 12 5 'Structure model' pdbx_entity_branch_list 13 5 'Structure model' pdbx_entity_nonpoly 14 5 'Structure model' pdbx_nonpoly_scheme 15 5 'Structure model' pdbx_struct_assembly_gen 16 5 'Structure model' pdbx_validate_chiral 17 5 'Structure model' pdbx_validate_close_contact 18 5 'Structure model' struct_asym 19 5 'Structure model' struct_conn 20 5 'Structure model' struct_ref_seq_dif 21 5 'Structure model' struct_site 22 5 'Structure model' struct_site_gen 23 6 'Structure model' atom_site 24 6 'Structure model' atom_sites 25 6 'Structure model' chem_comp 26 6 'Structure model' database_2 27 6 'Structure model' database_PDB_matrix 28 6 'Structure model' pdbx_database_remark 29 6 'Structure model' pdbx_validate_planes 30 6 'Structure model' pdbx_validate_rmsd_angle 31 6 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_diffrn_detector.detector' 2 4 'Structure model' '_pdbx_database_status.process_site' 3 5 'Structure model' '_atom_site.B_iso_or_equiv' 4 5 'Structure model' '_atom_site.Cartn_x' 5 5 'Structure model' '_atom_site.Cartn_y' 6 5 'Structure model' '_atom_site.Cartn_z' 7 5 'Structure model' '_atom_site.auth_asym_id' 8 5 'Structure model' '_atom_site.auth_atom_id' 9 5 'Structure model' '_atom_site.auth_seq_id' 10 5 'Structure model' '_atom_site.label_asym_id' 11 5 'Structure model' '_atom_site.label_atom_id' 12 5 'Structure model' '_atom_site.type_symbol' 13 5 'Structure model' '_chem_comp.name' 14 5 'Structure model' '_chem_comp.type' 15 5 'Structure model' '_entity.formula_weight' 16 5 'Structure model' '_entity.pdbx_description' 17 5 'Structure model' '_entity.pdbx_number_of_molecules' 18 5 'Structure model' '_entity.type' 19 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 20 5 'Structure model' '_pdbx_validate_chiral.auth_asym_id' 21 5 'Structure model' '_pdbx_validate_chiral.auth_seq_id' 22 5 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_1' 23 5 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_2' 24 5 'Structure model' '_pdbx_validate_close_contact.auth_atom_id_1' 25 5 'Structure model' '_pdbx_validate_close_contact.auth_atom_id_2' 26 5 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1' 27 5 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2' 28 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 29 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 30 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 31 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 32 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 33 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 34 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 35 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 36 5 'Structure model' '_struct_ref_seq_dif.details' 37 6 'Structure model' '_atom_site.Cartn_x' 38 6 'Structure model' '_atom_site.Cartn_y' 39 6 'Structure model' '_atom_sites.fract_transf_matrix[1][1]' 40 6 'Structure model' '_atom_sites.fract_transf_matrix[1][2]' 41 6 'Structure model' '_atom_sites.fract_transf_matrix[2][1]' 42 6 'Structure model' '_atom_sites.fract_transf_matrix[2][2]' 43 6 'Structure model' '_chem_comp.pdbx_synonyms' 44 6 'Structure model' '_database_2.pdbx_DOI' 45 6 'Structure model' '_database_2.pdbx_database_accession' 46 6 'Structure model' '_database_PDB_matrix.origx[1][1]' 47 6 'Structure model' '_database_PDB_matrix.origx[1][2]' 48 6 'Structure model' '_database_PDB_matrix.origx[2][1]' 49 6 'Structure model' '_database_PDB_matrix.origx[2][2]' 50 6 'Structure model' '_pdbx_validate_planes.rmsd' 51 6 'Structure model' '_pdbx_validate_rmsd_angle.angle_deviation' 52 6 'Structure model' '_pdbx_validate_rmsd_angle.angle_value' 53 6 'Structure model' '_struct_conn.pdbx_dist_value' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MADNES 'data collection' . ? 1 PROLSQ refinement . ? 2 MADNES 'data reduction' . ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 236 ? ? O A HOH 237 ? ? 2.11 2 1 O4 B NAG 1 ? ? O5 B NAG 2 ? ? 2.11 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 170 ? ? 1_555 O A HOH 170 ? ? 4_556 1.18 2 1 O A HOH 144 ? ? 1_555 O A HOH 144 ? ? 4_556 1.60 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 4 ? ? CG A ASP 4 ? ? OD1 A ASP 4 ? ? 111.22 118.30 -7.08 0.90 N 2 1 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.66 120.30 3.36 0.50 N 3 1 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH2 A ARG 5 ? ? 116.69 120.30 -3.61 0.50 N 4 1 CB A ASP 18 ? ? CG A ASP 18 ? ? OD1 A ASP 18 ? ? 124.66 118.30 6.36 0.90 N 5 1 CB A ASP 48 ? ? CG A ASP 48 ? ? OD1 A ASP 48 ? ? 124.42 118.30 6.12 0.90 N 6 1 CB A ASP 48 ? ? CG A ASP 48 ? ? OD2 A ASP 48 ? ? 112.29 118.30 -6.01 0.90 N 7 1 CB A ASP 52 ? ? CG A ASP 52 ? ? OD1 A ASP 52 ? ? 125.17 118.30 6.87 0.90 N 8 1 NE A ARG 61 ? ? CZ A ARG 61 ? ? NH1 A ARG 61 ? ? 125.11 120.30 4.81 0.50 N 9 1 NE A ARG 61 ? ? CZ A ARG 61 ? ? NH2 A ARG 61 ? ? 115.38 120.30 -4.92 0.50 N 10 1 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH1 A ARG 79 ? ? 123.64 120.30 3.34 0.50 N 11 1 NE A ARG 93 ? ? CZ A ARG 93 ? ? NH1 A ARG 93 ? ? 125.14 120.30 4.84 0.50 N 12 1 NE A ARG 93 ? ? CZ A ARG 93 ? ? NH2 A ARG 93 ? ? 114.51 120.30 -5.79 0.50 N 13 1 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH1 A ARG 97 ? ? 128.63 120.30 8.33 0.50 N 14 1 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH2 A ARG 97 ? ? 115.11 120.30 -5.19 0.50 N 15 1 CG1 A VAL 99 ? ? CB A VAL 99 ? ? CG2 A VAL 99 ? ? 122.60 110.90 11.70 1.60 N 16 1 CB A ASP 119 ? ? CG A ASP 119 ? ? OD2 A ASP 119 ? ? 111.68 118.30 -6.62 0.90 N 17 1 NE A ARG 121 ? ? CZ A ARG 121 ? ? NH1 A ARG 121 ? ? 125.56 120.30 5.26 0.50 N 18 1 NE A ARG 121 ? ? CZ A ARG 121 ? ? NH2 A ARG 121 ? ? 117.03 120.30 -3.27 0.50 N # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 61 ? ? 0.100 'SIDE CHAIN' 2 1 ARG A 79 ? ? 0.110 'SIDE CHAIN' 3 1 ARG A 93 ? ? 0.142 'SIDE CHAIN' # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id C2 _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id B _pdbx_validate_chiral.auth_comp_id NAG _pdbx_validate_chiral.auth_seq_id 2 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details PLANAR _pdbx_validate_chiral.omega . # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 ? NAG 131 n B 2 NAG 2 B NAG 2 ? NAG 130 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpNAcb1-4DGlcpNAcb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 NAG _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 NAG _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #