data_1LMR # _entry.id 1LMR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1LMR pdb_00001lmr 10.2210/pdb1lmr/pdb RCSB RCSB016088 ? ? WWPDB D_1000016088 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LMR _pdbx_database_status.recvd_initial_deposition_date 2002-05-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bernard, C.' 1 'Corzo, G.' 2 'Adachi-Akahane, S.' 3 'Foures, G.' 4 'Kanemaru, K.' 5 'Furukawa, Y.' 6 'Nakajima, T.' 7 'Darbon, H.' 8 # _citation.id primary _citation.title 'Solution structure of ADO1, a toxin extracted from the saliva of the assassin bug, Agriosphodrus dohrni' _citation.journal_abbrev 'Proteins: STRUCT.,FUNCT.,GENET.' _citation.journal_volume 54 _citation.page_first 195 _citation.page_last 205 _citation.year 2004 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14696181 _citation.pdbx_database_id_DOI 10.1002/prot.10513 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bernard, C.' 1 ? primary 'Corzo, G.' 2 ? primary 'Adachi-Akahane, S.' 3 ? primary 'Foures, G.' 4 ? primary 'Kanemaru, K.' 5 ? primary 'Furukawa, Y.' 6 ? primary 'Nakajima, T.' 7 ? primary 'Darbon, H.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'TOXIN ADO1' _entity.formula_weight 3792.394 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ADDDCLPRGSKCLGENKQCCKGTTCMFYANRCVGV _entity_poly.pdbx_seq_one_letter_code_can ADDDCLPRGSKCLGENKQCCKGTTCMFYANRCVGV _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 ASP n 1 4 ASP n 1 5 CYS n 1 6 LEU n 1 7 PRO n 1 8 ARG n 1 9 GLY n 1 10 SER n 1 11 LYS n 1 12 CYS n 1 13 LEU n 1 14 GLY n 1 15 GLU n 1 16 ASN n 1 17 LYS n 1 18 GLN n 1 19 CYS n 1 20 CYS n 1 21 LYS n 1 22 GLY n 1 23 THR n 1 24 THR n 1 25 CYS n 1 26 MET n 1 27 PHE n 1 28 TYR n 1 29 ALA n 1 30 ASN n 1 31 ARG n 1 32 CYS n 1 33 VAL n 1 34 GLY n 1 35 VAL n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Agriosphodrus dohrni' _entity_src_nat.pdbx_ncbi_taxonomy_id 184613 _entity_src_nat.genus Agriosphodrus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ADO1_AGRDO _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ADDDCLPRGSKCLGENKQCCKGTTCMFYANRCVGV _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P58608 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1LMR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P58608 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 35 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 35 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 DQF-COSY 2 1 1 '2D TOCSY' 3 1 1 '2D NOESY' 4 1 2 DQF-COSY 5 1 2 '2D TOCSY' 6 1 2 '2D NOESY' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.temperature_units 1 290 ambient ? 3.2 ? K 2 300 ambient ? 3.2 ? K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2 mm' _pdbx_nmr_sample_details.solvent_system ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1LMR _pdbx_nmr_refine.method 'distance geometry, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1LMR _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 21 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1LMR _pdbx_nmr_representative.conformer_id 21 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal CNS 1.0 refinement 'A.T. BRUNGER ET AL.' 1 XwinNMR 2.6 collection ? 2 XwinNMR 2.6 processing ? 3 XEASY 1.3 'data analysis' Bartels 4 DIANA 2.8 'structure solution' Gnthert 5 # _exptl.entry_id 1LMR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1LMR _struct.title 'Solution of ADO1, a Toxin from the Assassin Bugs Agriosphodrus dohrni that Blocks the Voltage Sensitive Calcium Channel L-type' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1LMR _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'ICK, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 20 SG ? ? A CYS 5 A CYS 20 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 12 A CYS 25 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf3 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 19 A CYS 32 1_555 ? ? ? ? ? ? ? 2.031 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 23 ? MET A 26 ? THR A 23 MET A 26 A 2 ARG A 31 ? GLY A 34 ? ARG A 31 GLY A 34 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 24 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 24 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 33 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 33 # _database_PDB_matrix.entry_id 1LMR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1LMR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 VAL 35 35 35 VAL VAL A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-08-19 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 4 ? ? -67.97 -154.84 2 1 ARG A 8 ? ? -68.95 77.39 3 1 CYS A 12 ? ? -173.09 53.02 4 1 LEU A 13 ? ? -68.68 -70.40 5 1 CYS A 19 ? ? -69.95 -177.07 6 1 ARG A 31 ? ? -174.46 129.04 7 2 ASP A 2 ? ? -60.44 -176.89 8 2 ASP A 4 ? ? -60.79 -79.52 9 2 CYS A 5 ? ? -60.38 -174.45 10 2 ARG A 8 ? ? -68.64 72.53 11 2 LEU A 13 ? ? -69.90 -78.72 12 2 CYS A 19 ? ? -69.89 -176.71 13 3 ASP A 4 ? ? -68.04 -154.90 14 3 CYS A 5 ? ? 56.93 -162.83 15 3 ARG A 8 ? ? -68.10 75.57 16 3 CYS A 12 ? ? -177.72 54.02 17 3 LEU A 13 ? ? -69.54 -72.04 18 3 CYS A 19 ? ? -69.92 -162.79 19 4 ASP A 3 ? ? -74.05 -168.18 20 4 ASP A 4 ? ? -67.60 -154.84 21 4 ARG A 8 ? ? -68.80 76.12 22 4 CYS A 12 ? ? -170.69 51.16 23 4 LEU A 13 ? ? -69.85 -72.53 24 4 ARG A 31 ? ? -174.61 145.83 25 5 ASP A 2 ? ? -98.87 31.67 26 5 ASP A 4 ? ? -68.02 -154.86 27 5 CYS A 5 ? ? 58.13 -161.71 28 5 ARG A 8 ? ? -68.68 72.17 29 5 CYS A 12 ? ? -142.36 25.30 30 5 LEU A 13 ? ? -77.86 -81.68 31 5 ARG A 31 ? ? -173.49 139.65 32 6 ARG A 8 ? ? -68.77 79.86 33 6 CYS A 12 ? ? -154.82 39.69 34 6 LEU A 13 ? ? -72.62 -73.77 35 6 ARG A 31 ? ? -171.79 148.73 36 7 ASP A 4 ? ? -68.00 -154.96 37 7 ARG A 8 ? ? -68.78 78.23 38 7 CYS A 12 ? ? -142.79 26.96 39 7 LEU A 13 ? ? -69.91 -82.37 40 8 ASP A 4 ? ? -60.35 -79.68 41 8 CYS A 5 ? ? 49.79 -169.04 42 8 ARG A 8 ? ? -69.82 24.55 43 8 CYS A 12 ? ? -141.51 22.80 44 8 LEU A 13 ? ? -69.74 -76.54 45 9 CYS A 5 ? ? 58.64 -169.79 46 9 ARG A 8 ? ? -68.82 76.54 47 9 CYS A 12 ? ? -144.50 37.39 48 9 LEU A 13 ? ? -69.86 -148.56 49 9 GLU A 15 ? ? -37.48 130.88 50 9 ARG A 31 ? ? -170.63 136.21 51 10 ASP A 2 ? ? -176.51 131.47 52 10 ASP A 4 ? ? -57.85 -78.39 53 10 CYS A 5 ? ? -59.64 -170.25 54 10 ARG A 8 ? ? -68.68 81.47 55 10 CYS A 12 ? ? -150.95 41.26 56 10 LEU A 13 ? ? -69.71 -74.46 57 11 ASP A 2 ? ? -98.37 35.39 58 11 ASP A 3 ? ? -148.92 35.56 59 11 ASP A 4 ? ? -68.08 -154.87 60 11 ARG A 8 ? ? -68.49 82.16 61 11 LEU A 13 ? ? -69.16 -148.98 62 11 GLU A 15 ? ? -37.96 125.20 63 11 ARG A 31 ? ? -175.30 132.35 64 12 ASP A 3 ? ? -60.35 -173.95 65 12 ARG A 8 ? ? -68.74 81.62 66 12 CYS A 12 ? ? -142.15 17.72 67 12 ARG A 31 ? ? -170.00 148.80 68 13 CYS A 5 ? ? 58.92 -169.07 69 13 ARG A 8 ? ? -68.76 77.56 70 13 CYS A 12 ? ? -156.80 33.28 71 13 LEU A 13 ? ? -69.93 -71.16 72 13 ARG A 31 ? ? -175.10 137.24 73 14 ARG A 8 ? ? -68.78 72.09 74 14 CYS A 12 ? ? -140.32 21.58 75 14 LEU A 13 ? ? -69.96 -81.35 76 14 CYS A 19 ? ? -69.96 -166.65 77 15 ASP A 2 ? ? -60.32 -177.39 78 15 ASP A 3 ? ? -69.81 -169.39 79 15 ASP A 4 ? ? -61.05 -80.52 80 15 CYS A 5 ? ? -87.81 -87.09 81 15 LEU A 6 ? ? -168.96 83.66 82 15 ARG A 8 ? ? -68.67 78.08 83 15 CYS A 12 ? ? -156.12 26.20 84 15 LEU A 13 ? ? -71.09 -71.64 85 15 ARG A 31 ? ? -176.48 148.03 86 16 ASP A 3 ? ? -65.55 79.18 87 16 CYS A 5 ? ? -58.73 -167.21 88 16 ARG A 8 ? ? -68.75 73.55 89 16 CYS A 12 ? ? -153.18 42.37 90 16 LEU A 13 ? ? -69.59 -75.20 91 16 ARG A 31 ? ? -174.58 139.81 92 17 ASP A 4 ? ? -68.04 -154.88 93 17 CYS A 5 ? ? 59.11 -169.19 94 17 ARG A 8 ? ? -68.82 76.19 95 17 CYS A 12 ? ? -161.14 46.38 96 17 LEU A 13 ? ? -69.90 -78.89 97 17 CYS A 19 ? ? -69.98 -167.25 98 17 ARG A 31 ? ? -174.99 135.46 99 18 ASP A 4 ? ? -58.11 -79.09 100 18 CYS A 5 ? ? 58.31 -170.28 101 18 ARG A 8 ? ? -68.69 79.12 102 18 CYS A 12 ? ? -151.83 39.37 103 18 LEU A 13 ? ? -69.86 -80.90 104 18 CYS A 19 ? ? -69.93 -179.93 105 18 ARG A 31 ? ? -179.55 124.59 106 19 CYS A 5 ? ? 58.55 -163.73 107 19 ARG A 8 ? ? -68.64 72.48 108 19 CYS A 12 ? ? -143.66 36.88 109 19 LEU A 13 ? ? -69.55 -76.48 110 20 ASP A 2 ? ? -150.75 80.22 111 20 ASP A 4 ? ? -68.02 -154.92 112 20 CYS A 5 ? ? 57.95 -163.38 113 20 ARG A 8 ? ? -68.33 78.78 114 20 CYS A 12 ? ? -162.17 46.83 115 20 LEU A 13 ? ? -69.89 -73.13 116 20 CYS A 19 ? ? -69.93 -172.03 117 21 ASP A 2 ? ? -111.68 -165.82 118 21 ASP A 3 ? ? 64.62 70.99 119 21 ASP A 4 ? ? -61.62 -76.28 120 21 CYS A 5 ? ? 65.00 -172.06 121 21 ARG A 8 ? ? -68.65 71.12 122 21 CYS A 12 ? ? -155.65 29.12 123 21 LEU A 13 ? ? -84.95 -82.87 124 21 ARG A 31 ? ? -171.39 140.74 #