data_1LRP # _entry.id 1LRP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1LRP WWPDB D_1000174806 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LRP _pdbx_database_status.recvd_initial_deposition_date 1987-12-04 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pabo, C.' 1 'Lewis, M.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Comparison of the structures of cro and lambda repressor proteins from bacteriophage lambda.' J.Mol.Biol. 169 757 769 1983 JMOBAK UK 0022-2836 0070 ? 6226802 '10.1016/S0022-2836(83)80169-7' 1 'Structure of the Operator-Binding Domain of Bacteriophage Lambda Repressor. Implications for DNA Recognition and Gene Regulation' 'Cold Spring Harbor Symp.Quant.Biol.' 47 435 ? 1983 CSHSAZ US 0091-7451 0421 ? ? ? 2 'Homology Among DNA-Binding Proteins Suggests Use of a Conserved Super-Secondary Structure' Nature 298 447 ? 1982 NATUAS UK 0028-0836 0006 ? ? ? 3 'The Operator-Binding Domain of Lambda Repressor. Structure and DNA Recognition' Nature 298 443 ? 1982 NATUAS UK 0028-0836 0006 ? ? ? 4 'The N-Terminal Arms of Lambda Repressor Wrap Around the Operator DNA' Nature 298 441 ? 1982 NATUAS UK 0028-0836 0006 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ohlendorf, D.H.' 1 primary 'Anderson, W.F.' 2 primary 'Lewis, M.' 3 primary 'Pabo, C.O.' 4 primary 'Matthews, B.W.' 5 1 'Lewis, M.' 6 1 'Jeffrey, A.' 7 1 'Wang, J.' 8 1 'Ladner, R.' 9 1 'Ptashne, M.' 10 1 'Pabo, C.O.' 11 2 'Sauer, R.T.' 12 2 'Yocum, R.R.' 13 2 'Doolittle, R.F.' 14 2 'Lewis, M.' 15 2 'Pabo, C.O.' 16 3 'Pabo, C.O.' 17 3 'Lewis, M.' 18 4 'Pabo, C.O.' 19 4 'Krovatin, W.' 20 4 'Jeffrey, A.' 21 4 'Sauer, R.T.' 22 # _cell.entry_id 1LRP _cell.length_a 65.000 _cell.length_b 65.000 _cell.length_c 149.600 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1LRP _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'LAMBDA REPRESSOR' _entity.formula_weight 10136.613 _entity.pdbx_number_of_molecules 3 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;STKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEFSPSI AREIYEMYEAVS ; _entity_poly.pdbx_seq_one_letter_code_can ;STKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEFSPSI AREIYEMYEAVS ; _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 THR n 1 3 LYS n 1 4 LYS n 1 5 LYS n 1 6 PRO n 1 7 LEU n 1 8 THR n 1 9 GLN n 1 10 GLU n 1 11 GLN n 1 12 LEU n 1 13 GLU n 1 14 ASP n 1 15 ALA n 1 16 ARG n 1 17 ARG n 1 18 LEU n 1 19 LYS n 1 20 ALA n 1 21 ILE n 1 22 TYR n 1 23 GLU n 1 24 LYS n 1 25 LYS n 1 26 LYS n 1 27 ASN n 1 28 GLU n 1 29 LEU n 1 30 GLY n 1 31 LEU n 1 32 SER n 1 33 GLN n 1 34 GLU n 1 35 SER n 1 36 VAL n 1 37 ALA n 1 38 ASP n 1 39 LYS n 1 40 MET n 1 41 GLY n 1 42 MET n 1 43 GLY n 1 44 GLN n 1 45 SER n 1 46 GLY n 1 47 VAL n 1 48 GLY n 1 49 ALA n 1 50 LEU n 1 51 PHE n 1 52 ASN n 1 53 GLY n 1 54 ILE n 1 55 ASN n 1 56 ALA n 1 57 LEU n 1 58 ASN n 1 59 ALA n 1 60 TYR n 1 61 ASN n 1 62 ALA n 1 63 ALA n 1 64 LEU n 1 65 LEU n 1 66 ALA n 1 67 LYS n 1 68 ILE n 1 69 LEU n 1 70 LYS n 1 71 VAL n 1 72 SER n 1 73 VAL n 1 74 GLU n 1 75 GLU n 1 76 PHE n 1 77 SER n 1 78 PRO n 1 79 SER n 1 80 ILE n 1 81 ALA n 1 82 ARG n 1 83 GLU n 1 84 ILE n 1 85 TYR n 1 86 GLU n 1 87 MET n 1 88 TYR n 1 89 GLU n 1 90 ALA n 1 91 VAL n 1 92 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'Lambda-like viruses' _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage lambda' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10710 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RPC1_LAMBD _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P03034 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;STKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEFSPSI AREIYEMYEAVSMQPSLRSEYEYPVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDSAFWLEVEGNSMTAPTGSKPSF PDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSVVGKVIASQWPEETFG ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1LRP A 1 ? 92 ? P03034 1 ? 92 ? 1 92 2 1 1LRP B 1 ? 92 ? P03034 1 ? 92 ? 1 92 3 1 1LRP C 1 ? 92 ? P03034 1 ? 92 ? 1 92 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1LRP _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.00 _exptl_crystal.density_percent_sol 58.99 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1LRP _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 3.20 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 267 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 267 _refine_hist.d_res_high 3.20 _refine_hist.d_res_low . # loop_ _struct_ncs_oper.id _struct_ncs_oper.code _struct_ncs_oper.details _struct_ncs_oper.matrix[1][1] _struct_ncs_oper.matrix[1][2] _struct_ncs_oper.matrix[1][3] _struct_ncs_oper.matrix[2][1] _struct_ncs_oper.matrix[2][2] _struct_ncs_oper.matrix[2][3] _struct_ncs_oper.matrix[3][1] _struct_ncs_oper.matrix[3][2] _struct_ncs_oper.matrix[3][3] _struct_ncs_oper.vector[1] _struct_ncs_oper.vector[2] _struct_ncs_oper.vector[3] 1 given ? -0.496275 -0.830170 0.254270 0.774128 -0.290628 0.562424 -0.392908 0.475870 0.786930 13.15542 28.28864 -10.70246 2 given ? -0.496343 0.774198 -0.392954 -0.830070 -0.290663 0.475974 0.254303 0.562164 0.786930 -19.57638 24.23215 -10.82593 # _struct.entry_id 1LRP _struct.title 'COMPARISON OF THE STRUCTURES OF CRO AND LAMBDA REPRESSOR PROTEINS FROM BACTERIOPHAGE LAMBDA' _struct.pdbx_descriptor 'LAMBDA REPRESSOR (N-TERMINAL DOMAIN)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1LRP _struct_keywords.pdbx_keywords 'DNA BINDING REGULATORY PROTEIN' _struct_keywords.text 'DNA BINDING REGULATORY PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? # loop_ _struct_biol.id _struct_biol.details _struct_biol.pdbx_parent_biol_id 1 ;THE REPRESSOR MOLECULE CONSISTS OF A DIMER, AND COORDINATES FOR THE SYMMETRY RELATED CHAIN CAN BE GENERATED FROM THE CHAIN PRESENTED IN THIS ENTRY BY 1.0 0.0 0.0 0.0 0.0 -1.0 0.0 0.0 0.0 0.0 -1.0 0.0 ; ? 2 ? ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 GLN A 9 ? GLU A 23 ? GLN A 9 GLU A 23 1 ? 15 HELX_P HELX_P2 H2 GLN A 33 ? LYS A 39 ? GLN A 33 LYS A 39 1 ? 7 HELX_P HELX_P3 H3 GLN A 44 ? ASN A 52 ? GLN A 44 ASN A 52 1 ? 9 HELX_P HELX_P4 H4 ASN A 61 ? LEU A 69 ? ASN A 61 LEU A 69 1 ? 9 HELX_P HELX_P5 H5 SER A 79 ? SER A 92 ? SER A 79 SER A 92 1 ? 14 HELX_P HELX_P6 H6 GLN B 9 ? GLU B 23 ? GLN B 9 GLU B 23 1 ? 15 HELX_P HELX_P7 H7 GLN B 33 ? LYS B 39 ? GLN B 33 LYS B 39 1 ? 7 HELX_P HELX_P8 H8 GLN B 44 ? ASN B 52 ? GLN B 44 ASN B 52 1 ? 9 HELX_P HELX_P9 H8 ASN B 61 ? LEU B 69 ? ASN B 61 LEU B 69 1 ? 9 HELX_P HELX_P10 H10 SER B 79 ? SER B 92 ? SER B 79 SER B 92 1 ? 14 HELX_P HELX_P11 H11 GLN C 9 ? GLU C 23 ? GLN C 9 GLU C 23 1 ? 15 HELX_P HELX_P12 H12 GLN C 33 ? LYS C 39 ? GLN C 33 LYS C 39 1 ? 7 HELX_P HELX_P13 H13 GLN C 44 ? ASN C 52 ? GLN C 44 ASN C 52 1 ? 9 HELX_P HELX_P14 H14 ASN C 61 ? LEU C 69 ? ASN C 61 LEU C 69 1 ? 9 HELX_P HELX_P15 H15 SER C 79 ? SER C 92 ? SER C 79 SER C 92 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1LRP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1LRP _atom_sites.fract_transf_matrix[1][1] -0.015383 _atom_sites.fract_transf_matrix[1][2] -0.008240 _atom_sites.fract_transf_matrix[1][3] 0.003330 _atom_sites.fract_transf_matrix[2][1] -0.015384 _atom_sites.fract_transf_matrix[2][2] 0.008228 _atom_sites.fract_transf_matrix[2][3] -0.003331 _atom_sites.fract_transf_matrix[3][1] 0.000001 _atom_sites.fract_transf_matrix[3][2] -0.002506 _atom_sites.fract_transf_matrix[3][3] -0.006196 _atom_sites.fract_transf_vector[1] -0.71011 _atom_sites.fract_transf_vector[2] -0.71005 _atom_sites.fract_transf_vector[3] -0.00002 # _atom_type.symbol C # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 SER 92 92 92 SER SER A . n B 1 1 SER 1 1 ? ? ? B . n B 1 2 THR 2 2 ? ? ? B . n B 1 3 LYS 3 3 ? ? ? B . n B 1 4 LYS 4 4 4 LYS LYS B . n B 1 5 LYS 5 5 5 LYS LYS B . n B 1 6 PRO 6 6 6 PRO PRO B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 THR 8 8 8 THR THR B . n B 1 9 GLN 9 9 9 GLN GLN B . n B 1 10 GLU 10 10 10 GLU GLU B . n B 1 11 GLN 11 11 11 GLN GLN B . n B 1 12 LEU 12 12 12 LEU LEU B . n B 1 13 GLU 13 13 13 GLU GLU B . n B 1 14 ASP 14 14 14 ASP ASP B . n B 1 15 ALA 15 15 15 ALA ALA B . n B 1 16 ARG 16 16 16 ARG ARG B . n B 1 17 ARG 17 17 17 ARG ARG B . n B 1 18 LEU 18 18 18 LEU LEU B . n B 1 19 LYS 19 19 19 LYS LYS B . n B 1 20 ALA 20 20 20 ALA ALA B . n B 1 21 ILE 21 21 21 ILE ILE B . n B 1 22 TYR 22 22 22 TYR TYR B . n B 1 23 GLU 23 23 23 GLU GLU B . n B 1 24 LYS 24 24 24 LYS LYS B . n B 1 25 LYS 25 25 25 LYS LYS B . n B 1 26 LYS 26 26 26 LYS LYS B . n B 1 27 ASN 27 27 27 ASN ASN B . n B 1 28 GLU 28 28 28 GLU GLU B . n B 1 29 LEU 29 29 29 LEU LEU B . n B 1 30 GLY 30 30 30 GLY GLY B . n B 1 31 LEU 31 31 31 LEU LEU B . n B 1 32 SER 32 32 32 SER SER B . n B 1 33 GLN 33 33 33 GLN GLN B . n B 1 34 GLU 34 34 34 GLU GLU B . n B 1 35 SER 35 35 35 SER SER B . n B 1 36 VAL 36 36 36 VAL VAL B . n B 1 37 ALA 37 37 37 ALA ALA B . n B 1 38 ASP 38 38 38 ASP ASP B . n B 1 39 LYS 39 39 39 LYS LYS B . n B 1 40 MET 40 40 40 MET MET B . n B 1 41 GLY 41 41 41 GLY GLY B . n B 1 42 MET 42 42 42 MET MET B . n B 1 43 GLY 43 43 43 GLY GLY B . n B 1 44 GLN 44 44 44 GLN GLN B . n B 1 45 SER 45 45 45 SER SER B . n B 1 46 GLY 46 46 46 GLY GLY B . n B 1 47 VAL 47 47 47 VAL VAL B . n B 1 48 GLY 48 48 48 GLY GLY B . n B 1 49 ALA 49 49 49 ALA ALA B . n B 1 50 LEU 50 50 50 LEU LEU B . n B 1 51 PHE 51 51 51 PHE PHE B . n B 1 52 ASN 52 52 52 ASN ASN B . n B 1 53 GLY 53 53 53 GLY GLY B . n B 1 54 ILE 54 54 54 ILE ILE B . n B 1 55 ASN 55 55 55 ASN ASN B . n B 1 56 ALA 56 56 56 ALA ALA B . n B 1 57 LEU 57 57 57 LEU LEU B . n B 1 58 ASN 58 58 58 ASN ASN B . n B 1 59 ALA 59 59 59 ALA ALA B . n B 1 60 TYR 60 60 60 TYR TYR B . n B 1 61 ASN 61 61 61 ASN ASN B . n B 1 62 ALA 62 62 62 ALA ALA B . n B 1 63 ALA 63 63 63 ALA ALA B . n B 1 64 LEU 64 64 64 LEU LEU B . n B 1 65 LEU 65 65 65 LEU LEU B . n B 1 66 ALA 66 66 66 ALA ALA B . n B 1 67 LYS 67 67 67 LYS LYS B . n B 1 68 ILE 68 68 68 ILE ILE B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 LYS 70 70 70 LYS LYS B . n B 1 71 VAL 71 71 71 VAL VAL B . n B 1 72 SER 72 72 72 SER SER B . n B 1 73 VAL 73 73 73 VAL VAL B . n B 1 74 GLU 74 74 74 GLU GLU B . n B 1 75 GLU 75 75 75 GLU GLU B . n B 1 76 PHE 76 76 76 PHE PHE B . n B 1 77 SER 77 77 77 SER SER B . n B 1 78 PRO 78 78 78 PRO PRO B . n B 1 79 SER 79 79 79 SER SER B . n B 1 80 ILE 80 80 80 ILE ILE B . n B 1 81 ALA 81 81 81 ALA ALA B . n B 1 82 ARG 82 82 82 ARG ARG B . n B 1 83 GLU 83 83 83 GLU GLU B . n B 1 84 ILE 84 84 84 ILE ILE B . n B 1 85 TYR 85 85 85 TYR TYR B . n B 1 86 GLU 86 86 86 GLU GLU B . n B 1 87 MET 87 87 87 MET MET B . n B 1 88 TYR 88 88 88 TYR TYR B . n B 1 89 GLU 89 89 89 GLU GLU B . n B 1 90 ALA 90 90 90 ALA ALA B . n B 1 91 VAL 91 91 91 VAL VAL B . n B 1 92 SER 92 92 92 SER SER B . n C 1 1 SER 1 1 ? ? ? C . n C 1 2 THR 2 2 ? ? ? C . n C 1 3 LYS 3 3 ? ? ? C . n C 1 4 LYS 4 4 4 LYS LYS C . n C 1 5 LYS 5 5 5 LYS LYS C . n C 1 6 PRO 6 6 6 PRO PRO C . n C 1 7 LEU 7 7 7 LEU LEU C . n C 1 8 THR 8 8 8 THR THR C . n C 1 9 GLN 9 9 9 GLN GLN C . n C 1 10 GLU 10 10 10 GLU GLU C . n C 1 11 GLN 11 11 11 GLN GLN C . n C 1 12 LEU 12 12 12 LEU LEU C . n C 1 13 GLU 13 13 13 GLU GLU C . n C 1 14 ASP 14 14 14 ASP ASP C . n C 1 15 ALA 15 15 15 ALA ALA C . n C 1 16 ARG 16 16 16 ARG ARG C . n C 1 17 ARG 17 17 17 ARG ARG C . n C 1 18 LEU 18 18 18 LEU LEU C . n C 1 19 LYS 19 19 19 LYS LYS C . n C 1 20 ALA 20 20 20 ALA ALA C . n C 1 21 ILE 21 21 21 ILE ILE C . n C 1 22 TYR 22 22 22 TYR TYR C . n C 1 23 GLU 23 23 23 GLU GLU C . n C 1 24 LYS 24 24 24 LYS LYS C . n C 1 25 LYS 25 25 25 LYS LYS C . n C 1 26 LYS 26 26 26 LYS LYS C . n C 1 27 ASN 27 27 27 ASN ASN C . n C 1 28 GLU 28 28 28 GLU GLU C . n C 1 29 LEU 29 29 29 LEU LEU C . n C 1 30 GLY 30 30 30 GLY GLY C . n C 1 31 LEU 31 31 31 LEU LEU C . n C 1 32 SER 32 32 32 SER SER C . n C 1 33 GLN 33 33 33 GLN GLN C . n C 1 34 GLU 34 34 34 GLU GLU C . n C 1 35 SER 35 35 35 SER SER C . n C 1 36 VAL 36 36 36 VAL VAL C . n C 1 37 ALA 37 37 37 ALA ALA C . n C 1 38 ASP 38 38 38 ASP ASP C . n C 1 39 LYS 39 39 39 LYS LYS C . n C 1 40 MET 40 40 40 MET MET C . n C 1 41 GLY 41 41 41 GLY GLY C . n C 1 42 MET 42 42 42 MET MET C . n C 1 43 GLY 43 43 43 GLY GLY C . n C 1 44 GLN 44 44 44 GLN GLN C . n C 1 45 SER 45 45 45 SER SER C . n C 1 46 GLY 46 46 46 GLY GLY C . n C 1 47 VAL 47 47 47 VAL VAL C . n C 1 48 GLY 48 48 48 GLY GLY C . n C 1 49 ALA 49 49 49 ALA ALA C . n C 1 50 LEU 50 50 50 LEU LEU C . n C 1 51 PHE 51 51 51 PHE PHE C . n C 1 52 ASN 52 52 52 ASN ASN C . n C 1 53 GLY 53 53 53 GLY GLY C . n C 1 54 ILE 54 54 54 ILE ILE C . n C 1 55 ASN 55 55 55 ASN ASN C . n C 1 56 ALA 56 56 56 ALA ALA C . n C 1 57 LEU 57 57 57 LEU LEU C . n C 1 58 ASN 58 58 58 ASN ASN C . n C 1 59 ALA 59 59 59 ALA ALA C . n C 1 60 TYR 60 60 60 TYR TYR C . n C 1 61 ASN 61 61 61 ASN ASN C . n C 1 62 ALA 62 62 62 ALA ALA C . n C 1 63 ALA 63 63 63 ALA ALA C . n C 1 64 LEU 64 64 64 LEU LEU C . n C 1 65 LEU 65 65 65 LEU LEU C . n C 1 66 ALA 66 66 66 ALA ALA C . n C 1 67 LYS 67 67 67 LYS LYS C . n C 1 68 ILE 68 68 68 ILE ILE C . n C 1 69 LEU 69 69 69 LEU LEU C . n C 1 70 LYS 70 70 70 LYS LYS C . n C 1 71 VAL 71 71 71 VAL VAL C . n C 1 72 SER 72 72 72 SER SER C . n C 1 73 VAL 73 73 73 VAL VAL C . n C 1 74 GLU 74 74 74 GLU GLU C . n C 1 75 GLU 75 75 75 GLU GLU C . n C 1 76 PHE 76 76 76 PHE PHE C . n C 1 77 SER 77 77 77 SER SER C . n C 1 78 PRO 78 78 78 PRO PRO C . n C 1 79 SER 79 79 79 SER SER C . n C 1 80 ILE 80 80 80 ILE ILE C . n C 1 81 ALA 81 81 81 ALA ALA C . n C 1 82 ARG 82 82 82 ARG ARG C . n C 1 83 GLU 83 83 83 GLU GLU C . n C 1 84 ILE 84 84 84 ILE ILE C . n C 1 85 TYR 85 85 85 TYR TYR C . n C 1 86 GLU 86 86 86 GLU GLU C . n C 1 87 MET 87 87 87 MET MET C . n C 1 88 TYR 88 88 88 TYR TYR C . n C 1 89 GLU 89 89 89 GLU GLU C . n C 1 90 ALA 90 90 90 ALA ALA C . n C 1 91 VAL 91 91 91 VAL VAL C . n C 1 92 SER 92 92 92 SER SER C . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? dimeric 2 2 author_defined_assembly ? dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2 A 2 1 B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 y,x,-z 1.0000000000 0.0007800565 0.0000000000 0.0000000000 0.0002165787 -1.0000000000 0.0000000000 0.0000000000 0.0002351927 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1989-01-09 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Version format compliance' # _pdbx_database_remark.id 285 _pdbx_database_remark.text ;THE ENTRY COORDINATES ARE NOT PRESENTED IN THE STANDARD CRYSTAL FRAME. ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 B SER 1 ? B SER 1 5 1 Y 1 B THR 2 ? B THR 2 6 1 Y 1 B LYS 3 ? B LYS 3 7 1 Y 1 C SER 1 ? C SER 1 8 1 Y 1 C THR 2 ? C THR 2 9 1 Y 1 C LYS 3 ? C LYS 3 # loop_ _pdbx_coordinate_model.asym_id _pdbx_coordinate_model.type A 'CA ATOMS ONLY' B 'CA ATOMS ONLY' C 'CA ATOMS ONLY' #