data_1LRY # _entry.id 1LRY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1LRY RCSB RCSB016229 WWPDB D_1000016229 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1LQW '1LQW IS the crystal structure of S.aureus deformylase.' unspecified PDB 1LQY '1LQY IS the crystal structure of B.stearothermophilus deformylase.' unspecified PDB 1LRU '1LRU IS the crystal structure of E.coli deformylase.' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LRY _pdbx_database_status.recvd_initial_deposition_date 2002-05-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Guilloteau, J.-P.' 1 'Mathieu, M.' 2 'Giglione, C.' 3 'Blanc, V.' 4 'Dupuy, A.' 5 'Chevrier, M.' 6 'Gil, P.' 7 'Famechon, A.' 8 'Meinnel, T.' 9 'Mikol, V.' 10 # _citation.id primary _citation.title ;The crystal structures of four peptide deformylases bound to the antibiotic actinonin reveal two distinct types: a platform for the structure-based design of antibacterial agents. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 320 _citation.page_first 951 _citation.page_last 962 _citation.year 2002 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12126617 _citation.pdbx_database_id_DOI '10.1016/S0022-2836(02)00549-1' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Guilloteau, J.P.' 1 primary 'Mathieu, M.' 2 primary 'Giglione, C.' 3 primary 'Blanc, V.' 4 primary 'Dupuy, A.' 5 primary 'Chevrier, M.' 6 primary 'Gil, P.' 7 primary 'Famechon, A.' 8 primary 'Meinnel, T.' 9 primary 'Mikol, V.' 10 # _cell.entry_id 1LRY _cell.length_a 50.430 _cell.length_b 60.130 _cell.length_c 73.290 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1LRY _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PEPTIDE deformylase' 19259.961 1 3.5.1.88 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn ACTINONIN 385.498 1 ? ? ? ? 4 water nat water 18.015 150 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PDF, POLYPEPTIDE DEFORMYLASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPL TEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLE KQHRQQA ; _entity_poly.pdbx_seq_one_letter_code_can ;AILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPL TEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLE KQHRQQA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ILE n 1 3 LEU n 1 4 ASN n 1 5 ILE n 1 6 LEU n 1 7 GLU n 1 8 PHE n 1 9 PRO n 1 10 ASP n 1 11 PRO n 1 12 ARG n 1 13 LEU n 1 14 ARG n 1 15 THR n 1 16 ILE n 1 17 ALA n 1 18 LYS n 1 19 PRO n 1 20 VAL n 1 21 GLU n 1 22 VAL n 1 23 VAL n 1 24 ASP n 1 25 ASP n 1 26 ALA n 1 27 VAL n 1 28 ARG n 1 29 GLN n 1 30 LEU n 1 31 ILE n 1 32 ASP n 1 33 ASP n 1 34 MET n 1 35 PHE n 1 36 GLU n 1 37 THR n 1 38 MET n 1 39 TYR n 1 40 GLU n 1 41 ALA n 1 42 PRO n 1 43 GLY n 1 44 ILE n 1 45 GLY n 1 46 LEU n 1 47 ALA n 1 48 ALA n 1 49 THR n 1 50 GLN n 1 51 VAL n 1 52 ASN n 1 53 VAL n 1 54 HIS n 1 55 LYS n 1 56 ARG n 1 57 ILE n 1 58 VAL n 1 59 VAL n 1 60 MET n 1 61 ASP n 1 62 LEU n 1 63 SER n 1 64 GLU n 1 65 ASP n 1 66 LYS n 1 67 SER n 1 68 GLU n 1 69 PRO n 1 70 ARG n 1 71 VAL n 1 72 PHE n 1 73 ILE n 1 74 ASN n 1 75 PRO n 1 76 GLU n 1 77 PHE n 1 78 GLU n 1 79 PRO n 1 80 LEU n 1 81 THR n 1 82 GLU n 1 83 ASP n 1 84 MET n 1 85 ASP n 1 86 GLN n 1 87 TYR n 1 88 GLN n 1 89 GLU n 1 90 GLY n 1 91 CYS n 1 92 LEU n 1 93 SER n 1 94 VAL n 1 95 PRO n 1 96 GLY n 1 97 PHE n 1 98 TYR n 1 99 GLU n 1 100 ASN n 1 101 VAL n 1 102 ASP n 1 103 ARG n 1 104 PRO n 1 105 GLN n 1 106 LYS n 1 107 VAL n 1 108 ARG n 1 109 ILE n 1 110 LYS n 1 111 ALA n 1 112 LEU n 1 113 ASP n 1 114 ARG n 1 115 ASP n 1 116 GLY n 1 117 ASN n 1 118 PRO n 1 119 PHE n 1 120 GLU n 1 121 GLU n 1 122 VAL n 1 123 ALA n 1 124 GLU n 1 125 GLY n 1 126 LEU n 1 127 LEU n 1 128 ALA n 1 129 VAL n 1 130 CYS n 1 131 ILE n 1 132 GLN n 1 133 HIS n 1 134 GLU n 1 135 CYS n 1 136 ASP n 1 137 HIS n 1 138 LEU n 1 139 ASN n 1 140 GLY n 1 141 LYS n 1 142 LEU n 1 143 PHE n 1 144 VAL n 1 145 ASP n 1 146 TYR n 1 147 LEU n 1 148 SER n 1 149 THR n 1 150 LEU n 1 151 LYS n 1 152 ARG n 1 153 ASP n 1 154 ARG n 1 155 ILE n 1 156 ARG n 1 157 LYS n 1 158 LYS n 1 159 LEU n 1 160 GLU n 1 161 LYS n 1 162 GLN n 1 163 HIS n 1 164 ARG n 1 165 GLN n 1 166 GLN n 1 167 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pseudomonas _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DEF_PSEAE _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEP LTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKL EKQHRQQA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession Q9I7A8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1LRY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 167 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9I7A8 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 168 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 167 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BB2 non-polymer . ACTINONIN '2-[(FORMYL-HYDROXY-AMINO)-METHYL]-HEPTANOIC ACID [1-(2-HYDROXYMETHYL-PYRROLIDINE-1-CARBONYL)-2-METHYL-PROPYL]-AMIDE' 'C19 H35 N3 O5' 385.498 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1LRY _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 57.34 _exptl_crystal.density_Matthews 2.7 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 9.5 _exptl_crystal_grow.pdbx_details '32% PEG6000, pH 9.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 95 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'MAC Science DIP-2000' _diffrn_detector.pdbx_collection_date 1997-10-22 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Ni MIRROR + Ni FILTER' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type ENRAF-NONIUS _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 1LRY _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 2.6 _reflns.d_resolution_low 15 _reflns.number_all 7756 _reflns.number_obs 7756 _reflns.percent_possible_obs 85.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.0880000 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_all 85.3 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.2460000 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 580 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1LRY _refine.ls_d_res_high 2.6 _refine.ls_d_res_low 15 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 7747 _refine.ls_number_reflns_obs 7747 _refine.ls_number_reflns_R_free ? _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_all 0.2210000 _refine.ls_R_factor_obs 0.2210000 _refine.ls_R_factor_R_work 0.2210000 _refine.ls_R_factor_R_free ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1332 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 150 _refine_hist.number_atoms_total 1510 _refine_hist.d_res_high 2.6 _refine_hist.d_res_low 15 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.012 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.5 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1LRY _struct.title 'Crystal Structure of P. aeruginosa Peptide Deformylase Complexed with Antibiotic Actinonin' _struct.pdbx_descriptor 'PEPTIDE deformylase (E.C.3.5.1.88)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1LRY _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'ACTINONIN, INHIBITION, POLYPEPTIDE DEFORMYLASE, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details 'the biological assembly is the monomer' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 10 ? THR A 15 ? ASP A 10 THR A 15 5 ? 6 HELX_P HELX_P2 2 ASP A 24 ? ALA A 41 ? ASP A 24 ALA A 41 1 ? 18 HELX_P HELX_P3 3 THR A 49 ? ASN A 52 ? THR A 49 ASN A 52 5 ? 4 HELX_P HELX_P4 4 GLU A 124 ? ASN A 139 ? GLU A 124 ASN A 139 1 ? 16 HELX_P HELX_P5 5 LEU A 142 ? TYR A 146 ? LEU A 142 TYR A 146 5 ? 5 HELX_P HELX_P6 6 SER A 148 ? ARG A 164 ? SER A 148 ARG A 164 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 133 NE2 ? ? A ZN 168 A HIS 133 1_555 ? ? ? ? ? ? ? 2.273 ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 137 NE2 ? ? A ZN 168 A HIS 137 1_555 ? ? ? ? ? ? ? 2.278 ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 C BB2 . O4 ? ? A ZN 168 A BB2 170 1_555 ? ? ? ? ? ? ? 2.191 ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 C BB2 . N1 ? ? A ZN 168 A BB2 170 1_555 ? ? ? ? ? ? ? 2.643 ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 C BB2 . O2 ? ? A ZN 168 A BB2 170 1_555 ? ? ? ? ? ? ? 2.199 ? metalc6 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 91 SG ? ? A ZN 168 A CYS 91 1_555 ? ? ? ? ? ? ? 2.502 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 8 A . ? PHE 8 A PRO 9 A ? PRO 9 A 1 0.34 2 ALA 41 A . ? ALA 41 A PRO 42 A ? PRO 42 A 1 -0.11 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 45 ? ALA A 47 ? GLY A 45 ALA A 47 A 2 ILE A 57 ? MET A 60 ? ILE A 57 MET A 60 A 3 ARG A 70 ? PRO A 79 ? ARG A 70 PRO A 79 A 4 VAL A 107 ? LEU A 112 ? VAL A 107 LEU A 112 A 5 PRO A 118 ? ALA A 123 ? PRO A 118 ALA A 123 B 1 MET A 84 ? CYS A 91 ? MET A 84 CYS A 91 B 2 VAL A 94 ? PRO A 104 ? VAL A 94 PRO A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 46 ? N LEU A 46 O VAL A 59 ? O VAL A 59 A 2 3 N VAL A 58 ? N VAL A 58 O PHE A 72 ? O PHE A 72 A 3 4 N GLU A 78 ? N GLU A 78 O ARG A 108 ? O ARG A 108 A 4 5 N VAL A 107 ? N VAL A 107 O ALA A 123 ? O ALA A 123 B 1 2 N TYR A 87 ? N TYR A 87 O VAL A 101 ? O VAL A 101 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 168' AC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE BB2 A 170' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLN A 50 ? GLN A 50 . ? 1_555 ? 2 AC1 5 CYS A 91 ? CYS A 91 . ? 1_555 ? 3 AC1 5 HIS A 133 ? HIS A 133 . ? 1_555 ? 4 AC1 5 HIS A 137 ? HIS A 137 . ? 1_555 ? 5 AC1 5 BB2 C . ? BB2 A 170 . ? 1_555 ? 6 AC2 16 GLY A 43 ? GLY A 43 . ? 1_555 ? 7 AC2 16 ILE A 44 ? ILE A 44 . ? 1_555 ? 8 AC2 16 GLY A 45 ? GLY A 45 . ? 1_555 ? 9 AC2 16 GLN A 50 ? GLN A 50 . ? 1_555 ? 10 AC2 16 TYR A 87 ? TYR A 87 . ? 1_555 ? 11 AC2 16 GLN A 88 ? GLN A 88 . ? 1_555 ? 12 AC2 16 GLY A 90 ? GLY A 90 . ? 1_555 ? 13 AC2 16 CYS A 91 ? CYS A 91 . ? 1_555 ? 14 AC2 16 LEU A 92 ? LEU A 92 . ? 1_555 ? 15 AC2 16 VAL A 129 ? VAL A 129 . ? 1_555 ? 16 AC2 16 CYS A 130 ? CYS A 130 . ? 1_555 ? 17 AC2 16 HIS A 133 ? HIS A 133 . ? 1_555 ? 18 AC2 16 GLU A 134 ? GLU A 134 . ? 1_555 ? 19 AC2 16 HIS A 137 ? HIS A 137 . ? 1_555 ? 20 AC2 16 ZN B . ? ZN A 168 . ? 1_555 ? 21 AC2 16 HOH D . ? HOH A 301 . ? 1_555 ? # _database_PDB_matrix.entry_id 1LRY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1LRY _atom_sites.fract_transf_matrix[1][1] 0.019829 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016631 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013644 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 GLN 86 86 86 GLN ALA A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 CYS 91 91 91 CYS CYS A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 GLN 132 132 132 GLN GLN A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 CYS 135 135 135 CYS CYS A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 GLN 162 162 162 GLN GLN A . n A 1 163 HIS 163 163 163 HIS HIS A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 GLN 166 166 ? ? ? A . n A 1 167 ALA 167 167 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 133 ? A HIS 133 ? 1_555 ZN ? B ZN . ? A ZN 168 ? 1_555 NE2 ? A HIS 137 ? A HIS 137 ? 1_555 103.0 ? 2 NE2 ? A HIS 133 ? A HIS 133 ? 1_555 ZN ? B ZN . ? A ZN 168 ? 1_555 O4 ? C BB2 . ? A BB2 170 ? 1_555 112.6 ? 3 NE2 ? A HIS 137 ? A HIS 137 ? 1_555 ZN ? B ZN . ? A ZN 168 ? 1_555 O4 ? C BB2 . ? A BB2 170 ? 1_555 140.1 ? 4 NE2 ? A HIS 133 ? A HIS 133 ? 1_555 ZN ? B ZN . ? A ZN 168 ? 1_555 N1 ? C BB2 . ? A BB2 170 ? 1_555 91.6 ? 5 NE2 ? A HIS 137 ? A HIS 137 ? 1_555 ZN ? B ZN . ? A ZN 168 ? 1_555 N1 ? C BB2 . ? A BB2 170 ? 1_555 107.4 ? 6 O4 ? C BB2 . ? A BB2 170 ? 1_555 ZN ? B ZN . ? A ZN 168 ? 1_555 N1 ? C BB2 . ? A BB2 170 ? 1_555 55.8 ? 7 NE2 ? A HIS 133 ? A HIS 133 ? 1_555 ZN ? B ZN . ? A ZN 168 ? 1_555 O2 ? C BB2 . ? A BB2 170 ? 1_555 99.6 ? 8 NE2 ? A HIS 137 ? A HIS 137 ? 1_555 ZN ? B ZN . ? A ZN 168 ? 1_555 O2 ? C BB2 . ? A BB2 170 ? 1_555 75.7 ? 9 O4 ? C BB2 . ? A BB2 170 ? 1_555 ZN ? B ZN . ? A ZN 168 ? 1_555 O2 ? C BB2 . ? A BB2 170 ? 1_555 81.0 ? 10 N1 ? C BB2 . ? A BB2 170 ? 1_555 ZN ? B ZN . ? A ZN 168 ? 1_555 O2 ? C BB2 . ? A BB2 170 ? 1_555 31.7 ? 11 NE2 ? A HIS 133 ? A HIS 133 ? 1_555 ZN ? B ZN . ? A ZN 168 ? 1_555 SG ? A CYS 91 ? A CYS 91 ? 1_555 109.5 ? 12 NE2 ? A HIS 137 ? A HIS 137 ? 1_555 ZN ? B ZN . ? A ZN 168 ? 1_555 SG ? A CYS 91 ? A CYS 91 ? 1_555 100.0 ? 13 O4 ? C BB2 . ? A BB2 170 ? 1_555 ZN ? B ZN . ? A ZN 168 ? 1_555 SG ? A CYS 91 ? A CYS 91 ? 1_555 84.9 ? 14 N1 ? C BB2 . ? A BB2 170 ? 1_555 ZN ? B ZN . ? A ZN 168 ? 1_555 SG ? A CYS 91 ? A CYS 91 ? 1_555 140.5 ? 15 O2 ? C BB2 . ? A BB2 170 ? 1_555 ZN ? B ZN . ? A ZN 168 ? 1_555 SG ? A CYS 91 ? A CYS 91 ? 1_555 150.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-07-24 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal AMoRE phasing . ? 1 X-PLOR refinement . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 9 ? ? -98.15 50.81 2 1 VAL A 23 ? ? -107.91 76.90 3 1 ASP A 61 ? ? -163.36 95.49 4 1 LEU A 62 ? ? -88.25 33.17 5 1 GLU A 64 ? ? -61.96 -71.25 6 1 LYS A 66 ? ? -66.78 54.02 7 1 GLU A 76 ? ? -176.33 140.67 8 1 ALA A 111 ? ? -150.57 -154.69 9 1 ASP A 113 ? ? -67.40 -171.57 10 1 HIS A 163 ? ? -42.09 -71.88 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 86 ? CG ? A GLN 86 CG 2 1 Y 1 A GLN 86 ? CD ? A GLN 86 CD 3 1 Y 1 A GLN 86 ? OE1 ? A GLN 86 OE1 4 1 Y 1 A GLN 86 ? NE2 ? A GLN 86 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 166 ? A GLN 166 2 1 Y 1 A ALA 167 ? A ALA 167 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 ACTINONIN BB2 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 168 168 ZN ZN A . C 3 BB2 1 170 170 BB2 ATN A . D 4 HOH 1 201 201 HOH HOH A . D 4 HOH 2 202 202 HOH HOH A . D 4 HOH 3 203 203 HOH HOH A . D 4 HOH 4 204 204 HOH HOH A . D 4 HOH 5 205 205 HOH HOH A . D 4 HOH 6 206 206 HOH HOH A . D 4 HOH 7 207 207 HOH HOH A . D 4 HOH 8 208 208 HOH HOH A . D 4 HOH 9 209 209 HOH HOH A . D 4 HOH 10 210 210 HOH HOH A . D 4 HOH 11 211 211 HOH HOH A . D 4 HOH 12 212 212 HOH HOH A . D 4 HOH 13 213 213 HOH HOH A . D 4 HOH 14 214 214 HOH HOH A . D 4 HOH 15 215 215 HOH HOH A . D 4 HOH 16 216 216 HOH HOH A . D 4 HOH 17 217 217 HOH HOH A . D 4 HOH 18 218 218 HOH HOH A . D 4 HOH 19 219 219 HOH HOH A . D 4 HOH 20 220 220 HOH HOH A . D 4 HOH 21 221 221 HOH HOH A . D 4 HOH 22 222 222 HOH HOH A . D 4 HOH 23 223 223 HOH HOH A . D 4 HOH 24 224 224 HOH HOH A . D 4 HOH 25 225 225 HOH HOH A . D 4 HOH 26 226 226 HOH HOH A . D 4 HOH 27 227 227 HOH HOH A . D 4 HOH 28 228 228 HOH HOH A . D 4 HOH 29 229 229 HOH HOH A . D 4 HOH 30 230 230 HOH HOH A . D 4 HOH 31 231 231 HOH HOH A . D 4 HOH 32 232 232 HOH HOH A . D 4 HOH 33 233 233 HOH HOH A . D 4 HOH 34 234 234 HOH HOH A . D 4 HOH 35 235 235 HOH HOH A . D 4 HOH 36 236 236 HOH HOH A . D 4 HOH 37 237 237 HOH HOH A . D 4 HOH 38 238 238 HOH HOH A . D 4 HOH 39 239 239 HOH HOH A . D 4 HOH 40 240 240 HOH HOH A . D 4 HOH 41 241 241 HOH HOH A . D 4 HOH 42 242 242 HOH HOH A . D 4 HOH 43 243 243 HOH HOH A . D 4 HOH 44 244 244 HOH HOH A . D 4 HOH 45 245 245 HOH HOH A . D 4 HOH 46 246 246 HOH HOH A . D 4 HOH 47 247 247 HOH HOH A . D 4 HOH 48 248 248 HOH HOH A . D 4 HOH 49 249 249 HOH HOH A . D 4 HOH 50 250 250 HOH HOH A . D 4 HOH 51 251 251 HOH HOH A . D 4 HOH 52 252 252 HOH HOH A . D 4 HOH 53 253 253 HOH HOH A . D 4 HOH 54 254 254 HOH HOH A . D 4 HOH 55 255 255 HOH HOH A . D 4 HOH 56 256 256 HOH HOH A . D 4 HOH 57 257 257 HOH HOH A . D 4 HOH 58 258 258 HOH HOH A . D 4 HOH 59 259 259 HOH HOH A . D 4 HOH 60 260 260 HOH HOH A . D 4 HOH 61 261 261 HOH HOH A . D 4 HOH 62 262 262 HOH HOH A . D 4 HOH 63 263 263 HOH HOH A . D 4 HOH 64 264 264 HOH HOH A . D 4 HOH 65 265 265 HOH HOH A . D 4 HOH 66 266 266 HOH HOH A . D 4 HOH 67 267 267 HOH HOH A . D 4 HOH 68 268 268 HOH HOH A . D 4 HOH 69 269 269 HOH HOH A . D 4 HOH 70 270 270 HOH HOH A . D 4 HOH 71 271 271 HOH HOH A . D 4 HOH 72 272 272 HOH HOH A . D 4 HOH 73 273 273 HOH HOH A . D 4 HOH 74 274 274 HOH HOH A . D 4 HOH 75 275 275 HOH HOH A . D 4 HOH 76 276 276 HOH HOH A . D 4 HOH 77 277 277 HOH HOH A . D 4 HOH 78 278 278 HOH HOH A . D 4 HOH 79 279 279 HOH HOH A . D 4 HOH 80 280 280 HOH HOH A . D 4 HOH 81 281 281 HOH HOH A . D 4 HOH 82 282 282 HOH HOH A . D 4 HOH 83 283 283 HOH HOH A . D 4 HOH 84 284 284 HOH HOH A . D 4 HOH 85 285 285 HOH HOH A . D 4 HOH 86 286 286 HOH HOH A . D 4 HOH 87 287 287 HOH HOH A . D 4 HOH 88 288 288 HOH HOH A . D 4 HOH 89 289 289 HOH HOH A . D 4 HOH 90 290 290 HOH HOH A . D 4 HOH 91 291 291 HOH HOH A . D 4 HOH 92 292 292 HOH HOH A . D 4 HOH 93 293 293 HOH HOH A . D 4 HOH 94 294 294 HOH HOH A . D 4 HOH 95 295 295 HOH HOH A . D 4 HOH 96 296 296 HOH HOH A . D 4 HOH 97 297 297 HOH HOH A . D 4 HOH 98 298 298 HOH HOH A . D 4 HOH 99 299 299 HOH HOH A . D 4 HOH 100 300 300 HOH HOH A . D 4 HOH 101 301 301 HOH HOH A . D 4 HOH 102 302 302 HOH HOH A . D 4 HOH 103 303 303 HOH HOH A . D 4 HOH 104 304 304 HOH HOH A . D 4 HOH 105 305 305 HOH HOH A . D 4 HOH 106 306 306 HOH HOH A . D 4 HOH 107 307 307 HOH HOH A . D 4 HOH 108 308 308 HOH HOH A . D 4 HOH 109 309 309 HOH HOH A . D 4 HOH 110 310 310 HOH HOH A . D 4 HOH 111 311 311 HOH HOH A . D 4 HOH 112 312 312 HOH HOH A . D 4 HOH 113 313 313 HOH HOH A . D 4 HOH 114 314 314 HOH HOH A . D 4 HOH 115 315 315 HOH HOH A . D 4 HOH 116 316 316 HOH HOH A . D 4 HOH 117 317 317 HOH HOH A . D 4 HOH 118 318 318 HOH HOH A . D 4 HOH 119 319 319 HOH HOH A . D 4 HOH 120 320 320 HOH HOH A . D 4 HOH 121 321 321 HOH HOH A . D 4 HOH 122 322 322 HOH HOH A . D 4 HOH 123 323 323 HOH HOH A . D 4 HOH 124 324 324 HOH HOH A . D 4 HOH 125 325 325 HOH HOH A . D 4 HOH 126 326 326 HOH HOH A . D 4 HOH 127 327 327 HOH HOH A . D 4 HOH 128 328 328 HOH HOH A . D 4 HOH 129 329 329 HOH HOH A . D 4 HOH 130 330 330 HOH HOH A . D 4 HOH 131 331 331 HOH HOH A . D 4 HOH 132 332 332 HOH HOH A . D 4 HOH 133 333 333 HOH HOH A . D 4 HOH 134 334 334 HOH HOH A . D 4 HOH 135 335 335 HOH HOH A . D 4 HOH 136 336 336 HOH HOH A . D 4 HOH 137 337 337 HOH HOH A . D 4 HOH 138 338 338 HOH HOH A . D 4 HOH 139 339 339 HOH HOH A . D 4 HOH 140 340 340 HOH HOH A . D 4 HOH 141 341 341 HOH HOH A . D 4 HOH 142 342 342 HOH HOH A . D 4 HOH 143 343 343 HOH HOH A . D 4 HOH 144 344 344 HOH HOH A . D 4 HOH 145 345 345 HOH HOH A . D 4 HOH 146 346 346 HOH HOH A . D 4 HOH 147 347 347 HOH HOH A . D 4 HOH 148 348 348 HOH HOH A . D 4 HOH 149 349 349 HOH HOH A . D 4 HOH 150 350 350 HOH HOH A . #