data_1LU1 # _entry.id 1LU1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1LU1 pdb_00001lu1 10.2210/pdb1lu1/pdb WWPDB D_1000174840 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LU1 _pdbx_database_status.recvd_initial_deposition_date 1998-07-24 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hamelryck, T.W.' 1 'Loris, R.' 2 'Bouckaert, J.' 3 'Strecker, G.' 4 'Imberty, A.' 5 'Fernandez, E.' 6 'Wyns, L.' 7 'Etzler, M.E.' 8 # _citation.id primary _citation.title ;Carbohydrate binding, quaternary structure and a novel hydrophobic binding site in two legume lectin oligomers from Dolichos biflorus. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 286 _citation.page_first 1161 _citation.page_last 1177 _citation.year 1999 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10047489 _citation.pdbx_database_id_DOI 10.1006/jmbi.1998.2534 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hamelryck, T.W.' 1 ? primary 'Loris, R.' 2 ? primary 'Bouckaert, J.' 3 ? primary 'Dao-Thi, M.H.' 4 ? primary 'Strecker, G.' 5 ? primary 'Imberty, A.' 6 ? primary 'Fernandez, E.' 7 ? primary 'Wyns, L.' 8 ? primary 'Etzler, M.E.' 9 ? # _cell.entry_id 1LU1 _cell.length_a 79.050 _cell.length_b 79.050 _cell.length_c 260.110 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1LU1 _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man LECTIN 27115.078 1 ? ? ? 'DOLICHOS BIFLORUS SEED LECTIN' 2 branched man '2-acetamido-2-deoxy-alpha-D-galactopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-galactopyranose' 424.401 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 5 non-polymer syn ADENINE 135.127 1 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 DBL 2 'Forssman antigen fragment' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ANIQSFSFKNFNSPSFILQGDATVSSGKLQLTKVKENGIPTPSSLGRAFYSSPIQIYDKSTGAVASWATSFTVKISAPSK ASFADGIAFALVPVGSEPRRNGGYLGVFDSDVYNNSAQTVAVEFDTLSNSGWDPSMKHIGIDVNSIKSIATVSWDLANGE NAEILITYNAATSLLVASLVHPSRRTSYILSERVDITNELPEYVSVGFSATTGLSEGYIETHDVLSWSFASKLPDDSTAE PLDLASYLVRNVL ; _entity_poly.pdbx_seq_one_letter_code_can ;ANIQSFSFKNFNSPSFILQGDATVSSGKLQLTKVKENGIPTPSSLGRAFYSSPIQIYDKSTGAVASWATSFTVKISAPSK ASFADGIAFALVPVGSEPRRNGGYLGVFDSDVYNNSAQTVAVEFDTLSNSGWDPSMKHIGIDVNSIKSIATVSWDLANGE NAEILITYNAATSLLVASLVHPSRRTSYILSERVDITNELPEYVSVGFSATTGLSEGYIETHDVLSWSFASKLPDDSTAE PLDLASYLVRNVL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASN n 1 3 ILE n 1 4 GLN n 1 5 SER n 1 6 PHE n 1 7 SER n 1 8 PHE n 1 9 LYS n 1 10 ASN n 1 11 PHE n 1 12 ASN n 1 13 SER n 1 14 PRO n 1 15 SER n 1 16 PHE n 1 17 ILE n 1 18 LEU n 1 19 GLN n 1 20 GLY n 1 21 ASP n 1 22 ALA n 1 23 THR n 1 24 VAL n 1 25 SER n 1 26 SER n 1 27 GLY n 1 28 LYS n 1 29 LEU n 1 30 GLN n 1 31 LEU n 1 32 THR n 1 33 LYS n 1 34 VAL n 1 35 LYS n 1 36 GLU n 1 37 ASN n 1 38 GLY n 1 39 ILE n 1 40 PRO n 1 41 THR n 1 42 PRO n 1 43 SER n 1 44 SER n 1 45 LEU n 1 46 GLY n 1 47 ARG n 1 48 ALA n 1 49 PHE n 1 50 TYR n 1 51 SER n 1 52 SER n 1 53 PRO n 1 54 ILE n 1 55 GLN n 1 56 ILE n 1 57 TYR n 1 58 ASP n 1 59 LYS n 1 60 SER n 1 61 THR n 1 62 GLY n 1 63 ALA n 1 64 VAL n 1 65 ALA n 1 66 SER n 1 67 TRP n 1 68 ALA n 1 69 THR n 1 70 SER n 1 71 PHE n 1 72 THR n 1 73 VAL n 1 74 LYS n 1 75 ILE n 1 76 SER n 1 77 ALA n 1 78 PRO n 1 79 SER n 1 80 LYS n 1 81 ALA n 1 82 SER n 1 83 PHE n 1 84 ALA n 1 85 ASP n 1 86 GLY n 1 87 ILE n 1 88 ALA n 1 89 PHE n 1 90 ALA n 1 91 LEU n 1 92 VAL n 1 93 PRO n 1 94 VAL n 1 95 GLY n 1 96 SER n 1 97 GLU n 1 98 PRO n 1 99 ARG n 1 100 ARG n 1 101 ASN n 1 102 GLY n 1 103 GLY n 1 104 TYR n 1 105 LEU n 1 106 GLY n 1 107 VAL n 1 108 PHE n 1 109 ASP n 1 110 SER n 1 111 ASP n 1 112 VAL n 1 113 TYR n 1 114 ASN n 1 115 ASN n 1 116 SER n 1 117 ALA n 1 118 GLN n 1 119 THR n 1 120 VAL n 1 121 ALA n 1 122 VAL n 1 123 GLU n 1 124 PHE n 1 125 ASP n 1 126 THR n 1 127 LEU n 1 128 SER n 1 129 ASN n 1 130 SER n 1 131 GLY n 1 132 TRP n 1 133 ASP n 1 134 PRO n 1 135 SER n 1 136 MET n 1 137 LYS n 1 138 HIS n 1 139 ILE n 1 140 GLY n 1 141 ILE n 1 142 ASP n 1 143 VAL n 1 144 ASN n 1 145 SER n 1 146 ILE n 1 147 LYS n 1 148 SER n 1 149 ILE n 1 150 ALA n 1 151 THR n 1 152 VAL n 1 153 SER n 1 154 TRP n 1 155 ASP n 1 156 LEU n 1 157 ALA n 1 158 ASN n 1 159 GLY n 1 160 GLU n 1 161 ASN n 1 162 ALA n 1 163 GLU n 1 164 ILE n 1 165 LEU n 1 166 ILE n 1 167 THR n 1 168 TYR n 1 169 ASN n 1 170 ALA n 1 171 ALA n 1 172 THR n 1 173 SER n 1 174 LEU n 1 175 LEU n 1 176 VAL n 1 177 ALA n 1 178 SER n 1 179 LEU n 1 180 VAL n 1 181 HIS n 1 182 PRO n 1 183 SER n 1 184 ARG n 1 185 ARG n 1 186 THR n 1 187 SER n 1 188 TYR n 1 189 ILE n 1 190 LEU n 1 191 SER n 1 192 GLU n 1 193 ARG n 1 194 VAL n 1 195 ASP n 1 196 ILE n 1 197 THR n 1 198 ASN n 1 199 GLU n 1 200 LEU n 1 201 PRO n 1 202 GLU n 1 203 TYR n 1 204 VAL n 1 205 SER n 1 206 VAL n 1 207 GLY n 1 208 PHE n 1 209 SER n 1 210 ALA n 1 211 THR n 1 212 THR n 1 213 GLY n 1 214 LEU n 1 215 SER n 1 216 GLU n 1 217 GLY n 1 218 TYR n 1 219 ILE n 1 220 GLU n 1 221 THR n 1 222 HIS n 1 223 ASP n 1 224 VAL n 1 225 LEU n 1 226 SER n 1 227 TRP n 1 228 SER n 1 229 PHE n 1 230 ALA n 1 231 SER n 1 232 LYS n 1 233 LEU n 1 234 PRO n 1 235 ASP n 1 236 ASP n 1 237 SER n 1 238 THR n 1 239 ALA n 1 240 GLU n 1 241 PRO n 1 242 LEU n 1 243 ASP n 1 244 LEU n 1 245 ALA n 1 246 SER n 1 247 TYR n 1 248 LEU n 1 249 VAL n 1 250 ARG n 1 251 ASN n 1 252 VAL n 1 253 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'horse gram' _entity_src_gen.gene_src_genus Vigna _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Vigna unguiculata' _entity_src_gen.gene_src_strain 'subsp. cylindrica' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vigna unguiculata subsp. cylindrica' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3840 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ SEED _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LEC1_DOLBI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P05045 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MASSTVSVVLSLFLLLLTQANSANIQSFSFKNFNSPSFILQGDATVSSGKLQLTKVKENGIPTPSSLGRAFYSSPIQIYD KSTGAVASWATSFTVKISAPSKASFADGIAFALVPVGSEPRRNGGYLGVFDSDVYNNSAQTVAVEFDTFSNSGWDPSMKH IGIDVNSIKSIATVSWDLANGENAEILITYNAATSLLVASLVHPSRRTSYILSERVDITNELPEYVSVGFSATTGLSEGY IETHDVLSWSFASKLPDDSTAEPLDLASYLVRNVL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1LU1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 253 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P05045 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 275 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 253 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1LU1 _struct_ref_seq_dif.mon_id LEU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 127 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P05045 _struct_ref_seq_dif.db_mon_id PHE _struct_ref_seq_dif.pdbx_seq_db_seq_num 149 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 127 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A2G 'D-saccharide, alpha linking' . 2-acetamido-2-deoxy-alpha-D-galactopyranose ;N-acetyl-alpha-D-galactosamine; 2-acetamido-2-deoxy-alpha-D-galactose; 2-acetamido-2-deoxy-D-galactose; 2-acetamido-2-deoxy-galactose; N-ACETYL-2-DEOXY-2-AMINO-GALACTOSE ; 'C8 H15 N O6' 221.208 ADE non-polymer . ADENINE ? 'C5 H5 N5' 135.127 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 NGA 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-galactopyranose ;N-acetyl-beta-D-galactosamine; 2-acetamido-2-deoxy-beta-D-galactose; 2-acetamido-2-deoxy-D-galactose; 2-acetamido-2-deoxy-galactose; N-ACETYL-D-GALACTOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1LU1 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.1 _exptl_crystal.density_percent_sol 60 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '100 MM HEPES PH 7.5 0.2 M MGCL2 30% (W/V) PEG 400' # _diffrn.id 1 _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1998-02 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1LU1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.00 _reflns.d_resolution_high 2.60 _reflns.number_obs 13175 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.15 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 15.2 _reflns.B_iso_Wilson_estimate 44.7 _reflns.pdbx_redundancy 7.0 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.62 _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_obs 0.75 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.27 _reflns_shell.pdbx_redundancy 7.0 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1LU1 _refine.ls_number_reflns_obs 13174 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 10000000.00 _refine.pdbx_data_cutoff_low_absF 0.00100 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 2.60 _refine.ls_percent_reflns_obs 100.0 _refine.ls_R_factor_obs 0.194 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.194 _refine.ls_R_factor_R_free 0.234 _refine.ls_R_factor_R_free_error 0.006 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.2 _refine.ls_number_reflns_R_free 1350 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 46.0 _refine.aniso_B[1][1] 0.52 _refine.aniso_B[2][2] 0.52 _refine.aniso_B[3][3] -1.03 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'BULK SOLVENT MODEL USED' _refine.pdbx_starting_model 1FAT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model GROUP _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1LU1 _refine_analyze.Luzzati_coordinate_error_obs 0.32 _refine_analyze.Luzzati_sigma_a_obs 0.49 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.39 _refine_analyze.Luzzati_sigma_a_free 0.56 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1881 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1921 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.011 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.5 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 28.7 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 0.66 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.d_res_high 2.60 _refine_ls_shell.d_res_low 2.69 _refine_ls_shell.number_reflns_R_work 1145 _refine_ls_shell.R_factor_R_work 0.355 _refine_ls_shell.percent_reflns_obs 99.9 _refine_ls_shell.R_factor_R_free 0.382 _refine_ls_shell.R_factor_R_free_error 0.033 _refine_ls_shell.percent_reflns_R_free 10.5 _refine_ls_shell.number_reflns_R_free 134 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM ? 'X-RAY DIFFRACTION' 2 ? ? 'X-RAY DIFFRACTION' # _struct.entry_id 1LU1 _struct.title 'THE STRUCTURE OF THE DOLICHOS BIFLORUS SEED LECTIN IN COMPLEX WITH THE FORSSMAN DISACCHARIDE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1LU1 _struct_keywords.pdbx_keywords LECTIN _struct_keywords.text 'LEGUME LECTINS, FORSSMAN DISACCHARIDE, DOLICHOS BIFLORUS SEED LECTIN, LECTIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 13 ? SER A 15 ? SER A 13 SER A 15 5 ? 3 HELX_P HELX_P2 2 GLY A 102 ? TYR A 104 ? GLY A 102 TYR A 104 5 ? 3 HELX_P HELX_P3 3 ASN A 115 ? ALA A 117 ? ASN A 115 ALA A 117 5 ? 3 HELX_P HELX_P4 4 PRO A 182 ? ARG A 184 ? PRO A 182 ARG A 184 5 ? 3 HELX_P HELX_P5 5 ILE A 196 ? GLU A 199 ? ILE A 196 GLU A 199 1 ? 4 HELX_P HELX_P6 6 LEU A 244 ? ASN A 251 ? LEU A 244 ASN A 251 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B NGA . O3 ? ? ? 1_555 B A2G . C1 ? ? B NGA 1 B A2G 2 1_555 ? ? ? ? ? ? ? 1.441 ? ? metalc1 metalc ? ? A GLU 123 OE2 ? ? ? 1_555 D MN . MN ? ? A GLU 123 A MN 302 1_555 ? ? ? ? ? ? ? 2.419 ? ? metalc2 metalc ? ? A ASP 125 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 125 A CA 301 1_555 ? ? ? ? ? ? ? 2.389 ? ? metalc3 metalc ? ? A ASP 125 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 125 A CA 301 1_555 ? ? ? ? ? ? ? 2.655 ? ? metalc4 metalc ? ? A ASP 125 OD2 ? ? ? 1_555 D MN . MN ? ? A ASP 125 A MN 302 1_555 ? ? ? ? ? ? ? 2.444 ? ? metalc5 metalc ? ? A LEU 127 O ? ? ? 1_555 C CA . CA ? ? A LEU 127 A CA 301 1_555 ? ? ? ? ? ? ? 2.369 ? ? metalc6 metalc ? ? A ASN 129 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 129 A CA 301 1_555 ? ? ? ? ? ? ? 2.103 ? ? metalc7 metalc ? ? A ASP 133 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 133 A CA 301 1_555 ? ? ? ? ? ? ? 2.428 ? ? metalc8 metalc ? ? A ASP 133 OD1 ? ? ? 1_555 D MN . MN ? ? A ASP 133 A MN 302 1_555 ? ? ? ? ? ? ? 2.429 ? ? metalc9 metalc ? ? A HIS 138 NE2 ? ? ? 1_555 D MN . MN ? ? A HIS 138 A MN 302 1_555 ? ? ? ? ? ? ? 2.523 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 84 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 84 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 ASP _struct_mon_prot_cis.pdbx_label_seq_id_2 85 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ASP _struct_mon_prot_cis.pdbx_auth_seq_id_2 85 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.21 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 7 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 2 ? PHE A 8 ? ASN A 2 PHE A 8 A 2 ASP A 223 ? LEU A 233 ? ASP A 223 LEU A 233 A 3 SER A 66 ? LYS A 74 ? SER A 66 LYS A 74 A 4 ASN A 161 ? ASN A 169 ? ASN A 161 ASN A 169 A 5 LEU A 174 ? HIS A 181 ? LEU A 174 HIS A 181 A 6 THR A 186 ? ARG A 193 ? THR A 186 ARG A 193 B 1 PHE A 16 ? GLY A 20 ? PHE A 16 GLY A 20 B 2 LEU A 45 ? TYR A 50 ? LEU A 45 TYR A 50 B 3 VAL A 204 ? THR A 212 ? VAL A 204 THR A 212 B 4 ASP A 85 ? PRO A 93 ? ASP A 85 PRO A 93 B 5 VAL A 120 ? ASP A 125 ? VAL A 120 ASP A 125 B 6 HIS A 138 ? VAL A 143 ? HIS A 138 VAL A 143 B 7 ALA A 150 ? SER A 153 ? ALA A 150 SER A 153 C 1 THR A 23 ? SER A 25 ? THR A 23 SER A 25 C 2 LYS A 28 ? GLN A 30 ? LYS A 28 GLN A 30 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASN A 2 ? O ASN A 2 N LEU A 233 ? N LEU A 233 A 2 3 O ASP A 223 ? O ASP A 223 N LYS A 74 ? N LYS A 74 A 3 4 O TRP A 67 ? O TRP A 67 N TYR A 168 ? N TYR A 168 A 4 5 O GLU A 163 ? O GLU A 163 N VAL A 180 ? N VAL A 180 A 5 6 O LEU A 175 ? O LEU A 175 N GLU A 192 ? N GLU A 192 B 1 2 O ILE A 17 ? O ILE A 17 N PHE A 49 ? N PHE A 49 B 2 3 O GLY A 46 ? O GLY A 46 N ALA A 210 ? N ALA A 210 B 3 4 O SER A 205 ? O SER A 205 N VAL A 92 ? N VAL A 92 B 4 5 O ILE A 87 ? O ILE A 87 N PHE A 124 ? N PHE A 124 B 5 6 O ALA A 121 ? O ALA A 121 N ASP A 142 ? N ASP A 142 B 6 7 O ILE A 139 ? O ILE A 139 N VAL A 152 ? N VAL A 152 C 1 2 O THR A 23 ? O THR A 23 N GLN A 30 ? N GLN A 30 # _database_PDB_matrix.entry_id 1LU1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1LU1 _atom_sites.fract_transf_matrix[1][1] 0.012650 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012650 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003845 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA MN N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 TRP 67 67 67 TRP TRP A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 TRP 132 132 132 TRP TRP A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 HIS 138 138 138 HIS HIS A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 TRP 154 154 154 TRP TRP A . n A 1 155 ASP 155 155 155 ASP ASP A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 ASN 158 158 158 ASN ASN A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 ASN 169 169 169 ASN ASN A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 THR 172 172 172 THR THR A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 HIS 181 181 181 HIS HIS A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 TYR 188 188 188 TYR TYR A . n A 1 189 ILE 189 189 189 ILE ILE A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 SER 191 191 191 SER SER A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 ARG 193 193 193 ARG ARG A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 ASN 198 198 198 ASN ASN A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 PRO 201 201 201 PRO PRO A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 TYR 203 203 203 TYR TYR A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 SER 209 209 209 SER SER A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 THR 211 211 211 THR THR A . n A 1 212 THR 212 212 212 THR THR A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 SER 215 215 215 SER SER A . n A 1 216 GLU 216 216 216 GLU GLU A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 GLU 220 220 220 GLU GLU A . n A 1 221 THR 221 221 221 THR THR A . n A 1 222 HIS 222 222 222 HIS HIS A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 VAL 224 224 224 VAL VAL A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 SER 226 226 226 SER SER A . n A 1 227 TRP 227 227 227 TRP TRP A . n A 1 228 SER 228 228 228 SER SER A . n A 1 229 PHE 229 229 229 PHE PHE A . n A 1 230 ALA 230 230 230 ALA ALA A . n A 1 231 SER 231 231 231 SER SER A . n A 1 232 LYS 232 232 232 LYS LYS A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 PRO 234 234 234 PRO PRO A . n A 1 235 ASP 235 235 235 ASP ASP A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 SER 237 237 237 SER SER A . n A 1 238 THR 238 238 238 THR THR A . n A 1 239 ALA 239 239 239 ALA ALA A . n A 1 240 GLU 240 240 240 GLU GLU A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 LEU 242 242 242 LEU LEU A . n A 1 243 ASP 243 243 243 ASP ASP A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 ALA 245 245 245 ALA ALA A . n A 1 246 SER 246 246 246 SER SER A . n A 1 247 TYR 247 247 247 TYR TYR A . n A 1 248 LEU 248 248 248 LEU LEU A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 ARG 250 250 250 ARG ARG A . n A 1 251 ASN 251 251 251 ASN ASN A . n A 1 252 VAL 252 252 252 VAL VAL A . n A 1 253 LEU 253 253 253 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 301 301 CA CA A . D 4 MN 1 302 302 MN MN A . E 5 ADE 1 601 601 ADE AD2 A . # _pdbx_molecule_features.prd_id PRD_900083 _pdbx_molecule_features.name 'Forssman antigen fragment' _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class Antigen _pdbx_molecule_features.details oligosaccharide # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900083 _pdbx_molecule.asym_id B # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 15_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 260.1100000000 3 'crystal symmetry operation' 10_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 79.0500000000 0.0000000000 -1.0000000000 0.0000000000 79.0500000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 8_666 -y+1,-x+1,-z+1 0.0000000000 -1.0000000000 0.0000000000 79.0500000000 -1.0000000000 0.0000000000 0.0000000000 79.0500000000 0.0000000000 0.0000000000 -1.0000000000 260.1100000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 123 ? A GLU 123 ? 1_555 MN ? D MN . ? A MN 302 ? 1_555 OD2 ? A ASP 125 ? A ASP 125 ? 1_555 77.0 ? 2 OE2 ? A GLU 123 ? A GLU 123 ? 1_555 MN ? D MN . ? A MN 302 ? 1_555 OD1 ? A ASP 133 ? A ASP 133 ? 1_555 155.7 ? 3 OD2 ? A ASP 125 ? A ASP 125 ? 1_555 MN ? D MN . ? A MN 302 ? 1_555 OD1 ? A ASP 133 ? A ASP 133 ? 1_555 81.2 ? 4 OE2 ? A GLU 123 ? A GLU 123 ? 1_555 MN ? D MN . ? A MN 302 ? 1_555 NE2 ? A HIS 138 ? A HIS 138 ? 1_555 80.5 ? 5 OD2 ? A ASP 125 ? A ASP 125 ? 1_555 MN ? D MN . ? A MN 302 ? 1_555 NE2 ? A HIS 138 ? A HIS 138 ? 1_555 77.5 ? 6 OD1 ? A ASP 133 ? A ASP 133 ? 1_555 MN ? D MN . ? A MN 302 ? 1_555 NE2 ? A HIS 138 ? A HIS 138 ? 1_555 84.5 ? 7 OD1 ? A ASP 125 ? A ASP 125 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 OD2 ? A ASP 125 ? A ASP 125 ? 1_555 51.7 ? 8 OD1 ? A ASP 125 ? A ASP 125 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 O ? A LEU 127 ? A LEU 127 ? 1_555 73.6 ? 9 OD2 ? A ASP 125 ? A ASP 125 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 O ? A LEU 127 ? A LEU 127 ? 1_555 104.9 ? 10 OD1 ? A ASP 125 ? A ASP 125 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 OD1 ? A ASN 129 ? A ASN 129 ? 1_555 167.2 ? 11 OD2 ? A ASP 125 ? A ASP 125 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 OD1 ? A ASN 129 ? A ASN 129 ? 1_555 139.4 ? 12 O ? A LEU 127 ? A LEU 127 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 OD1 ? A ASN 129 ? A ASN 129 ? 1_555 95.1 ? 13 OD1 ? A ASP 125 ? A ASP 125 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 OD2 ? A ASP 133 ? A ASP 133 ? 1_555 99.0 ? 14 OD2 ? A ASP 125 ? A ASP 125 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 OD2 ? A ASP 133 ? A ASP 133 ? 1_555 68.0 ? 15 O ? A LEU 127 ? A LEU 127 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 OD2 ? A ASP 133 ? A ASP 133 ? 1_555 76.0 ? 16 OD1 ? A ASN 129 ? A ASN 129 ? 1_555 CA ? C CA . ? A CA 301 ? 1_555 OD2 ? A ASP 133 ? A ASP 133 ? 1_555 83.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-12-09 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2020-07-29 5 'Structure model' 2 1 2023-08-09 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' Advisory 4 4 'Structure model' 'Atomic model' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Structure summary' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Refinement description' 11 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' chem_comp 3 4 'Structure model' entity 4 4 'Structure model' entity_name_com 5 4 'Structure model' pdbx_branch_scheme 6 4 'Structure model' pdbx_chem_comp_identifier 7 4 'Structure model' pdbx_entity_branch 8 4 'Structure model' pdbx_entity_branch_descriptor 9 4 'Structure model' pdbx_entity_branch_link 10 4 'Structure model' pdbx_entity_branch_list 11 4 'Structure model' pdbx_entity_nonpoly 12 4 'Structure model' pdbx_molecule_features 13 4 'Structure model' pdbx_nonpoly_scheme 14 4 'Structure model' pdbx_struct_assembly_gen 15 4 'Structure model' pdbx_struct_conn_angle 16 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 17 4 'Structure model' struct_asym 18 4 'Structure model' struct_conn 19 4 'Structure model' struct_conn_type 20 4 'Structure model' struct_ref_seq_dif 21 4 'Structure model' struct_site 22 4 'Structure model' struct_site_gen 23 5 'Structure model' chem_comp 24 5 'Structure model' database_2 25 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.B_iso_or_equiv' 2 4 'Structure model' '_atom_site.Cartn_x' 3 4 'Structure model' '_atom_site.Cartn_y' 4 4 'Structure model' '_atom_site.Cartn_z' 5 4 'Structure model' '_atom_site.auth_asym_id' 6 4 'Structure model' '_atom_site.auth_atom_id' 7 4 'Structure model' '_atom_site.auth_comp_id' 8 4 'Structure model' '_atom_site.auth_seq_id' 9 4 'Structure model' '_atom_site.label_asym_id' 10 4 'Structure model' '_atom_site.label_atom_id' 11 4 'Structure model' '_atom_site.label_comp_id' 12 4 'Structure model' '_atom_site.label_entity_id' 13 4 'Structure model' '_atom_site.type_symbol' 14 4 'Structure model' '_chem_comp.name' 15 4 'Structure model' '_chem_comp.type' 16 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 24 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 25 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 29 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 30 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 31 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 32 4 'Structure model' '_pdbx_struct_conn_angle.value' 33 4 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.auth_asym_id' 34 4 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.auth_seq_id' 35 4 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.label_seq_id' 36 4 'Structure model' '_struct_conn.conn_type_id' 37 4 'Structure model' '_struct_conn.id' 38 4 'Structure model' '_struct_conn.pdbx_dist_value' 39 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 40 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 41 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 42 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 43 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 44 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 45 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 46 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 47 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 48 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 49 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 50 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 51 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 52 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 53 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 54 4 'Structure model' '_struct_conn_type.id' 55 4 'Structure model' '_struct_ref_seq_dif.details' 56 5 'Structure model' '_chem_comp.pdbx_synonyms' 57 5 'Structure model' '_database_2.pdbx_DOI' 58 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal AMoRE phasing . ? 1 X-PLOR refinement 3.851 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 13 ? ? -25.13 -44.02 2 1 SER A 79 ? ? -29.70 -73.37 3 1 ALA A 84 ? ? 177.08 143.06 4 1 SER A 96 ? ? -23.28 137.42 5 1 ARG A 99 ? ? -108.90 -146.25 6 1 LEU A 105 ? ? 52.03 18.09 7 1 SER A 130 ? ? -34.73 -33.64 8 1 TRP A 132 ? ? -155.56 -2.15 9 1 MET A 136 ? ? -119.30 -167.26 10 1 PRO A 234 ? ? -69.46 -178.70 11 1 THR A 238 ? ? -52.13 106.53 12 1 ASN A 251 ? ? -126.02 -50.92 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 9 ? CD ? A LYS 9 CD 2 1 Y 1 A LYS 9 ? CE ? A LYS 9 CE 3 1 Y 1 A LYS 9 ? NZ ? A LYS 9 NZ 4 1 Y 1 A LYS 28 ? CD ? A LYS 28 CD 5 1 Y 1 A LYS 28 ? CE ? A LYS 28 CE 6 1 Y 1 A LYS 28 ? NZ ? A LYS 28 NZ 7 1 Y 1 A LYS 35 ? CD ? A LYS 35 CD 8 1 Y 1 A LYS 35 ? CE ? A LYS 35 CE 9 1 Y 1 A LYS 35 ? NZ ? A LYS 35 NZ 10 1 Y 1 A GLU 36 ? CG ? A GLU 36 CG 11 1 Y 1 A GLU 36 ? CD ? A GLU 36 CD 12 1 Y 1 A GLU 36 ? OE1 ? A GLU 36 OE1 13 1 Y 1 A GLU 36 ? OE2 ? A GLU 36 OE2 14 1 Y 1 A LYS 59 ? CG ? A LYS 59 CG 15 1 Y 1 A LYS 59 ? CD ? A LYS 59 CD 16 1 Y 1 A LYS 59 ? CE ? A LYS 59 CE 17 1 Y 1 A LYS 59 ? NZ ? A LYS 59 NZ 18 1 Y 1 A LYS 80 ? CG ? A LYS 80 CG 19 1 Y 1 A LYS 80 ? CD ? A LYS 80 CD 20 1 Y 1 A LYS 80 ? CE ? A LYS 80 CE 21 1 Y 1 A LYS 80 ? NZ ? A LYS 80 NZ 22 1 Y 1 A ARG 193 ? NE ? A ARG 193 NE 23 1 Y 1 A ARG 193 ? CZ ? A ARG 193 CZ 24 1 Y 1 A ARG 193 ? NH1 ? A ARG 193 NH1 25 1 Y 1 A ARG 193 ? NH2 ? A ARG 193 NH2 26 1 Y 1 A GLU 240 ? CG ? A GLU 240 CG 27 1 Y 1 A GLU 240 ? CD ? A GLU 240 CD 28 1 Y 1 A GLU 240 ? OE1 ? A GLU 240 OE1 29 1 Y 1 A GLU 240 ? OE2 ? A GLU 240 OE2 30 1 Y 1 A ARG 250 ? CG ? A ARG 250 CG 31 1 Y 1 A ARG 250 ? CD ? A ARG 250 CD 32 1 Y 1 A ARG 250 ? NE ? A ARG 250 NE 33 1 Y 1 A ARG 250 ? CZ ? A ARG 250 CZ 34 1 Y 1 A ARG 250 ? NH1 ? A ARG 250 NH1 35 1 Y 1 A ARG 250 ? NH2 ? A ARG 250 NH2 36 1 N 1 B NGA 1 ? O6 ? B NGA 1 O6 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NGA 1 B NGA 1 ? NGA 2 n B 2 A2G 2 B A2G 2 ? NGA 1 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier A2G 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGalpNAca A2G 'COMMON NAME' GMML 1.0 N-acetyl-a-D-galactopyranosamine A2G 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-GalpNAc A2G 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GalNAc NGA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGalpNAcb NGA 'COMMON NAME' GMML 1.0 N-acetyl-b-D-galactopyranosamine NGA 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GalpNAc NGA 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GalNAc # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGalpNAca1-3DGalpNAcb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,2,1/[a2112h-1b_1-5_2*NCC/3=O][a2112h-1a_1-5_2*NCC/3=O]/1-2/a3-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-FucpNAc]{[(3+1)][a-D-GalpNAc]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 A2G _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 NGA _pdbx_entity_branch_link.atom_id_2 O3 _pdbx_entity_branch_link.leaving_atom_id_2 HO3 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NGA 1 n 2 A2G 2 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CALCIUM ION' CA 4 'MANGANESE (II) ION' MN 5 ADENINE ADE # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1FAT _pdbx_initial_refinement_model.details ? #