data_1LUN # _entry.id 1LUN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1LUN pdb_00001lun 10.2210/pdb1lun/pdb RCSB RCSB016287 ? ? WWPDB D_1000016287 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1LUI 'NMR Structure of the Itk SH2 domain, Pro287cis, 20 low energy structures' unspecified PDB 1LUK 'NMR Structure of the Itk SH2 domain, Pro287cis, energy minimized average structure' unspecified PDB 1LUM 'NMR Structure of the Itk SH2 domain, Pro287trans, 20 low energy structures' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LUN _pdbx_database_status.recvd_initial_deposition_date 2002-05-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mallis, R.J.' 1 'Brazin, K.N.' 2 'Fulton, D.B.' 3 'Andreotti, A.H.' 4 # _citation.id primary _citation.title ;Structural characterization of a proline-driven conformational switch within the Itk SH2 domain ; _citation.journal_abbrev Nat.Struct.Biol. _citation.journal_volume 9 _citation.page_first 900 _citation.page_last 905 _citation.year 2002 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12402030 _citation.pdbx_database_id_DOI 10.1038/nsb864 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mallis, R.J.' 1 ? primary 'Brazin, K.N.' 2 ? primary 'Fulton, D.B.' 3 ? primary 'Andreotti, A.H.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Tyrosine-protein kinase ITK/TSK' _entity.formula_weight 12558.251 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.1.112 _entity.pdbx_mutation ? _entity.pdbx_fragment 'src homology 2 (SH2) domain (residues 238-344)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Interleukin-2 tyrosine kinase, T-cell-specific kinase, IL-2-inducible T-cell kinase, Kinase EMT, Kinase TLK ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(ACE)NNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENPCIKHYHIKETNDSPKRYYV AEKYVFDSIPLLIQYHQYNGGGLVTRLRYPVCG(NH2) ; _entity_poly.pdbx_seq_one_letter_code_can ;XNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENPCIKHYHIKETNDSPKRYYVAEKY VFDSIPLLIQYHQYNGGGLVTRLRYPVCGX ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 ASN n 1 3 ASN n 1 4 LEU n 1 5 GLU n 1 6 THR n 1 7 TYR n 1 8 GLU n 1 9 TRP n 1 10 TYR n 1 11 ASN n 1 12 LYS n 1 13 SER n 1 14 ILE n 1 15 SER n 1 16 ARG n 1 17 ASP n 1 18 LYS n 1 19 ALA n 1 20 GLU n 1 21 LYS n 1 22 LEU n 1 23 LEU n 1 24 LEU n 1 25 ASP n 1 26 THR n 1 27 GLY n 1 28 LYS n 1 29 GLU n 1 30 GLY n 1 31 ALA n 1 32 PHE n 1 33 MET n 1 34 VAL n 1 35 ARG n 1 36 ASP n 1 37 SER n 1 38 ARG n 1 39 THR n 1 40 PRO n 1 41 GLY n 1 42 THR n 1 43 TYR n 1 44 THR n 1 45 VAL n 1 46 SER n 1 47 VAL n 1 48 PHE n 1 49 THR n 1 50 LYS n 1 51 ALA n 1 52 ILE n 1 53 ILE n 1 54 SER n 1 55 GLU n 1 56 ASN n 1 57 PRO n 1 58 CYS n 1 59 ILE n 1 60 LYS n 1 61 HIS n 1 62 TYR n 1 63 HIS n 1 64 ILE n 1 65 LYS n 1 66 GLU n 1 67 THR n 1 68 ASN n 1 69 ASP n 1 70 SER n 1 71 PRO n 1 72 LYS n 1 73 ARG n 1 74 TYR n 1 75 TYR n 1 76 VAL n 1 77 ALA n 1 78 GLU n 1 79 LYS n 1 80 TYR n 1 81 VAL n 1 82 PHE n 1 83 ASP n 1 84 SER n 1 85 ILE n 1 86 PRO n 1 87 LEU n 1 88 LEU n 1 89 ILE n 1 90 GLN n 1 91 TYR n 1 92 HIS n 1 93 GLN n 1 94 TYR n 1 95 ASN n 1 96 GLY n 1 97 GLY n 1 98 GLY n 1 99 LEU n 1 100 VAL n 1 101 THR n 1 102 ARG n 1 103 LEU n 1 104 ARG n 1 105 TYR n 1 106 PRO n 1 107 VAL n 1 108 CYS n 1 109 GLY n 1 110 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ITK_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENPCIKHYHIKETNDSPKRYYVAEKYV FDSIPLLIQYHQYNGGGLVTRLRYPVC ; _struct_ref.pdbx_align_begin 238 _struct_ref.pdbx_db_accession Q03526 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1LUN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q03526 _struct_ref_seq.db_align_beg 238 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 344 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 110 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1LUN _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 109 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q03526 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'cloning artifact' _struct_ref_seq_dif.pdbx_auth_seq_num 111 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 2 3 1 DQF-COSY 3 4 1 '2D NOESY' 3 5 1 '2D TOCSY' 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 125mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1 mM Itk SH2, U-15N,13C, 125mM phosphate buffer, pH 7.4' '90% H2O/10% D2O' 2 '1 mM Itk SH2, U-15N, 125mM phosphate buffer, pH 7.4' '90% H2O/10% D2O' 3 '1 mM Itk SH2, 125mM phosphate buffer, pH 7.4' '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1LUN _pdbx_nmr_refine.method 'distance geometry and simulated annealing' _pdbx_nmr_refine.details ;The structures are based on 2323 NOE-derived distance constraints, 58 phi/psi dihedral angle restraints,9 chi dihedral angle restraints and 30 distance restraints from hydrogen bonds ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1LUN _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1LUN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR ? ? 1 processing NMRPipe ? ? 2 'data analysis' NMRView 4.1.3 'Johnson & Blevins' 3 refinement CNS 1.0 Brunger 4 # _exptl.entry_id 1LUN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1LUN _struct.title 'NMR Structure of the Itk SH2 domain, Pro287trans, energy minimized average structure' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1LUN _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'cis/trans isomerization, interleukin-2 tyrosine kinase, Itk, t-cell specific kinase, tsk, src homology 2, SH2, proline, TRANSFERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 15 ? GLY A 27 ? SER A 17 GLY A 29 1 ? 13 HELX_P HELX_P2 2 SER A 84 ? TYR A 94 ? SER A 86 TYR A 96 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A ASN 2 N ? ? A ACE 3 A ASN 4 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A GLY 109 C ? ? ? 1_555 A NH2 110 N ? ? A GLY 111 A NH2 112 1_555 ? ? ? ? ? ? ? 1.327 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 70 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 72 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 71 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 73 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.06 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 59 ? HIS A 63 ? ILE A 61 HIS A 65 A 2 TYR A 43 ? PHE A 48 ? TYR A 45 PHE A 50 A 3 ALA A 31 ? ASP A 36 ? ALA A 33 ASP A 38 A 4 TYR A 105 ? PRO A 106 ? TYR A 107 PRO A 108 B 1 LYS A 65 ? GLU A 66 ? LYS A 67 GLU A 68 B 2 TYR A 74 ? TYR A 75 ? TYR A 76 TYR A 77 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 62 ? O TYR A 64 N VAL A 45 ? N VAL A 47 A 2 3 O THR A 44 ? O THR A 46 N ARG A 35 ? N ARG A 37 A 3 4 N PHE A 32 ? N PHE A 34 O TYR A 105 ? O TYR A 107 B 1 2 N LYS A 65 ? N LYS A 67 O TYR A 75 ? O TYR A 77 # _struct_site.id AC2 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NH2 _struct_site.pdbx_auth_seq_id 112 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 112' # _struct_site_gen.id 1 _struct_site_gen.site_id AC2 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id GLY _struct_site_gen.label_asym_id A _struct_site_gen.label_seq_id 109 _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id GLY _struct_site_gen.auth_asym_id A _struct_site_gen.auth_seq_id 111 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # _database_PDB_matrix.entry_id 1LUN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1LUN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 3 3 ACE ACE A . n A 1 2 ASN 2 4 4 ASN ASN A . n A 1 3 ASN 3 5 5 ASN ASN A . n A 1 4 LEU 4 6 6 LEU LEU A . n A 1 5 GLU 5 7 7 GLU GLU A . n A 1 6 THR 6 8 8 THR THR A . n A 1 7 TYR 7 9 9 TYR TYR A . n A 1 8 GLU 8 10 10 GLU GLU A . n A 1 9 TRP 9 11 11 TRP TRP A . n A 1 10 TYR 10 12 12 TYR TYR A . n A 1 11 ASN 11 13 13 ASN ASN A . n A 1 12 LYS 12 14 14 LYS LYS A . n A 1 13 SER 13 15 15 SER SER A . n A 1 14 ILE 14 16 16 ILE ILE A . n A 1 15 SER 15 17 17 SER SER A . n A 1 16 ARG 16 18 18 ARG ARG A . n A 1 17 ASP 17 19 19 ASP ASP A . n A 1 18 LYS 18 20 20 LYS LYS A . n A 1 19 ALA 19 21 21 ALA ALA A . n A 1 20 GLU 20 22 22 GLU GLU A . n A 1 21 LYS 21 23 23 LYS LYS A . n A 1 22 LEU 22 24 24 LEU LEU A . n A 1 23 LEU 23 25 25 LEU LEU A . n A 1 24 LEU 24 26 26 LEU LEU A . n A 1 25 ASP 25 27 27 ASP ASP A . n A 1 26 THR 26 28 28 THR THR A . n A 1 27 GLY 27 29 29 GLY GLY A . n A 1 28 LYS 28 30 30 LYS LYS A . n A 1 29 GLU 29 31 31 GLU GLU A . n A 1 30 GLY 30 32 32 GLY GLY A . n A 1 31 ALA 31 33 33 ALA ALA A . n A 1 32 PHE 32 34 34 PHE PHE A . n A 1 33 MET 33 35 35 MET MET A . n A 1 34 VAL 34 36 36 VAL VAL A . n A 1 35 ARG 35 37 37 ARG ARG A . n A 1 36 ASP 36 38 38 ASP ASP A . n A 1 37 SER 37 39 39 SER SER A . n A 1 38 ARG 38 40 40 ARG ARG A . n A 1 39 THR 39 41 41 THR THR A . n A 1 40 PRO 40 42 42 PRO PRO A . n A 1 41 GLY 41 43 43 GLY GLY A . n A 1 42 THR 42 44 44 THR THR A . n A 1 43 TYR 43 45 45 TYR TYR A . n A 1 44 THR 44 46 46 THR THR A . n A 1 45 VAL 45 47 47 VAL VAL A . n A 1 46 SER 46 48 48 SER SER A . n A 1 47 VAL 47 49 49 VAL VAL A . n A 1 48 PHE 48 50 50 PHE PHE A . n A 1 49 THR 49 51 51 THR THR A . n A 1 50 LYS 50 52 52 LYS LYS A . n A 1 51 ALA 51 53 53 ALA ALA A . n A 1 52 ILE 52 54 54 ILE ILE A . n A 1 53 ILE 53 55 55 ILE ILE A . n A 1 54 SER 54 56 56 SER SER A . n A 1 55 GLU 55 57 57 GLU GLU A . n A 1 56 ASN 56 58 58 ASN ASN A . n A 1 57 PRO 57 59 59 PRO PRO A . n A 1 58 CYS 58 60 60 CYS CYS A . n A 1 59 ILE 59 61 61 ILE ILE A . n A 1 60 LYS 60 62 62 LYS LYS A . n A 1 61 HIS 61 63 63 HIS HIS A . n A 1 62 TYR 62 64 64 TYR TYR A . n A 1 63 HIS 63 65 65 HIS HIS A . n A 1 64 ILE 64 66 66 ILE ILE A . n A 1 65 LYS 65 67 67 LYS LYS A . n A 1 66 GLU 66 68 68 GLU GLU A . n A 1 67 THR 67 69 69 THR THR A . n A 1 68 ASN 68 70 70 ASN ASN A . n A 1 69 ASP 69 71 71 ASP ASP A . n A 1 70 SER 70 72 72 SER SER A . n A 1 71 PRO 71 73 73 PRO PRO A . n A 1 72 LYS 72 74 74 LYS LYS A . n A 1 73 ARG 73 75 75 ARG ARG A . n A 1 74 TYR 74 76 76 TYR TYR A . n A 1 75 TYR 75 77 77 TYR TYR A . n A 1 76 VAL 76 78 78 VAL VAL A . n A 1 77 ALA 77 79 79 ALA ALA A . n A 1 78 GLU 78 80 80 GLU GLU A . n A 1 79 LYS 79 81 81 LYS LYS A . n A 1 80 TYR 80 82 82 TYR TYR A . n A 1 81 VAL 81 83 83 VAL VAL A . n A 1 82 PHE 82 84 84 PHE PHE A . n A 1 83 ASP 83 85 85 ASP ASP A . n A 1 84 SER 84 86 86 SER SER A . n A 1 85 ILE 85 87 87 ILE ILE A . n A 1 86 PRO 86 88 88 PRO PRO A . n A 1 87 LEU 87 89 89 LEU LEU A . n A 1 88 LEU 88 90 90 LEU LEU A . n A 1 89 ILE 89 91 91 ILE ILE A . n A 1 90 GLN 90 92 92 GLN GLN A . n A 1 91 TYR 91 93 93 TYR TYR A . n A 1 92 HIS 92 94 94 HIS HIS A . n A 1 93 GLN 93 95 95 GLN GLN A . n A 1 94 TYR 94 96 96 TYR TYR A . n A 1 95 ASN 95 97 97 ASN ASN A . n A 1 96 GLY 96 98 98 GLY GLY A . n A 1 97 GLY 97 99 99 GLY GLY A . n A 1 98 GLY 98 100 100 GLY GLY A . n A 1 99 LEU 99 101 101 LEU LEU A . n A 1 100 VAL 100 102 102 VAL VAL A . n A 1 101 THR 101 103 103 THR THR A . n A 1 102 ARG 102 104 104 ARG ARG A . n A 1 103 LEU 103 105 105 LEU LEU A . n A 1 104 ARG 104 106 106 ARG ARG A . n A 1 105 TYR 105 107 107 TYR TYR A . n A 1 106 PRO 106 108 108 PRO PRO A . n A 1 107 VAL 107 109 109 VAL VAL A . n A 1 108 CYS 108 110 110 CYS CYS A . n A 1 109 GLY 109 111 111 GLY GLY A . n A 1 110 NH2 110 112 111 NH2 GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-11-27 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PHE 34 ? ? H A VAL 109 ? ? 1.23 2 1 O A VAL 47 ? ? H A TYR 64 ? ? 1.30 3 1 O A ILE 87 ? ? H A ILE 91 ? ? 1.32 4 1 H A LYS 67 ? ? O A TYR 77 ? ? 1.32 5 1 H A TYR 76 ? ? O A PHE 84 ? ? 1.35 6 1 O A PRO 88 ? ? H A GLN 92 ? ? 1.35 7 1 HZ1 A LYS 81 ? ? OH A TYR 93 ? ? 1.39 8 1 O A ARG 37 ? ? H A THR 46 ? ? 1.41 9 1 O A ILE 54 ? ? H A GLU 57 ? ? 1.42 10 1 O A ILE 91 ? ? H A GLN 95 ? ? 1.46 11 1 O A TYR 45 ? ? HD1 A HIS 65 ? ? 1.48 12 1 O A ALA 33 ? ? H A PHE 50 ? ? 1.48 13 1 O A TRP 11 ? ? H A VAL 36 ? ? 1.49 14 1 O A LYS 67 ? ? HA A TYR 76 ? ? 1.49 15 1 H A ARG 75 ? ? O A PHE 84 ? ? 1.49 16 1 O A MET 35 ? ? H A SER 48 ? ? 1.50 17 1 O A TYR 76 ? ? H A PHE 84 ? ? 1.50 18 1 OD1 A ASP 71 ? ? H A SER 72 ? ? 1.52 19 1 H A ARG 37 ? ? O A THR 46 ? ? 1.52 20 1 H A VAL 49 ? ? O A LYS 62 ? ? 1.53 21 1 O A VAL 49 ? ? H A LYS 62 ? ? 1.53 22 1 H A VAL 47 ? ? O A TYR 64 ? ? 1.54 23 1 O A TYR 45 ? ? H A ILE 66 ? ? 1.54 24 1 HH11 A ARG 37 ? ? OG1 A THR 46 ? ? 1.54 25 1 H A PHE 34 ? ? O A TYR 107 ? ? 1.54 26 1 H A THR 69 ? ? O A ARG 75 ? ? 1.54 27 1 H A MET 35 ? ? O A SER 48 ? ? 1.55 28 1 O A GLU 22 ? ? H A LEU 26 ? ? 1.55 29 1 O A LYS 20 ? ? H A LEU 24 ? ? 1.56 30 1 O A ALA 21 ? ? H A LEU 25 ? ? 1.56 31 1 H A ALA 33 ? ? O A PHE 50 ? ? 1.56 32 1 O A LEU 89 ? ? H A TYR 93 ? ? 1.57 33 1 O A THR 69 ? ? H A ASP 71 ? ? 1.57 34 1 O A ILE 87 ? ? HG12 A ILE 91 ? ? 1.60 35 1 O A PHE 34 ? ? N A VAL 109 ? ? 2.00 36 1 OG1 A THR 44 ? ? O A ILE 66 ? ? 2.04 37 1 O A THR 69 ? ? N A ASP 71 ? ? 2.07 38 1 O A LEU 6 ? ? N A THR 8 ? ? 2.13 39 1 N A THR 69 ? ? O A ARG 75 ? ? 2.14 40 1 O A ILE 87 ? ? N A ILE 91 ? ? 2.15 41 1 N A VAL 47 ? ? O A TYR 64 ? ? 2.16 42 1 N A LYS 67 ? ? O A TYR 77 ? ? 2.17 43 1 O A HIS 94 ? ? O A ARG 104 ? ? 2.17 44 1 O A GLU 10 ? ? O A VAL 109 ? ? 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 5 ? ? -21.25 139.76 2 1 GLU A 7 ? ? -18.44 74.00 3 1 THR A 8 ? ? 176.57 -11.62 4 1 SER A 15 ? ? 54.92 1.78 5 1 SER A 39 ? ? -117.81 -110.25 6 1 ARG A 40 ? ? -174.92 -21.83 7 1 THR A 41 ? ? -46.17 -161.59 8 1 PRO A 42 ? ? -41.85 -1.11 9 1 ALA A 53 ? ? 150.81 166.90 10 1 ILE A 54 ? ? -175.02 -98.92 11 1 ILE A 55 ? ? 23.71 -110.81 12 1 GLU A 57 ? ? 119.23 170.86 13 1 ASN A 58 ? ? 138.22 -25.38 14 1 ASN A 70 ? ? -40.33 68.35 15 1 ASP A 71 ? ? -90.87 -152.42 16 1 LYS A 74 ? ? 4.81 79.85 17 1 ALA A 79 ? ? 163.62 43.09 18 1 GLU A 80 ? ? 36.03 29.05 19 1 LYS A 81 ? ? -123.69 -169.55 20 1 TYR A 82 ? ? -12.73 108.85 21 1 SER A 86 ? ? -175.28 143.24 22 1 TYR A 96 ? ? -105.01 -108.94 23 1 ASN A 97 ? ? -2.22 -116.28 24 1 LEU A 101 ? ? 51.22 151.39 25 1 VAL A 102 ? ? -20.46 -45.09 26 1 THR A 103 ? ? -169.92 46.78 27 1 LEU A 105 ? ? 42.20 85.48 28 1 TYR A 107 ? ? -165.23 93.29 29 1 PRO A 108 ? ? -52.99 109.58 #