data_1LV1 # _entry.id 1LV1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1LV1 pdb_00001lv1 10.2210/pdb1lv1/pdb RCSB RCSB016300 ? ? WWPDB D_1000016300 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1G6L _pdbx_database_related.details '1G6L contains the tethered HIV-1 protease carrying the single mutation C95M on one subunit only.' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LV1 _pdbx_database_status.recvd_initial_deposition_date 2002-05-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kumar, M.' 1 'Kannan, K.K.' 2 'Hosur, M.V.' 3 'Bhavesh, N.S.' 4 'Chatterjee, A.' 5 'Mittal, R.' 6 'Hosur, R.V.' 7 # _citation.id primary _citation.title 'Effects of remote mutation on the autolysis of HIV-1 PR: X-ray and NMR investigations.' _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 294 _citation.page_first 395 _citation.page_last 401 _citation.year 2002 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 0006-291X _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12051725 _citation.pdbx_database_id_DOI '10.1016/S0006-291X(02)00482-5' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kumar, M.' 1 ? primary 'Kannan, K.K.' 2 ? primary 'Hosur, M.V.' 3 ? primary 'Bhavesh, N.S.' 4 ? primary 'Chatterjee, A.' 5 ? primary 'Mittal, R.' 6 ? primary 'Hosur, R.V.' 7 ? # _cell.entry_id 1LV1 _cell.length_a 63.060 _cell.length_b 63.060 _cell.length_c 83.420 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1LV1 _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HIV-1 protease' 21902.760 1 3.4.23.16 C95M/C1095A ? 'Tethered dimer linked by GGSSG' 2 water nat water 18.015 55 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT PVNIIGRNLLTQIGMTLNFGGSSGPQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKV RQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF ; _entity_poly.pdbx_seq_one_letter_code_can ;PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT PVNIIGRNLLTQIGMTLNFGGSSGPQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKV RQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 GLN n 1 3 VAL n 1 4 THR n 1 5 LEU n 1 6 TRP n 1 7 GLN n 1 8 ARG n 1 9 PRO n 1 10 LEU n 1 11 VAL n 1 12 THR n 1 13 ILE n 1 14 LYS n 1 15 ILE n 1 16 GLY n 1 17 GLY n 1 18 GLN n 1 19 LEU n 1 20 LYS n 1 21 GLU n 1 22 ALA n 1 23 LEU n 1 24 LEU n 1 25 ASP n 1 26 THR n 1 27 GLY n 1 28 ALA n 1 29 ASP n 1 30 ASP n 1 31 THR n 1 32 VAL n 1 33 LEU n 1 34 GLU n 1 35 GLU n 1 36 MET n 1 37 SER n 1 38 LEU n 1 39 PRO n 1 40 GLY n 1 41 ARG n 1 42 TRP n 1 43 LYS n 1 44 PRO n 1 45 LYS n 1 46 MET n 1 47 ILE n 1 48 GLY n 1 49 GLY n 1 50 ILE n 1 51 GLY n 1 52 GLY n 1 53 PHE n 1 54 ILE n 1 55 LYS n 1 56 VAL n 1 57 ARG n 1 58 GLN n 1 59 TYR n 1 60 ASP n 1 61 GLN n 1 62 ILE n 1 63 LEU n 1 64 ILE n 1 65 GLU n 1 66 ILE n 1 67 CYS n 1 68 GLY n 1 69 HIS n 1 70 LYS n 1 71 ALA n 1 72 ILE n 1 73 GLY n 1 74 THR n 1 75 VAL n 1 76 LEU n 1 77 VAL n 1 78 GLY n 1 79 PRO n 1 80 THR n 1 81 PRO n 1 82 VAL n 1 83 ASN n 1 84 ILE n 1 85 ILE n 1 86 GLY n 1 87 ARG n 1 88 ASN n 1 89 LEU n 1 90 LEU n 1 91 THR n 1 92 GLN n 1 93 ILE n 1 94 GLY n 1 95 MET n 1 96 THR n 1 97 LEU n 1 98 ASN n 1 99 PHE n 1 100 GLY n 1 101 GLY n 1 102 SER n 1 103 SER n 1 104 GLY n 1 105 PRO n 1 106 GLN n 1 107 VAL n 1 108 THR n 1 109 LEU n 1 110 TRP n 1 111 GLN n 1 112 ARG n 1 113 PRO n 1 114 LEU n 1 115 VAL n 1 116 THR n 1 117 ILE n 1 118 LYS n 1 119 ILE n 1 120 GLY n 1 121 GLY n 1 122 GLN n 1 123 LEU n 1 124 LYS n 1 125 GLU n 1 126 ALA n 1 127 LEU n 1 128 LEU n 1 129 ASP n 1 130 THR n 1 131 GLY n 1 132 ALA n 1 133 ASP n 1 134 ASP n 1 135 THR n 1 136 VAL n 1 137 LEU n 1 138 GLU n 1 139 GLU n 1 140 MET n 1 141 SER n 1 142 LEU n 1 143 PRO n 1 144 GLY n 1 145 ARG n 1 146 TRP n 1 147 LYS n 1 148 PRO n 1 149 LYS n 1 150 MET n 1 151 ILE n 1 152 GLY n 1 153 GLY n 1 154 ILE n 1 155 GLY n 1 156 GLY n 1 157 PHE n 1 158 ILE n 1 159 LYS n 1 160 VAL n 1 161 ARG n 1 162 GLN n 1 163 TYR n 1 164 ASP n 1 165 GLN n 1 166 ILE n 1 167 LEU n 1 168 ILE n 1 169 GLU n 1 170 ILE n 1 171 CYS n 1 172 GLY n 1 173 HIS n 1 174 LYS n 1 175 ALA n 1 176 ILE n 1 177 GLY n 1 178 THR n 1 179 VAL n 1 180 LEU n 1 181 VAL n 1 182 GLY n 1 183 PRO n 1 184 THR n 1 185 PRO n 1 186 VAL n 1 187 ASN n 1 188 ILE n 1 189 ILE n 1 190 GLY n 1 191 ARG n 1 192 ASN n 1 193 LEU n 1 194 LEU n 1 195 THR n 1 196 GLN n 1 197 ILE n 1 198 GLY n 1 199 ALA n 1 200 THR n 1 201 LEU n 1 202 ASN n 1 203 PHE n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? 1 99 ? Lentivirus ? ? ? ? ? ? ? 'Human immunodeficiency virus 1' 11676 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET11a ? ? 1 2 sample ? 105 203 ? Lentivirus ? ? ? ? ? ? ? 'Human immunodeficiency virus 1' 11676 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET11a ? ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POL_HV1H2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P04585 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1LV1 A 1 ? 99 ? P04585 57 ? 155 ? 1 99 2 1 1LV1 A 105 ? 203 ? P04585 57 ? 155 ? 1001 1099 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1LV1 MET A 95 ? UNP P04585 CYS 151 'engineered mutation' 95 1 1 1LV1 GLY A 100 ? UNP P04585 ? ? linker 996 2 1 1LV1 GLY A 101 ? UNP P04585 ? ? linker 997 3 1 1LV1 SER A 102 ? UNP P04585 ? ? linker 998 4 1 1LV1 SER A 103 ? UNP P04585 ? ? linker 999 5 1 1LV1 GLY A 104 ? UNP P04585 ? ? linker 1000 6 1 1LV1 ALA A 199 ? UNP P04585 CYS 151 'engineered mutation' 1095 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1LV1 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 43.70 _exptl_crystal.density_Matthews 2.18 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.2 _exptl_crystal_grow.pdbx_details '5% saturated ammonium sulfate, 200mM sodium phosphate, pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 295K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 295 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IIC' _diffrn_detector.pdbx_collection_date 2001-01-01 _diffrn_detector.details 'Totally reflecting MSC mirrors' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'YALE MIRRORS' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200HB' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 1LV1 _reflns.observed_criterion_sigma_I 1.0 _reflns.observed_criterion_sigma_F 2.0 _reflns.d_resolution_low 15.0 _reflns.d_resolution_high 2.1 _reflns.number_obs 11676 _reflns.number_all 51200 _reflns.percent_possible_obs 93.1 _reflns.pdbx_Rmerge_I_obs 0.0710000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 10.1 _reflns.B_iso_Wilson_estimate 34.7 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.2 _reflns_shell.percent_possible_all 47.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1LV1 _refine.ls_number_reflns_obs 8047 _refine.ls_number_reflns_all 11676 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.0 _refine.pdbx_data_cutoff_high_absF 319647.95 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.ls_d_res_low 14.75 _refine.ls_d_res_high 2.10 _refine.ls_percent_reflns_obs 73.3 _refine.ls_R_factor_obs 0.1940000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1940000 _refine.ls_R_factor_R_free 0.2600000 _refine.ls_R_factor_R_free_error 0.013 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.3 _refine.ls_number_reflns_R_free 428 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 39.7 _refine.aniso_B[1][1] 0.95 _refine.aniso_B[2][2] 0.95 _refine.aniso_B[3][3] -1.91 _refine.aniso_B[1][2] 6.10 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.326686 _refine.solvent_model_param_bsol 53.9922 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1LV1 _refine_analyze.Luzzati_coordinate_error_obs 0.25 _refine_analyze.Luzzati_sigma_a_obs 0.27 _refine_analyze.Luzzati_d_res_low_obs 8.0 _refine_analyze.Luzzati_coordinate_error_free 0.33 _refine_analyze.Luzzati_sigma_a_free 0.36 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1513 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 55 _refine_hist.number_atoms_total 1568 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 14.75 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 26.2 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.81 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.49 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.43 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.30 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.38 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 2.10 _refine_ls_shell.d_res_low 2.20 _refine_ls_shell.number_reflns_R_work 610 _refine_ls_shell.R_factor_R_work 0.2910000 _refine_ls_shell.percent_reflns_obs 47.1 _refine_ls_shell.R_factor_R_free 0.3920000 _refine_ls_shell.R_factor_R_free_error 0.072 _refine_ls_shell.percent_reflns_R_free 4.7 _refine_ls_shell.number_reflns_R_free 30 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1LV1 _struct.title 'Crystal Structure Analysis of the non-active site mutant of tethered HIV-1 protease to 2.1A resolution' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1LV1 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'beta-ribbon flap, Hydrolase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 86 ? THR A 91 ? GLY A 86 THR A 91 1 ? 6 HELX_P HELX_P2 2 GLN A 92 ? GLY A 94 ? GLN A 92 GLY A 94 5 ? 3 HELX_P HELX_P3 3 GLY A 190 ? THR A 195 ? GLY A 1086 THR A 1091 1 ? 6 HELX_P HELX_P4 4 GLN A 196 ? GLY A 198 ? GLN A 1092 GLY A 1094 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 8 ? C ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? parallel B 5 6 ? anti-parallel B 6 7 ? parallel B 7 8 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel C 4 5 ? parallel C 5 6 ? anti-parallel C 6 7 ? parallel C 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 2 ? VAL A 3 ? GLN A 2 VAL A 3 A 2 THR A 200 ? ASN A 202 ? THR A 1096 ASN A 1098 A 3 THR A 96 ? ASN A 98 ? THR A 96 ASN A 98 A 4 GLN A 106 ? THR A 108 ? GLN A 1002 THR A 1004 B 1 LYS A 43 ? GLY A 49 ? LYS A 43 GLY A 49 B 2 GLY A 52 ? ILE A 66 ? GLY A 52 ILE A 66 B 3 LEU A 10 ? ILE A 15 ? LEU A 10 ILE A 15 B 4 GLN A 18 ? LEU A 24 ? GLN A 18 LEU A 24 B 5 ILE A 84 ? ILE A 85 ? ILE A 84 ILE A 85 B 6 VAL A 32 ? LEU A 33 ? VAL A 32 LEU A 33 B 7 HIS A 69 ? VAL A 77 ? HIS A 69 VAL A 77 B 8 GLY A 52 ? ILE A 66 ? GLY A 52 ILE A 66 C 1 LYS A 147 ? GLY A 153 ? LYS A 1043 GLY A 1049 C 2 GLY A 156 ? ILE A 170 ? GLY A 1052 ILE A 1066 C 3 LEU A 114 ? ILE A 119 ? LEU A 1010 ILE A 1015 C 4 GLN A 122 ? LEU A 128 ? GLN A 1018 LEU A 1024 C 5 ILE A 188 ? ILE A 189 ? ILE A 1084 ILE A 1085 C 6 VAL A 136 ? LEU A 137 ? VAL A 1032 LEU A 1033 C 7 HIS A 173 ? VAL A 181 ? HIS A 1069 VAL A 1077 C 8 GLY A 156 ? ILE A 170 ? GLY A 1052 ILE A 1066 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 3 ? N VAL A 3 O LEU A 201 ? O LEU A 1097 A 2 3 O ASN A 202 ? O ASN A 1098 N THR A 96 ? N THR A 96 A 3 4 O LEU A 97 ? O LEU A 97 N VAL A 107 ? N VAL A 1003 B 1 2 N GLY A 49 ? N GLY A 49 O GLY A 52 ? O GLY A 52 B 2 3 N GLU A 65 ? N GLU A 65 O LYS A 14 ? O LYS A 14 B 3 4 N ILE A 15 ? N ILE A 15 O GLN A 18 ? O GLN A 18 B 4 5 O LEU A 23 ? O LEU A 23 N ILE A 85 ? N ILE A 85 B 5 6 N ILE A 84 ? N ILE A 84 O VAL A 32 ? O VAL A 32 B 6 7 N LEU A 33 ? N LEU A 33 O LEU A 76 ? O LEU A 76 B 7 8 O VAL A 77 ? O VAL A 77 N ARG A 57 ? N ARG A 57 C 1 2 N GLY A 153 ? N GLY A 1049 O GLY A 156 ? O GLY A 1052 C 2 3 N GLU A 169 ? N GLU A 1065 O LYS A 118 ? O LYS A 1014 C 3 4 N ILE A 119 ? N ILE A 1015 O GLN A 122 ? O GLN A 1018 C 4 5 O LEU A 127 ? O LEU A 1023 N ILE A 189 ? N ILE A 1085 C 5 6 N ILE A 188 ? N ILE A 1084 O VAL A 136 ? O VAL A 1032 C 6 7 N LEU A 137 ? N LEU A 1033 O LEU A 180 ? O LEU A 1076 C 7 8 O VAL A 181 ? O VAL A 1077 N ARG A 161 ? N ARG A 1057 # _database_PDB_matrix.entry_id 1LV1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1LV1 _atom_sites.fract_transf_matrix[1][1] 0.015858 _atom_sites.fract_transf_matrix[1][2] 0.009156 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018311 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011988 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 GLY 100 996 ? ? ? A . n A 1 101 GLY 101 997 ? ? ? A . n A 1 102 SER 102 998 ? ? ? A . n A 1 103 SER 103 999 ? ? ? A . n A 1 104 GLY 104 1000 ? ? ? A . n A 1 105 PRO 105 1001 1001 PRO PRO A . n A 1 106 GLN 106 1002 1002 GLN GLN A . n A 1 107 VAL 107 1003 1003 VAL VAL A . n A 1 108 THR 108 1004 1004 THR THR A . n A 1 109 LEU 109 1005 1005 LEU LEU A . n A 1 110 TRP 110 1006 1006 TRP TRP A . n A 1 111 GLN 111 1007 1007 GLN GLN A . n A 1 112 ARG 112 1008 1008 ARG ARG A . n A 1 113 PRO 113 1009 1009 PRO PRO A . n A 1 114 LEU 114 1010 1010 LEU LEU A . n A 1 115 VAL 115 1011 1011 VAL VAL A . n A 1 116 THR 116 1012 1012 THR THR A . n A 1 117 ILE 117 1013 1013 ILE ILE A . n A 1 118 LYS 118 1014 1014 LYS LYS A . n A 1 119 ILE 119 1015 1015 ILE ILE A . n A 1 120 GLY 120 1016 1016 GLY GLY A . n A 1 121 GLY 121 1017 1017 GLY GLY A . n A 1 122 GLN 122 1018 1018 GLN GLN A . n A 1 123 LEU 123 1019 1019 LEU LEU A . n A 1 124 LYS 124 1020 1020 LYS LYS A . n A 1 125 GLU 125 1021 1021 GLU GLU A . n A 1 126 ALA 126 1022 1022 ALA ALA A . n A 1 127 LEU 127 1023 1023 LEU LEU A . n A 1 128 LEU 128 1024 1024 LEU LEU A . n A 1 129 ASP 129 1025 1025 ASP ASP A . n A 1 130 THR 130 1026 1026 THR THR A . n A 1 131 GLY 131 1027 1027 GLY GLY A . n A 1 132 ALA 132 1028 1028 ALA ALA A . n A 1 133 ASP 133 1029 1029 ASP ASP A . n A 1 134 ASP 134 1030 1030 ASP ASP A . n A 1 135 THR 135 1031 1031 THR THR A . n A 1 136 VAL 136 1032 1032 VAL VAL A . n A 1 137 LEU 137 1033 1033 LEU LEU A . n A 1 138 GLU 138 1034 1034 GLU GLU A . n A 1 139 GLU 139 1035 1035 GLU GLU A . n A 1 140 MET 140 1036 1036 MET MET A . n A 1 141 SER 141 1037 1037 SER SER A . n A 1 142 LEU 142 1038 1038 LEU LEU A . n A 1 143 PRO 143 1039 1039 PRO PRO A . n A 1 144 GLY 144 1040 1040 GLY GLY A . n A 1 145 ARG 145 1041 1041 ARG ARG A . n A 1 146 TRP 146 1042 1042 TRP TRP A . n A 1 147 LYS 147 1043 1043 LYS LYS A . n A 1 148 PRO 148 1044 1044 PRO PRO A . n A 1 149 LYS 149 1045 1045 LYS LYS A . n A 1 150 MET 150 1046 1046 MET MET A . n A 1 151 ILE 151 1047 1047 ILE ILE A . n A 1 152 GLY 152 1048 1048 GLY GLY A . n A 1 153 GLY 153 1049 1049 GLY GLY A . n A 1 154 ILE 154 1050 1050 ILE ILE A . n A 1 155 GLY 155 1051 1051 GLY GLY A . n A 1 156 GLY 156 1052 1052 GLY GLY A . n A 1 157 PHE 157 1053 1053 PHE PHE A . n A 1 158 ILE 158 1054 1054 ILE ILE A . n A 1 159 LYS 159 1055 1055 LYS LYS A . n A 1 160 VAL 160 1056 1056 VAL VAL A . n A 1 161 ARG 161 1057 1057 ARG ARG A . n A 1 162 GLN 162 1058 1058 GLN GLN A . n A 1 163 TYR 163 1059 1059 TYR TYR A . n A 1 164 ASP 164 1060 1060 ASP ASP A . n A 1 165 GLN 165 1061 1061 GLN GLN A . n A 1 166 ILE 166 1062 1062 ILE ILE A . n A 1 167 LEU 167 1063 1063 LEU LEU A . n A 1 168 ILE 168 1064 1064 ILE ILE A . n A 1 169 GLU 169 1065 1065 GLU GLU A . n A 1 170 ILE 170 1066 1066 ILE ILE A . n A 1 171 CYS 171 1067 1067 CYS CYS A . n A 1 172 GLY 172 1068 1068 GLY GLY A . n A 1 173 HIS 173 1069 1069 HIS HIS A . n A 1 174 LYS 174 1070 1070 LYS LYS A . n A 1 175 ALA 175 1071 1071 ALA ALA A . n A 1 176 ILE 176 1072 1072 ILE ILE A . n A 1 177 GLY 177 1073 1073 GLY GLY A . n A 1 178 THR 178 1074 1074 THR THR A . n A 1 179 VAL 179 1075 1075 VAL VAL A . n A 1 180 LEU 180 1076 1076 LEU LEU A . n A 1 181 VAL 181 1077 1077 VAL VAL A . n A 1 182 GLY 182 1078 1078 GLY GLY A . n A 1 183 PRO 183 1079 1079 PRO PRO A . n A 1 184 THR 184 1080 1080 THR THR A . n A 1 185 PRO 185 1081 1081 PRO PRO A . n A 1 186 VAL 186 1082 1082 VAL VAL A . n A 1 187 ASN 187 1083 1083 ASN ASN A . n A 1 188 ILE 188 1084 1084 ILE ILE A . n A 1 189 ILE 189 1085 1085 ILE ILE A . n A 1 190 GLY 190 1086 1086 GLY GLY A . n A 1 191 ARG 191 1087 1087 ARG ARG A . n A 1 192 ASN 192 1088 1088 ASN ASN A . n A 1 193 LEU 193 1089 1089 LEU LEU A . n A 1 194 LEU 194 1090 1090 LEU LEU A . n A 1 195 THR 195 1091 1091 THR THR A . n A 1 196 GLN 196 1092 1092 GLN GLN A . n A 1 197 ILE 197 1093 1093 ILE ILE A . n A 1 198 GLY 198 1094 1094 GLY GLY A . n A 1 199 ALA 199 1095 1095 ALA ALA A . n A 1 200 THR 200 1096 1096 THR THR A . n A 1 201 LEU 201 1097 1097 LEU LEU A . n A 1 202 ASN 202 1098 1098 ASN ASN A . n A 1 203 PHE 203 1099 1099 PHE PHE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 401 HOH WAT A . B 2 HOH 2 402 402 HOH WAT A . B 2 HOH 3 403 403 HOH WAT A . B 2 HOH 4 404 404 HOH WAT A . B 2 HOH 5 405 405 HOH WAT A . B 2 HOH 6 406 406 HOH WAT A . B 2 HOH 7 407 407 HOH WAT A . B 2 HOH 8 408 408 HOH WAT A . B 2 HOH 9 409 409 HOH WAT A . B 2 HOH 10 410 410 HOH WAT A . B 2 HOH 11 411 411 HOH WAT A . B 2 HOH 12 412 412 HOH WAT A . B 2 HOH 13 413 413 HOH WAT A . B 2 HOH 14 414 414 HOH WAT A . B 2 HOH 15 415 415 HOH WAT A . B 2 HOH 16 416 416 HOH WAT A . B 2 HOH 17 417 417 HOH WAT A . B 2 HOH 18 418 418 HOH WAT A . B 2 HOH 19 419 419 HOH WAT A . B 2 HOH 20 420 420 HOH WAT A . B 2 HOH 21 421 421 HOH WAT A . B 2 HOH 22 422 422 HOH WAT A . B 2 HOH 23 423 423 HOH WAT A . B 2 HOH 24 424 424 HOH WAT A . B 2 HOH 25 425 425 HOH WAT A . B 2 HOH 26 426 426 HOH WAT A . B 2 HOH 27 427 427 HOH WAT A . B 2 HOH 28 428 428 HOH WAT A . B 2 HOH 29 429 429 HOH WAT A . B 2 HOH 30 430 430 HOH WAT A . B 2 HOH 31 431 431 HOH WAT A . B 2 HOH 32 432 432 HOH WAT A . B 2 HOH 33 433 433 HOH WAT A . B 2 HOH 34 434 434 HOH WAT A . B 2 HOH 35 435 435 HOH WAT A . B 2 HOH 36 436 436 HOH WAT A . B 2 HOH 37 437 437 HOH WAT A . B 2 HOH 38 438 438 HOH WAT A . B 2 HOH 39 439 439 HOH WAT A . B 2 HOH 40 440 440 HOH WAT A . B 2 HOH 41 441 441 HOH WAT A . B 2 HOH 42 442 442 HOH WAT A . B 2 HOH 43 443 443 HOH WAT A . B 2 HOH 44 444 444 HOH WAT A . B 2 HOH 45 445 445 HOH WAT A . B 2 HOH 46 446 446 HOH WAT A . B 2 HOH 47 447 447 HOH WAT A . B 2 HOH 48 448 448 HOH WAT A . B 2 HOH 49 449 449 HOH WAT A . B 2 HOH 50 450 450 HOH WAT A . B 2 HOH 51 451 451 HOH WAT A . B 2 HOH 52 452 452 HOH WAT A . B 2 HOH 53 453 453 HOH WAT A . B 2 HOH 54 454 454 HOH WAT A . B 2 HOH 55 455 455 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-06-19 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-08-16 5 'Structure model' 1 4 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' 4 4 'Structure model' 'Source and taxonomy' 5 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity_src_gen 2 4 'Structure model' software 3 5 'Structure model' database_2 4 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement . ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 CNS phasing . ? 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id CYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 1067 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 33.94 _pdbx_validate_torsion.psi 43.63 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 996 ? A GLY 100 2 1 Y 1 A GLY 997 ? A GLY 101 3 1 Y 1 A SER 998 ? A SER 102 4 1 Y 1 A SER 999 ? A SER 103 5 1 Y 1 A GLY 1000 ? A GLY 104 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #