data_1LV9 # _entry.id 1LV9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1LV9 pdb_00001lv9 10.2210/pdb1lv9/pdb RCSB RCSB016308 ? ? WWPDB D_1000016308 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-09-18 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LV9 _pdbx_database_status.recvd_initial_deposition_date 2002-05-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Booth, V.' 1 'Keizer, D.W.' 2 'Kamphuis, M.B.' 3 'Clark-Lewis, I.' 4 'Sykes, B.D.' 5 # _citation.id primary _citation.title 'The CXCR3 binding chemokine IP-10/CXCL10: structure and receptor interactions.' _citation.journal_abbrev Biochemistry _citation.journal_volume 41 _citation.page_first 10418 _citation.page_last 10425 _citation.year 2002 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12173928 _citation.pdbx_database_id_DOI 10.1021/bi026020q # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Booth, V.' 1 ? primary 'Keizer, D.W.' 2 ? primary 'Kamphuis, M.B.' 3 ? primary 'Clark-Lewis, I.' 4 ? primary 'Sykes, B.D.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Small inducible cytokine B10' _entity.formula_weight 8651.370 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CXCL10, Interferon-gamma induced protein, Gamma-IP10, IP-10' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;VPLSRTVRCTCISISNQPVNPRSLEK(MLE)EIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRS P ; _entity_poly.pdbx_seq_one_letter_code_can VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 PRO n 1 3 LEU n 1 4 SER n 1 5 ARG n 1 6 THR n 1 7 VAL n 1 8 ARG n 1 9 CYS n 1 10 THR n 1 11 CYS n 1 12 ILE n 1 13 SER n 1 14 ILE n 1 15 SER n 1 16 ASN n 1 17 GLN n 1 18 PRO n 1 19 VAL n 1 20 ASN n 1 21 PRO n 1 22 ARG n 1 23 SER n 1 24 LEU n 1 25 GLU n 1 26 LYS n 1 27 MLE n 1 28 GLU n 1 29 ILE n 1 30 ILE n 1 31 PRO n 1 32 ALA n 1 33 SER n 1 34 GLN n 1 35 PHE n 1 36 CYS n 1 37 PRO n 1 38 ARG n 1 39 VAL n 1 40 GLU n 1 41 ILE n 1 42 ILE n 1 43 ALA n 1 44 THR n 1 45 MET n 1 46 LYS n 1 47 LYS n 1 48 LYS n 1 49 GLY n 1 50 GLU n 1 51 LYS n 1 52 ARG n 1 53 CYS n 1 54 LEU n 1 55 ASN n 1 56 PRO n 1 57 GLU n 1 58 SER n 1 59 LYS n 1 60 ALA n 1 61 ILE n 1 62 LYS n 1 63 ASN n 1 64 LEU n 1 65 LEU n 1 66 LYS n 1 67 ALA n 1 68 VAL n 1 69 SER n 1 70 LYS n 1 71 GLU n 1 72 MET n 1 73 SER n 1 74 LYS n 1 75 ARG n 1 76 SER n 1 77 PRO n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;The sequence of the protein is naturally found in Homo sapiens. It was synthesized by stepwise solid phase methods using t-butoxycarbonyl protection chemistry. ; # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MLE 'L-peptide linking' n N-METHYLLEUCINE ? 'C7 H15 N O2' 145.199 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 ARG 5 5 ? ? ? A . n A 1 6 THR 6 6 ? ? ? A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 MLE 27 27 27 MLE LEM A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLU 71 71 ? ? ? A . n A 1 72 MET 72 72 ? ? ? A . n A 1 73 SER 73 73 ? ? ? A . n A 1 74 LYS 74 74 ? ? ? A . n A 1 75 ARG 75 75 ? ? ? A . n A 1 76 SER 76 76 ? ? ? A . n A 1 77 PRO 77 77 ? ? ? A . n # _exptl.entry_id 1LV9 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1LV9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1LV9 _struct.title 'CXCR3 Binding Chemokine IP-10/CXCL10' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1LV9 _struct_keywords.pdbx_keywords CYTOKINE _struct_keywords.text 'chemokine, CYTOKINE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SCYBA_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_db_accession P02778 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1LV9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02778 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 98 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 77 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1LV9 _struct_ref_seq_dif.mon_id MLE _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 27 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P02778 _struct_ref_seq_dif.db_mon_id LEU _struct_ref_seq_dif.pdbx_seq_db_seq_num 48 _struct_ref_seq_dif.details 'modified residue' _struct_ref_seq_dif.pdbx_auth_seq_num 27 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 60 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 70 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 60 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 70 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 9 A CYS 36 1_555 ? ? ? ? ? ? ? 2.143 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 53 SG ? ? A CYS 11 A CYS 53 1_555 ? ? ? ? ? ? ? 2.140 ? ? covale1 covale both ? A LYS 26 C ? ? ? 1_555 A MLE 27 N ? ? A LYS 26 A MLE 27 1_555 ? ? ? ? ? ? ? 1.343 ? ? covale2 covale both ? A MLE 27 C ? ? ? 1_555 A GLU 28 N ? ? A MLE 27 A GLU 28 1_555 ? ? ? ? ? ? ? 1.329 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MLE A 27 ? . . . . MLE A 27 ? 1_555 . . . . . . . LEU 1 MLE Methylation 'Named protein modification' 2 CYS A 9 ? CYS A 36 ? CYS A 9 ? 1_555 CYS A 36 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 11 ? CYS A 53 ? CYS A 11 ? 1_555 CYS A 53 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ILE 14 A . ? ILE 14 A SER 15 A ? SER 15 A 10 1.38 2 VAL 19 A . ? VAL 19 A ASN 20 A ? ASN 20 A 10 9.84 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 26 ? PRO A 31 ? LYS A 26 PRO A 31 A 2 VAL A 39 ? MET A 45 ? VAL A 39 MET A 45 A 3 GLU A 50 ? LEU A 54 ? GLU A 50 LEU A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 30 ? N ILE A 30 O GLU A 40 ? O GLU A 40 A 2 3 N ALA A 43 ? N ALA A 43 O ARG A 52 ? O ARG A 52 # _pdbx_entry_details.entry_id 1LV9 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH21 A ARG 38 ? ? OE1 A GLU 57 ? ? 1.56 2 1 O A ASN 63 ? ? H A ALA 67 ? ? 1.58 3 2 O A ASN 63 ? ? H A ALA 67 ? ? 1.59 4 5 O A PRO 37 ? ? HH11 A ARG 38 ? ? 1.55 5 5 O A ALA 43 ? ? H A ARG 52 ? ? 1.58 6 5 O A ASN 63 ? ? H A ALA 67 ? ? 1.59 7 8 O A ASN 63 ? ? H A ALA 67 ? ? 1.58 8 9 O A ASN 63 ? ? H A ALA 67 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 18 ? ? -38.15 -27.86 2 1 PRO A 21 ? ? -40.76 -16.88 3 1 GLU A 25 ? ? -146.39 -74.03 4 1 LYS A 26 ? ? -104.87 79.51 5 1 SER A 33 ? ? -160.27 -58.22 6 1 ARG A 38 ? ? -160.71 -162.71 7 1 LYS A 47 ? ? 176.14 -35.36 8 1 LYS A 48 ? ? -162.51 27.53 9 1 PRO A 56 ? ? -23.73 93.66 10 1 SER A 58 ? ? -160.75 -164.40 11 1 LYS A 59 ? ? -87.67 -80.78 12 2 PRO A 18 ? ? -38.42 -28.64 13 2 PRO A 21 ? ? -41.01 -15.52 14 2 GLU A 25 ? ? -146.18 -76.34 15 2 SER A 33 ? ? -157.18 -67.06 16 2 ARG A 38 ? ? -160.53 -160.47 17 2 LYS A 47 ? ? 172.49 -33.72 18 2 LYS A 48 ? ? -159.73 24.83 19 2 ASN A 55 ? ? -150.98 77.09 20 2 PRO A 56 ? ? -25.86 96.73 21 2 GLU A 57 ? ? -140.49 53.90 22 2 LYS A 59 ? ? -87.02 -81.07 23 3 CYS A 9 ? ? -79.64 -165.88 24 3 PRO A 18 ? ? -38.02 -27.95 25 3 ASN A 20 ? ? -68.07 -175.72 26 3 GLU A 25 ? ? -145.43 -74.41 27 3 SER A 33 ? ? -161.72 -48.52 28 3 PHE A 35 ? ? -132.06 -52.09 29 3 PRO A 37 ? ? -63.74 68.58 30 3 ARG A 38 ? ? -147.07 -159.01 31 3 LYS A 47 ? ? 175.67 -36.12 32 3 LYS A 48 ? ? -162.54 21.97 33 3 PRO A 56 ? ? -25.89 96.72 34 3 GLU A 57 ? ? -141.80 55.44 35 3 SER A 58 ? ? -160.69 -165.73 36 3 LYS A 59 ? ? -85.82 -80.88 37 4 PRO A 18 ? ? -39.61 -27.73 38 4 ASN A 20 ? ? -68.85 -174.01 39 4 PRO A 21 ? ? -57.70 -9.78 40 4 GLU A 25 ? ? -144.08 -71.81 41 4 LYS A 26 ? ? -106.92 78.41 42 4 SER A 33 ? ? -161.05 -57.37 43 4 PHE A 35 ? ? -125.10 -54.59 44 4 LYS A 47 ? ? 172.63 -33.86 45 4 LYS A 48 ? ? -155.36 23.26 46 4 ASN A 55 ? ? -151.79 75.56 47 4 PRO A 56 ? ? -21.39 96.71 48 4 SER A 58 ? ? -160.39 -166.75 49 4 LYS A 59 ? ? -86.37 -80.53 50 5 ARG A 8 ? ? -160.92 115.20 51 5 CYS A 9 ? ? -79.99 -160.89 52 5 SER A 15 ? ? -89.78 -97.02 53 5 PRO A 21 ? ? -43.10 -14.97 54 5 ARG A 22 ? ? -38.44 -35.28 55 5 GLU A 25 ? ? -145.33 -76.70 56 5 LYS A 26 ? ? -103.52 79.98 57 5 SER A 33 ? ? -160.29 -60.50 58 5 PHE A 35 ? ? -121.99 -57.66 59 5 PRO A 37 ? ? -54.89 75.40 60 5 ARG A 38 ? ? -160.00 -156.39 61 5 LYS A 47 ? ? 174.33 -33.69 62 5 LYS A 48 ? ? -160.22 25.56 63 5 PRO A 56 ? ? -29.71 92.19 64 5 SER A 58 ? ? -160.80 -166.44 65 5 LYS A 59 ? ? -87.19 -80.12 66 5 SER A 69 ? ? -84.63 -80.36 67 6 SER A 15 ? ? -95.57 -88.47 68 6 VAL A 19 ? ? -103.60 67.38 69 6 ASN A 20 ? ? -61.09 -171.52 70 6 PRO A 21 ? ? -55.99 -8.37 71 6 GLU A 25 ? ? -143.11 -75.23 72 6 LYS A 26 ? ? -105.59 79.82 73 6 SER A 33 ? ? -161.79 -50.55 74 6 PHE A 35 ? ? -130.11 -46.07 75 6 ARG A 38 ? ? -157.87 -158.89 76 6 LYS A 47 ? ? 172.10 -33.72 77 6 LYS A 48 ? ? -161.57 25.80 78 6 PRO A 56 ? ? -20.20 84.36 79 6 LYS A 59 ? ? -90.06 -73.51 80 7 SER A 15 ? ? -94.96 -89.42 81 7 ASN A 16 ? ? 44.89 28.67 82 7 ASN A 20 ? ? -57.05 173.31 83 7 PRO A 21 ? ? -45.69 -12.20 84 7 GLU A 25 ? ? -138.30 -76.71 85 7 SER A 33 ? ? -160.66 -58.32 86 7 CYS A 36 ? ? -153.12 85.84 87 7 PRO A 37 ? ? -47.69 80.71 88 7 ARG A 38 ? ? -162.90 -158.37 89 7 LYS A 47 ? ? 159.17 -39.64 90 7 LYS A 48 ? ? -147.00 13.50 91 7 PRO A 56 ? ? -22.60 93.33 92 7 SER A 58 ? ? -160.41 -166.48 93 7 LYS A 59 ? ? -84.34 -81.12 94 8 CYS A 9 ? ? -79.23 -72.94 95 8 THR A 10 ? ? 178.49 -63.94 96 8 SER A 15 ? ? -98.70 -92.37 97 8 ASN A 16 ? ? 42.76 29.57 98 8 VAL A 19 ? ? -95.37 52.96 99 8 ASN A 20 ? ? -56.08 -176.28 100 8 PRO A 21 ? ? -56.80 -9.37 101 8 GLU A 25 ? ? -144.69 -75.21 102 8 LYS A 26 ? ? -105.21 79.64 103 8 SER A 33 ? ? -162.95 -82.63 104 8 CYS A 36 ? ? -154.46 87.27 105 8 PRO A 37 ? ? -51.66 75.55 106 8 ARG A 38 ? ? -164.61 -162.57 107 8 LYS A 47 ? ? 163.49 -30.31 108 8 LYS A 48 ? ? -160.50 24.73 109 8 PRO A 56 ? ? -23.90 96.76 110 8 SER A 58 ? ? -160.59 -160.55 111 8 LYS A 59 ? ? -90.21 -76.70 112 9 SER A 15 ? ? -95.67 48.33 113 9 PRO A 21 ? ? -41.75 -15.65 114 9 ARG A 22 ? ? -39.67 -34.60 115 9 GLU A 25 ? ? -149.38 -75.13 116 9 LYS A 26 ? ? -102.07 78.90 117 9 SER A 33 ? ? -157.63 -68.84 118 9 GLN A 34 ? ? -44.22 -78.29 119 9 ARG A 38 ? ? -163.78 -159.91 120 9 LYS A 47 ? ? 163.15 -34.96 121 9 LYS A 48 ? ? -159.72 23.84 122 9 PRO A 56 ? ? -26.02 84.08 123 9 LYS A 59 ? ? -86.30 -77.32 124 9 SER A 69 ? ? -79.28 -77.20 125 10 ARG A 8 ? ? -160.41 111.30 126 10 CYS A 9 ? ? -78.69 -159.01 127 10 ILE A 12 ? ? -110.05 -73.87 128 10 SER A 13 ? ? -75.33 -90.76 129 10 ILE A 14 ? ? -150.03 -65.87 130 10 PRO A 18 ? ? -37.97 -29.64 131 10 ASN A 20 ? ? 62.08 162.22 132 10 GLU A 25 ? ? -136.57 -76.28 133 10 SER A 33 ? ? -160.31 -45.18 134 10 GLN A 34 ? ? -49.61 -72.68 135 10 LYS A 47 ? ? 173.91 -35.74 136 10 LYS A 48 ? ? -159.19 25.54 137 10 PRO A 56 ? ? -26.71 87.93 138 10 SER A 58 ? ? -79.68 -161.60 139 10 LYS A 59 ? ? -90.23 -76.78 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id MLE _pdbx_struct_mod_residue.label_seq_id 27 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id MLE _pdbx_struct_mod_residue.auth_seq_id 27 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LEU _pdbx_struct_mod_residue.details N-METHYLLEUCINE # _pdbx_nmr_ensemble.entry_id 1LV9 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with favorable non-bond energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1LV9 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2 mM NMeLeu 27 IP-10 (no isotope labelling), 1 mM sodium azide, 1 mM DSS, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D TOCSY' 2 1 1 '2D NOESY' 3 1 1 DQF-COSY # _pdbx_nmr_refine.entry_id 1LV9 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR ? collection Varian 1 NMRPipe ? processing 'Delaglio et al' 2 NMRView 4.1.2 'data analysis' Johnson 3 X-PLOR 3.851 refinement Brunger 4 ARIA 1999 refinement Nilges 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 1 ? A VAL 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A ARG 5 ? A ARG 5 6 1 Y 1 A THR 6 ? A THR 6 7 1 Y 1 A GLU 71 ? A GLU 71 8 1 Y 1 A MET 72 ? A MET 72 9 1 Y 1 A SER 73 ? A SER 73 10 1 Y 1 A LYS 74 ? A LYS 74 11 1 Y 1 A ARG 75 ? A ARG 75 12 1 Y 1 A SER 76 ? A SER 76 13 1 Y 1 A PRO 77 ? A PRO 77 14 2 Y 1 A VAL 1 ? A VAL 1 15 2 Y 1 A PRO 2 ? A PRO 2 16 2 Y 1 A LEU 3 ? A LEU 3 17 2 Y 1 A SER 4 ? A SER 4 18 2 Y 1 A ARG 5 ? A ARG 5 19 2 Y 1 A THR 6 ? A THR 6 20 2 Y 1 A GLU 71 ? A GLU 71 21 2 Y 1 A MET 72 ? A MET 72 22 2 Y 1 A SER 73 ? A SER 73 23 2 Y 1 A LYS 74 ? A LYS 74 24 2 Y 1 A ARG 75 ? A ARG 75 25 2 Y 1 A SER 76 ? A SER 76 26 2 Y 1 A PRO 77 ? A PRO 77 27 3 Y 1 A VAL 1 ? A VAL 1 28 3 Y 1 A PRO 2 ? A PRO 2 29 3 Y 1 A LEU 3 ? A LEU 3 30 3 Y 1 A SER 4 ? A SER 4 31 3 Y 1 A ARG 5 ? A ARG 5 32 3 Y 1 A THR 6 ? A THR 6 33 3 Y 1 A GLU 71 ? A GLU 71 34 3 Y 1 A MET 72 ? A MET 72 35 3 Y 1 A SER 73 ? A SER 73 36 3 Y 1 A LYS 74 ? A LYS 74 37 3 Y 1 A ARG 75 ? A ARG 75 38 3 Y 1 A SER 76 ? A SER 76 39 3 Y 1 A PRO 77 ? A PRO 77 40 4 Y 1 A VAL 1 ? A VAL 1 41 4 Y 1 A PRO 2 ? A PRO 2 42 4 Y 1 A LEU 3 ? A LEU 3 43 4 Y 1 A SER 4 ? A SER 4 44 4 Y 1 A ARG 5 ? A ARG 5 45 4 Y 1 A THR 6 ? A THR 6 46 4 Y 1 A GLU 71 ? A GLU 71 47 4 Y 1 A MET 72 ? A MET 72 48 4 Y 1 A SER 73 ? A SER 73 49 4 Y 1 A LYS 74 ? A LYS 74 50 4 Y 1 A ARG 75 ? A ARG 75 51 4 Y 1 A SER 76 ? A SER 76 52 4 Y 1 A PRO 77 ? A PRO 77 53 5 Y 1 A VAL 1 ? A VAL 1 54 5 Y 1 A PRO 2 ? A PRO 2 55 5 Y 1 A LEU 3 ? A LEU 3 56 5 Y 1 A SER 4 ? A SER 4 57 5 Y 1 A ARG 5 ? A ARG 5 58 5 Y 1 A THR 6 ? A THR 6 59 5 Y 1 A GLU 71 ? A GLU 71 60 5 Y 1 A MET 72 ? A MET 72 61 5 Y 1 A SER 73 ? A SER 73 62 5 Y 1 A LYS 74 ? A LYS 74 63 5 Y 1 A ARG 75 ? A ARG 75 64 5 Y 1 A SER 76 ? A SER 76 65 5 Y 1 A PRO 77 ? A PRO 77 66 6 Y 1 A VAL 1 ? A VAL 1 67 6 Y 1 A PRO 2 ? A PRO 2 68 6 Y 1 A LEU 3 ? A LEU 3 69 6 Y 1 A SER 4 ? A SER 4 70 6 Y 1 A ARG 5 ? A ARG 5 71 6 Y 1 A THR 6 ? A THR 6 72 6 Y 1 A GLU 71 ? A GLU 71 73 6 Y 1 A MET 72 ? A MET 72 74 6 Y 1 A SER 73 ? A SER 73 75 6 Y 1 A LYS 74 ? A LYS 74 76 6 Y 1 A ARG 75 ? A ARG 75 77 6 Y 1 A SER 76 ? A SER 76 78 6 Y 1 A PRO 77 ? A PRO 77 79 7 Y 1 A VAL 1 ? A VAL 1 80 7 Y 1 A PRO 2 ? A PRO 2 81 7 Y 1 A LEU 3 ? A LEU 3 82 7 Y 1 A SER 4 ? A SER 4 83 7 Y 1 A ARG 5 ? A ARG 5 84 7 Y 1 A THR 6 ? A THR 6 85 7 Y 1 A GLU 71 ? A GLU 71 86 7 Y 1 A MET 72 ? A MET 72 87 7 Y 1 A SER 73 ? A SER 73 88 7 Y 1 A LYS 74 ? A LYS 74 89 7 Y 1 A ARG 75 ? A ARG 75 90 7 Y 1 A SER 76 ? A SER 76 91 7 Y 1 A PRO 77 ? A PRO 77 92 8 Y 1 A VAL 1 ? A VAL 1 93 8 Y 1 A PRO 2 ? A PRO 2 94 8 Y 1 A LEU 3 ? A LEU 3 95 8 Y 1 A SER 4 ? A SER 4 96 8 Y 1 A ARG 5 ? A ARG 5 97 8 Y 1 A THR 6 ? A THR 6 98 8 Y 1 A GLU 71 ? A GLU 71 99 8 Y 1 A MET 72 ? A MET 72 100 8 Y 1 A SER 73 ? A SER 73 101 8 Y 1 A LYS 74 ? A LYS 74 102 8 Y 1 A ARG 75 ? A ARG 75 103 8 Y 1 A SER 76 ? A SER 76 104 8 Y 1 A PRO 77 ? A PRO 77 105 9 Y 1 A VAL 1 ? A VAL 1 106 9 Y 1 A PRO 2 ? A PRO 2 107 9 Y 1 A LEU 3 ? A LEU 3 108 9 Y 1 A SER 4 ? A SER 4 109 9 Y 1 A ARG 5 ? A ARG 5 110 9 Y 1 A THR 6 ? A THR 6 111 9 Y 1 A GLU 71 ? A GLU 71 112 9 Y 1 A MET 72 ? A MET 72 113 9 Y 1 A SER 73 ? A SER 73 114 9 Y 1 A LYS 74 ? A LYS 74 115 9 Y 1 A ARG 75 ? A ARG 75 116 9 Y 1 A SER 76 ? A SER 76 117 9 Y 1 A PRO 77 ? A PRO 77 118 10 Y 1 A VAL 1 ? A VAL 1 119 10 Y 1 A PRO 2 ? A PRO 2 120 10 Y 1 A LEU 3 ? A LEU 3 121 10 Y 1 A SER 4 ? A SER 4 122 10 Y 1 A ARG 5 ? A ARG 5 123 10 Y 1 A THR 6 ? A THR 6 124 10 Y 1 A GLU 71 ? A GLU 71 125 10 Y 1 A MET 72 ? A MET 72 126 10 Y 1 A SER 73 ? A SER 73 127 10 Y 1 A LYS 74 ? A LYS 74 128 10 Y 1 A ARG 75 ? A ARG 75 129 10 Y 1 A SER 76 ? A SER 76 130 10 Y 1 A PRO 77 ? A PRO 77 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 ILE N N N N 121 ILE CA C N S 122 ILE C C N N 123 ILE O O N N 124 ILE CB C N S 125 ILE CG1 C N N 126 ILE CG2 C N N 127 ILE CD1 C N N 128 ILE OXT O N N 129 ILE H H N N 130 ILE H2 H N N 131 ILE HA H N N 132 ILE HB H N N 133 ILE HG12 H N N 134 ILE HG13 H N N 135 ILE HG21 H N N 136 ILE HG22 H N N 137 ILE HG23 H N N 138 ILE HD11 H N N 139 ILE HD12 H N N 140 ILE HD13 H N N 141 ILE HXT H N N 142 LEU N N N N 143 LEU CA C N S 144 LEU C C N N 145 LEU O O N N 146 LEU CB C N N 147 LEU CG C N N 148 LEU CD1 C N N 149 LEU CD2 C N N 150 LEU OXT O N N 151 LEU H H N N 152 LEU H2 H N N 153 LEU HA H N N 154 LEU HB2 H N N 155 LEU HB3 H N N 156 LEU HG H N N 157 LEU HD11 H N N 158 LEU HD12 H N N 159 LEU HD13 H N N 160 LEU HD21 H N N 161 LEU HD22 H N N 162 LEU HD23 H N N 163 LEU HXT H N N 164 LYS N N N N 165 LYS CA C N S 166 LYS C C N N 167 LYS O O N N 168 LYS CB C N N 169 LYS CG C N N 170 LYS CD C N N 171 LYS CE C N N 172 LYS NZ N N N 173 LYS OXT O N N 174 LYS H H N N 175 LYS H2 H N N 176 LYS HA H N N 177 LYS HB2 H N N 178 LYS HB3 H N N 179 LYS HG2 H N N 180 LYS HG3 H N N 181 LYS HD2 H N N 182 LYS HD3 H N N 183 LYS HE2 H N N 184 LYS HE3 H N N 185 LYS HZ1 H N N 186 LYS HZ2 H N N 187 LYS HZ3 H N N 188 LYS HXT H N N 189 MET N N N N 190 MET CA C N S 191 MET C C N N 192 MET O O N N 193 MET CB C N N 194 MET CG C N N 195 MET SD S N N 196 MET CE C N N 197 MET OXT O N N 198 MET H H N N 199 MET H2 H N N 200 MET HA H N N 201 MET HB2 H N N 202 MET HB3 H N N 203 MET HG2 H N N 204 MET HG3 H N N 205 MET HE1 H N N 206 MET HE2 H N N 207 MET HE3 H N N 208 MET HXT H N N 209 MLE N N N N 210 MLE CN C N N 211 MLE CA C N S 212 MLE CB C N N 213 MLE CG C N N 214 MLE CD1 C N N 215 MLE CD2 C N N 216 MLE C C N N 217 MLE O O N N 218 MLE OXT O N N 219 MLE H H N N 220 MLE HN1 H N N 221 MLE HN2 H N N 222 MLE HN3 H N N 223 MLE HA H N N 224 MLE HB2 H N N 225 MLE HB3 H N N 226 MLE HG H N N 227 MLE HD11 H N N 228 MLE HD12 H N N 229 MLE HD13 H N N 230 MLE HD21 H N N 231 MLE HD22 H N N 232 MLE HD23 H N N 233 MLE HXT H N N 234 PHE N N N N 235 PHE CA C N S 236 PHE C C N N 237 PHE O O N N 238 PHE CB C N N 239 PHE CG C Y N 240 PHE CD1 C Y N 241 PHE CD2 C Y N 242 PHE CE1 C Y N 243 PHE CE2 C Y N 244 PHE CZ C Y N 245 PHE OXT O N N 246 PHE H H N N 247 PHE H2 H N N 248 PHE HA H N N 249 PHE HB2 H N N 250 PHE HB3 H N N 251 PHE HD1 H N N 252 PHE HD2 H N N 253 PHE HE1 H N N 254 PHE HE2 H N N 255 PHE HZ H N N 256 PHE HXT H N N 257 PRO N N N N 258 PRO CA C N S 259 PRO C C N N 260 PRO O O N N 261 PRO CB C N N 262 PRO CG C N N 263 PRO CD C N N 264 PRO OXT O N N 265 PRO H H N N 266 PRO HA H N N 267 PRO HB2 H N N 268 PRO HB3 H N N 269 PRO HG2 H N N 270 PRO HG3 H N N 271 PRO HD2 H N N 272 PRO HD3 H N N 273 PRO HXT H N N 274 SER N N N N 275 SER CA C N S 276 SER C C N N 277 SER O O N N 278 SER CB C N N 279 SER OG O N N 280 SER OXT O N N 281 SER H H N N 282 SER H2 H N N 283 SER HA H N N 284 SER HB2 H N N 285 SER HB3 H N N 286 SER HG H N N 287 SER HXT H N N 288 THR N N N N 289 THR CA C N S 290 THR C C N N 291 THR O O N N 292 THR CB C N R 293 THR OG1 O N N 294 THR CG2 C N N 295 THR OXT O N N 296 THR H H N N 297 THR H2 H N N 298 THR HA H N N 299 THR HB H N N 300 THR HG1 H N N 301 THR HG21 H N N 302 THR HG22 H N N 303 THR HG23 H N N 304 THR HXT H N N 305 VAL N N N N 306 VAL CA C N S 307 VAL C C N N 308 VAL O O N N 309 VAL CB C N N 310 VAL CG1 C N N 311 VAL CG2 C N N 312 VAL OXT O N N 313 VAL H H N N 314 VAL H2 H N N 315 VAL HA H N N 316 VAL HB H N N 317 VAL HG11 H N N 318 VAL HG12 H N N 319 VAL HG13 H N N 320 VAL HG21 H N N 321 VAL HG22 H N N 322 VAL HG23 H N N 323 VAL HXT H N N 324 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 ILE N CA sing N N 114 ILE N H sing N N 115 ILE N H2 sing N N 116 ILE CA C sing N N 117 ILE CA CB sing N N 118 ILE CA HA sing N N 119 ILE C O doub N N 120 ILE C OXT sing N N 121 ILE CB CG1 sing N N 122 ILE CB CG2 sing N N 123 ILE CB HB sing N N 124 ILE CG1 CD1 sing N N 125 ILE CG1 HG12 sing N N 126 ILE CG1 HG13 sing N N 127 ILE CG2 HG21 sing N N 128 ILE CG2 HG22 sing N N 129 ILE CG2 HG23 sing N N 130 ILE CD1 HD11 sing N N 131 ILE CD1 HD12 sing N N 132 ILE CD1 HD13 sing N N 133 ILE OXT HXT sing N N 134 LEU N CA sing N N 135 LEU N H sing N N 136 LEU N H2 sing N N 137 LEU CA C sing N N 138 LEU CA CB sing N N 139 LEU CA HA sing N N 140 LEU C O doub N N 141 LEU C OXT sing N N 142 LEU CB CG sing N N 143 LEU CB HB2 sing N N 144 LEU CB HB3 sing N N 145 LEU CG CD1 sing N N 146 LEU CG CD2 sing N N 147 LEU CG HG sing N N 148 LEU CD1 HD11 sing N N 149 LEU CD1 HD12 sing N N 150 LEU CD1 HD13 sing N N 151 LEU CD2 HD21 sing N N 152 LEU CD2 HD22 sing N N 153 LEU CD2 HD23 sing N N 154 LEU OXT HXT sing N N 155 LYS N CA sing N N 156 LYS N H sing N N 157 LYS N H2 sing N N 158 LYS CA C sing N N 159 LYS CA CB sing N N 160 LYS CA HA sing N N 161 LYS C O doub N N 162 LYS C OXT sing N N 163 LYS CB CG sing N N 164 LYS CB HB2 sing N N 165 LYS CB HB3 sing N N 166 LYS CG CD sing N N 167 LYS CG HG2 sing N N 168 LYS CG HG3 sing N N 169 LYS CD CE sing N N 170 LYS CD HD2 sing N N 171 LYS CD HD3 sing N N 172 LYS CE NZ sing N N 173 LYS CE HE2 sing N N 174 LYS CE HE3 sing N N 175 LYS NZ HZ1 sing N N 176 LYS NZ HZ2 sing N N 177 LYS NZ HZ3 sing N N 178 LYS OXT HXT sing N N 179 MET N CA sing N N 180 MET N H sing N N 181 MET N H2 sing N N 182 MET CA C sing N N 183 MET CA CB sing N N 184 MET CA HA sing N N 185 MET C O doub N N 186 MET C OXT sing N N 187 MET CB CG sing N N 188 MET CB HB2 sing N N 189 MET CB HB3 sing N N 190 MET CG SD sing N N 191 MET CG HG2 sing N N 192 MET CG HG3 sing N N 193 MET SD CE sing N N 194 MET CE HE1 sing N N 195 MET CE HE2 sing N N 196 MET CE HE3 sing N N 197 MET OXT HXT sing N N 198 MLE N CN sing N N 199 MLE N CA sing N N 200 MLE N H sing N N 201 MLE CN HN1 sing N N 202 MLE CN HN2 sing N N 203 MLE CN HN3 sing N N 204 MLE CA CB sing N N 205 MLE CA C sing N N 206 MLE CA HA sing N N 207 MLE CB CG sing N N 208 MLE CB HB2 sing N N 209 MLE CB HB3 sing N N 210 MLE CG CD1 sing N N 211 MLE CG CD2 sing N N 212 MLE CG HG sing N N 213 MLE CD1 HD11 sing N N 214 MLE CD1 HD12 sing N N 215 MLE CD1 HD13 sing N N 216 MLE CD2 HD21 sing N N 217 MLE CD2 HD22 sing N N 218 MLE CD2 HD23 sing N N 219 MLE C O doub N N 220 MLE C OXT sing N N 221 MLE OXT HXT sing N N 222 PHE N CA sing N N 223 PHE N H sing N N 224 PHE N H2 sing N N 225 PHE CA C sing N N 226 PHE CA CB sing N N 227 PHE CA HA sing N N 228 PHE C O doub N N 229 PHE C OXT sing N N 230 PHE CB CG sing N N 231 PHE CB HB2 sing N N 232 PHE CB HB3 sing N N 233 PHE CG CD1 doub Y N 234 PHE CG CD2 sing Y N 235 PHE CD1 CE1 sing Y N 236 PHE CD1 HD1 sing N N 237 PHE CD2 CE2 doub Y N 238 PHE CD2 HD2 sing N N 239 PHE CE1 CZ doub Y N 240 PHE CE1 HE1 sing N N 241 PHE CE2 CZ sing Y N 242 PHE CE2 HE2 sing N N 243 PHE CZ HZ sing N N 244 PHE OXT HXT sing N N 245 PRO N CA sing N N 246 PRO N CD sing N N 247 PRO N H sing N N 248 PRO CA C sing N N 249 PRO CA CB sing N N 250 PRO CA HA sing N N 251 PRO C O doub N N 252 PRO C OXT sing N N 253 PRO CB CG sing N N 254 PRO CB HB2 sing N N 255 PRO CB HB3 sing N N 256 PRO CG CD sing N N 257 PRO CG HG2 sing N N 258 PRO CG HG3 sing N N 259 PRO CD HD2 sing N N 260 PRO CD HD3 sing N N 261 PRO OXT HXT sing N N 262 SER N CA sing N N 263 SER N H sing N N 264 SER N H2 sing N N 265 SER CA C sing N N 266 SER CA CB sing N N 267 SER CA HA sing N N 268 SER C O doub N N 269 SER C OXT sing N N 270 SER CB OG sing N N 271 SER CB HB2 sing N N 272 SER CB HB3 sing N N 273 SER OG HG sing N N 274 SER OXT HXT sing N N 275 THR N CA sing N N 276 THR N H sing N N 277 THR N H2 sing N N 278 THR CA C sing N N 279 THR CA CB sing N N 280 THR CA HA sing N N 281 THR C O doub N N 282 THR C OXT sing N N 283 THR CB OG1 sing N N 284 THR CB CG2 sing N N 285 THR CB HB sing N N 286 THR OG1 HG1 sing N N 287 THR CG2 HG21 sing N N 288 THR CG2 HG22 sing N N 289 THR CG2 HG23 sing N N 290 THR OXT HXT sing N N 291 VAL N CA sing N N 292 VAL N H sing N N 293 VAL N H2 sing N N 294 VAL CA C sing N N 295 VAL CA CB sing N N 296 VAL CA HA sing N N 297 VAL C O doub N N 298 VAL C OXT sing N N 299 VAL CB CG1 sing N N 300 VAL CB CG2 sing N N 301 VAL CB HB sing N N 302 VAL CG1 HG11 sing N N 303 VAL CG1 HG12 sing N N 304 VAL CG1 HG13 sing N N 305 VAL CG2 HG21 sing N N 306 VAL CG2 HG22 sing N N 307 VAL CG2 HG23 sing N N 308 VAL OXT HXT sing N N 309 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1LV9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_