data_1M33 # _entry.id 1M33 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.313 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1M33 RCSB RCSB016536 WWPDB D_1000016536 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC064 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1M33 _pdbx_database_status.recvd_initial_deposition_date 2002-06-26 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sanishvili, R.' 1 'Savchenko, A.' 2 'Skarina, T.' 3 'Edwards, A.' 4 'Joachimiak, A.' 5 'Yakunin, A.' 6 'Midwest Center for Structural Genomics (MCSG)' 7 # _citation.id primary _citation.title 'Integrating structure, bioinformatics, and enzymology to discover function: BioH, a new carboxylesterase from Escherichia coli.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 278 _citation.page_first 26039 _citation.page_last 26045 _citation.year 2003 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12732651 _citation.pdbx_database_id_DOI 10.1074/jbc.M303867200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sanishvili, R.' 1 ? primary 'Yakunin, A.F.' 2 ? primary 'Laskowski, R.A.' 3 ? primary 'Skarina, T.' 4 ? primary 'Evdokimova, E.' 5 ? primary 'Doherty-Kirby, A.' 6 ? primary 'Lajoie, G.A.' 7 ? primary 'Thornton, J.M.' 8 ? primary 'Arrowsmith, C.H.' 9 ? primary 'Savchenko, A.' 10 ? primary 'Joachimiak, A.' 11 ? primary 'Edwards, A.M.' 12 ? # _cell.entry_id 1M33 _cell.length_a 75.210 _cell.length_b 75.210 _cell.length_c 49.256 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1M33 _symmetry.space_group_name_H-M 'P 43' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 78 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'BioH protein' 28972.488 1 ? ? ? ? 2 non-polymer syn '3-HYDROXY-PROPANOIC ACID' 90.078 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 4 water nat water 18.015 238 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)NNIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLAD(MSE)AEAVLQQA PDKAIWLGWSLGGLVASQIALTHPERVRALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDQQRTVERFLALQT (MSE)GTETARQDARALKKTVLALP(MSE)PEVDVLNGGLEILKTVDLRQPLQNVS(MSE)PFLRLYGYLDGLVPRKVVP (MSE)LDKLWPHSESYIFAKAAHAPFISHPAEFCHLLVALKQRVGS ; _entity_poly.pdbx_seq_one_letter_code_can ;MNNIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAEAVLQQAPDKAIWLG WSLGGLVASQIALTHPERVRALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDQQRTVERFLALQTMGTETARQDARA LKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIFAKAAHAPFIS HPAEFCHLLVALKQRVGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC064 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ASN n 1 3 ASN n 1 4 ILE n 1 5 TRP n 1 6 TRP n 1 7 GLN n 1 8 THR n 1 9 LYS n 1 10 GLY n 1 11 GLN n 1 12 GLY n 1 13 ASN n 1 14 VAL n 1 15 HIS n 1 16 LEU n 1 17 VAL n 1 18 LEU n 1 19 LEU n 1 20 HIS n 1 21 GLY n 1 22 TRP n 1 23 GLY n 1 24 LEU n 1 25 ASN n 1 26 ALA n 1 27 GLU n 1 28 VAL n 1 29 TRP n 1 30 ARG n 1 31 CYS n 1 32 ILE n 1 33 ASP n 1 34 GLU n 1 35 GLU n 1 36 LEU n 1 37 SER n 1 38 SER n 1 39 HIS n 1 40 PHE n 1 41 THR n 1 42 LEU n 1 43 HIS n 1 44 LEU n 1 45 VAL n 1 46 ASP n 1 47 LEU n 1 48 PRO n 1 49 GLY n 1 50 PHE n 1 51 GLY n 1 52 ARG n 1 53 SER n 1 54 ARG n 1 55 GLY n 1 56 PHE n 1 57 GLY n 1 58 ALA n 1 59 LEU n 1 60 SER n 1 61 LEU n 1 62 ALA n 1 63 ASP n 1 64 MSE n 1 65 ALA n 1 66 GLU n 1 67 ALA n 1 68 VAL n 1 69 LEU n 1 70 GLN n 1 71 GLN n 1 72 ALA n 1 73 PRO n 1 74 ASP n 1 75 LYS n 1 76 ALA n 1 77 ILE n 1 78 TRP n 1 79 LEU n 1 80 GLY n 1 81 TRP n 1 82 SER n 1 83 LEU n 1 84 GLY n 1 85 GLY n 1 86 LEU n 1 87 VAL n 1 88 ALA n 1 89 SER n 1 90 GLN n 1 91 ILE n 1 92 ALA n 1 93 LEU n 1 94 THR n 1 95 HIS n 1 96 PRO n 1 97 GLU n 1 98 ARG n 1 99 VAL n 1 100 ARG n 1 101 ALA n 1 102 LEU n 1 103 VAL n 1 104 THR n 1 105 VAL n 1 106 ALA n 1 107 SER n 1 108 SER n 1 109 PRO n 1 110 CYS n 1 111 PHE n 1 112 SER n 1 113 ALA n 1 114 ARG n 1 115 ASP n 1 116 GLU n 1 117 TRP n 1 118 PRO n 1 119 GLY n 1 120 ILE n 1 121 LYS n 1 122 PRO n 1 123 ASP n 1 124 VAL n 1 125 LEU n 1 126 ALA n 1 127 GLY n 1 128 PHE n 1 129 GLN n 1 130 GLN n 1 131 GLN n 1 132 LEU n 1 133 SER n 1 134 ASP n 1 135 ASP n 1 136 GLN n 1 137 GLN n 1 138 ARG n 1 139 THR n 1 140 VAL n 1 141 GLU n 1 142 ARG n 1 143 PHE n 1 144 LEU n 1 145 ALA n 1 146 LEU n 1 147 GLN n 1 148 THR n 1 149 MSE n 1 150 GLY n 1 151 THR n 1 152 GLU n 1 153 THR n 1 154 ALA n 1 155 ARG n 1 156 GLN n 1 157 ASP n 1 158 ALA n 1 159 ARG n 1 160 ALA n 1 161 LEU n 1 162 LYS n 1 163 LYS n 1 164 THR n 1 165 VAL n 1 166 LEU n 1 167 ALA n 1 168 LEU n 1 169 PRO n 1 170 MSE n 1 171 PRO n 1 172 GLU n 1 173 VAL n 1 174 ASP n 1 175 VAL n 1 176 LEU n 1 177 ASN n 1 178 GLY n 1 179 GLY n 1 180 LEU n 1 181 GLU n 1 182 ILE n 1 183 LEU n 1 184 LYS n 1 185 THR n 1 186 VAL n 1 187 ASP n 1 188 LEU n 1 189 ARG n 1 190 GLN n 1 191 PRO n 1 192 LEU n 1 193 GLN n 1 194 ASN n 1 195 VAL n 1 196 SER n 1 197 MSE n 1 198 PRO n 1 199 PHE n 1 200 LEU n 1 201 ARG n 1 202 LEU n 1 203 TYR n 1 204 GLY n 1 205 TYR n 1 206 LEU n 1 207 ASP n 1 208 GLY n 1 209 LEU n 1 210 VAL n 1 211 PRO n 1 212 ARG n 1 213 LYS n 1 214 VAL n 1 215 VAL n 1 216 PRO n 1 217 MSE n 1 218 LEU n 1 219 ASP n 1 220 LYS n 1 221 LEU n 1 222 TRP n 1 223 PRO n 1 224 HIS n 1 225 SER n 1 226 GLU n 1 227 SER n 1 228 TYR n 1 229 ILE n 1 230 PHE n 1 231 ALA n 1 232 LYS n 1 233 ALA n 1 234 ALA n 1 235 HIS n 1 236 ALA n 1 237 PRO n 1 238 PHE n 1 239 ILE n 1 240 SER n 1 241 HIS n 1 242 PRO n 1 243 ALA n 1 244 GLU n 1 245 PHE n 1 246 CYS n 1 247 HIS n 1 248 LEU n 1 249 LEU n 1 250 VAL n 1 251 ALA n 1 252 LEU n 1 253 LYS n 1 254 GLN n 1 255 ARG n 1 256 VAL n 1 257 GLY n 1 258 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene BioH _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BIOH_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNNIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAEAVLQQAPDKAIWLG WSLGGLVASQIALTHPERVQALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARA LKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIFAKAAHAPFIS HPAEFCHLLVALKQRV ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P13001 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1M33 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 256 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P13001 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 256 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 256 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1M33 MSE A 1 ? UNP P13001 MET 1 'MODIFIED RESIDUE' 1 1 1 1M33 MSE A 64 ? UNP P13001 MET 64 'MODIFIED RESIDUE' 64 2 1 1M33 ARG A 100 ? UNP P13001 GLN 100 CONFLICT 100 3 1 1M33 GLN A 136 ? UNP P13001 PHE 136 CONFLICT 136 4 1 1M33 TRP A 81 ? UNP P13001 PHE 143 CONFLICT 81 5 1 1M33 MSE A 149 ? UNP P13001 MET 149 'MODIFIED RESIDUE' 149 6 1 1M33 ARG A 100 ? UNP P13001 LYS 162 CONFLICT 100 7 1 1M33 MSE A 170 ? UNP P13001 MET 170 'MODIFIED RESIDUE' 170 8 1 1M33 MSE A 197 ? UNP P13001 MET 197 'MODIFIED RESIDUE' 197 9 1 1M33 MSE A 217 ? UNP P13001 MET 217 'MODIFIED RESIDUE' 217 10 1 1M33 GLY A 257 ? UNP P13001 ? ? INSERTION 257 11 1 1M33 SER A 258 ? UNP P13001 ? ? INSERTION 258 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 3OH non-polymer . '3-HYDROXY-PROPANOIC ACID' ? 'C3 H6 O3' 90.078 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1M33 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 48.81 _exptl_crystal.density_Matthews 2.40 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.8 _exptl_crystal_grow.pdbx_details '1.3M tri Na Citrate, 0.1M Tris, 15% ethylene glycol, pH 8.8, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type CUSTOM-MADE _diffrn_detector.pdbx_collection_date 2001-05-15 _diffrn_detector.details 'sagitally focusing monochromator, vertically focusing mirror' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Sagitally focusing Si(111) double crystal monochromator' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.979464 1.0 2 0.953732 1.0 3 1.03321 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.979464, 0.953732, 1.03321' # _reflns.entry_id 1M33 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 1.63 _reflns.d_resolution_low 100 _reflns.number_all 34646 _reflns.number_obs 33538 _reflns.percent_possible_obs 96.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.075 _reflns.pdbx_netI_over_sigmaI 16.5 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.63 _reflns_shell.d_res_low 1.69 _reflns_shell.percent_possible_all 82.5 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.595 _reflns_shell.meanI_over_sigI_obs 1.2 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 2828 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1M33 _refine.ls_number_reflns_obs 27141 _refine.ls_number_reflns_all 30435 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 74.54 _refine.ls_d_res_high 1.70 _refine.ls_percent_reflns_obs 93.85 _refine.ls_R_factor_obs 0.14735 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.14523 _refine.ls_R_factor_R_free 0.18838 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 1422 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.972 _refine.correlation_coeff_Fo_to_Fc_free 0.952 _refine.B_iso_mean 15.249 _refine.aniso_B[1][1] -0.15 _refine.aniso_B[2][2] -0.15 _refine.aniso_B[3][3] 0.30 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.102 _refine.overall_SU_B 1.933 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML 0.062 _refine.pdbx_overall_ESU_R 0.099 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1996 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.number_atoms_solvent 238 _refine_hist.number_atoms_total 2248 _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 74.54 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.022 0.021 ? 2327 'X-RAY DIFFRACTION' ? r_bond_other_d 0.003 0.020 ? 2174 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.941 1.950 ? 3158 'X-RAY DIFFRACTION' ? r_angle_other_deg 2.329 3.000 ? 5079 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.629 5.000 ? 276 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 19.565 15.000 ? 455 'X-RAY DIFFRACTION' ? r_chiral_restr 0.143 0.200 ? 352 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.011 0.020 ? 2551 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.009 0.020 ? 468 'X-RAY DIFFRACTION' ? r_nbd_refined 0.286 0.200 ? 539 'X-RAY DIFFRACTION' ? r_nbd_other 0.268 0.200 ? 2506 'X-RAY DIFFRACTION' ? r_nbtor_other 0.098 0.200 ? 1273 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.196 0.200 ? 144 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.300 0.200 ? 17 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.293 0.200 ? 59 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.142 0.200 ? 18 'X-RAY DIFFRACTION' ? r_mcbond_it 1.107 1.500 ? 1373 'X-RAY DIFFRACTION' ? r_mcangle_it 1.791 2.000 ? 2248 'X-RAY DIFFRACTION' ? r_scbond_it 2.650 3.000 ? 954 'X-RAY DIFFRACTION' ? r_scangle_it 3.961 4.500 ? 910 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.d_res_high 1.70 _refine_ls_shell.d_res_low 1.792 _refine_ls_shell.number_reflns_R_work 3631 _refine_ls_shell.R_factor_R_work 0.212 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.256 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 175 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1M33 _struct.title 'Crystal Structure of BioH at 1.7 A' _struct.pdbx_descriptor 'BioH protein, 3-HYDROXY-PROPANOIC ACID, ETHYLENE GLYCOL' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1M33 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;alpha-betta-alpha sandwich, Structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_biol.id 1 _struct_biol.details 'The monomer in the asymmetric unit is a whole biological unit.' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 25 ? CYS A 31 ? ASN A 25 CYS A 31 5 ? 7 HELX_P HELX_P2 2 ILE A 32 ? SER A 38 ? ILE A 32 SER A 38 1 ? 7 HELX_P HELX_P3 3 SER A 60 ? GLN A 70 ? SER A 60 GLN A 70 1 ? 11 HELX_P HELX_P4 4 SER A 82 ? HIS A 95 ? SER A 82 HIS A 95 1 ? 14 HELX_P HELX_P5 5 LYS A 121 ? ARG A 142 ? LYS A 121 ARG A 142 1 ? 22 HELX_P HELX_P6 6 LEU A 144 ? THR A 148 ? LEU A 144 THR A 148 5 ? 5 HELX_P HELX_P7 7 THR A 153 ? LEU A 161 ? THR A 153 LEU A 161 1 ? 9 HELX_P HELX_P8 8 LYS A 163 ? VAL A 165 ? LYS A 163 VAL A 165 5 ? 3 HELX_P HELX_P9 9 GLU A 172 ? VAL A 186 ? GLU A 172 VAL A 186 1 ? 15 HELX_P HELX_P10 10 GLN A 190 ? VAL A 195 ? GLN A 190 VAL A 195 5 ? 6 HELX_P HELX_P11 11 LYS A 213 ? TRP A 222 ? LYS A 213 TRP A 222 1 ? 10 HELX_P HELX_P12 12 ALA A 236 ? HIS A 241 ? ALA A 236 HIS A 241 1 ? 6 HELX_P HELX_P13 13 HIS A 241 ? GLN A 254 ? HIS A 241 GLN A 254 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale none ? A SER 82 OG ? ? ? 1_555 B 3OH . C3 A ? A SER 82 A 3OH 300 1_555 ? ? ? ? ? ? ? 1.780 ? covale2 covale none ? A SER 82 OG ? ? ? 1_555 B 3OH . C3 B ? A SER 82 A 3OH 300 1_555 ? ? ? ? ? ? ? 1.882 ? covale3 covale both ? A ASP 63 C ? ? ? 1_555 A MSE 64 N ? ? A ASP 63 A MSE 64 1_555 ? ? ? ? ? ? ? 1.331 ? covale4 covale both ? A MSE 64 C ? ? ? 1_555 A ALA 65 N ? ? A MSE 64 A ALA 65 1_555 ? ? ? ? ? ? ? 1.314 ? covale5 covale both ? A THR 148 C ? ? ? 1_555 A MSE 149 N ? ? A THR 148 A MSE 149 1_555 ? ? ? ? ? ? ? 1.342 ? covale6 covale both ? A MSE 149 C ? ? ? 1_555 A GLY 150 N ? ? A MSE 149 A GLY 150 1_555 ? ? ? ? ? ? ? 1.313 ? covale7 covale both ? A PRO 169 C ? ? ? 1_555 A MSE 170 N ? ? A PRO 169 A MSE 170 1_555 ? ? ? ? ? ? ? 1.327 ? covale8 covale both ? A MSE 170 C ? ? ? 1_555 A PRO 171 N ? ? A MSE 170 A PRO 171 1_555 ? ? ? ? ? ? ? 1.335 ? covale9 covale both ? A SER 196 C ? ? ? 1_555 A MSE 197 N ? ? A SER 196 A MSE 197 1_555 ? ? ? ? ? ? ? 1.328 ? covale10 covale both ? A MSE 197 C ? ? ? 1_555 A PRO 198 N ? ? A MSE 197 A PRO 198 1_555 ? ? ? ? ? ? ? 1.338 ? covale11 covale both ? A PRO 216 C ? ? ? 1_555 A MSE 217 N A ? A PRO 216 A MSE 217 1_555 ? ? ? ? ? ? ? 1.325 ? covale12 covale both ? A MSE 217 C ? ? ? 1_555 A LEU 218 N ? ? A MSE 217 A LEU 218 1_555 ? ? ? ? ? ? ? 1.332 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 6 ? LYS A 9 ? TRP A 6 LYS A 9 A 2 THR A 41 ? VAL A 45 ? THR A 41 VAL A 45 A 3 HIS A 15 ? LEU A 19 ? HIS A 15 LEU A 19 A 4 ALA A 76 ? TRP A 81 ? ALA A 76 TRP A 81 A 5 VAL A 99 ? VAL A 105 ? VAL A 99 VAL A 105 A 6 PHE A 199 ? GLY A 204 ? PHE A 199 GLY A 204 A 7 GLU A 226 ? PHE A 230 ? GLU A 226 PHE A 230 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLN A 7 ? N GLN A 7 O LEU A 44 ? O LEU A 44 A 2 3 O HIS A 43 ? O HIS A 43 N LEU A 18 ? N LEU A 18 A 3 4 N LEU A 19 ? N LEU A 19 O TRP A 81 ? O TRP A 81 A 4 5 N TRP A 78 ? N TRP A 78 O VAL A 103 ? O VAL A 103 A 5 6 N THR A 104 ? N THR A 104 O LEU A 202 ? O LEU A 202 A 6 7 N TYR A 203 ? N TYR A 203 O PHE A 230 ? O PHE A 230 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE 3OH A 300' AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE EDO A 301' AC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE EDO A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 GLY A 21 ? GLY A 21 . ? 1_555 ? 2 AC1 11 TRP A 22 ? TRP A 22 . ? 1_555 ? 3 AC1 11 LEU A 24 ? LEU A 24 . ? 1_555 ? 4 AC1 11 TRP A 81 ? TRP A 81 . ? 1_555 ? 5 AC1 11 SER A 82 ? SER A 82 . ? 1_555 ? 6 AC1 11 LEU A 83 ? LEU A 83 . ? 1_555 ? 7 AC1 11 PHE A 111 ? PHE A 111 . ? 1_555 ? 8 AC1 11 PHE A 143 ? PHE A 143 . ? 1_555 ? 9 AC1 11 GLN A 147 ? GLN A 147 . ? 1_555 ? 10 AC1 11 LEU A 183 ? LEU A 183 . ? 1_555 ? 11 AC1 11 HIS A 235 ? HIS A 235 . ? 1_555 ? 12 AC2 3 GLU A 152 ? GLU A 152 . ? 1_555 ? 13 AC2 3 LEU A 206 ? LEU A 206 . ? 1_555 ? 14 AC2 3 LYS A 232 ? LYS A 232 . ? 1_555 ? 15 AC3 8 ILE A 229 ? ILE A 229 . ? 1_555 ? 16 AC3 8 HIS A 241 ? HIS A 241 . ? 1_555 ? 17 AC3 8 PRO A 242 ? PRO A 242 . ? 1_555 ? 18 AC3 8 ALA A 243 ? ALA A 243 . ? 1_555 ? 19 AC3 8 GLU A 244 ? GLU A 244 . ? 1_555 ? 20 AC3 8 HOH E . ? HOH A 360 . ? 1_555 ? 21 AC3 8 HOH E . ? HOH A 424 . ? 1_555 ? 22 AC3 8 HOH E . ? HOH A 510 . ? 3_554 ? # _database_PDB_matrix.entry_id 1M33 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1M33 _atom_sites.fract_transf_matrix[1][1] 0.013296 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013296 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020302 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 TRP 5 5 5 TRP TRP A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 MSE 64 64 64 MSE MSE A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 TRP 81 81 81 TRP TRP A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 CYS 110 110 110 CYS CYS A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 TRP 117 117 117 TRP TRP A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 GLN 130 130 130 GLN GLN A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 MSE 149 149 149 MSE MSE A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 MSE 170 170 170 MSE MSE A . n A 1 171 PRO 171 171 171 PRO PRO A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ASN 177 177 177 ASN ASN A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 GLN 190 190 190 GLN GLN A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 GLN 193 193 193 GLN GLN A . n A 1 194 ASN 194 194 194 ASN ASN A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 MSE 197 197 197 MSE MSE A . n A 1 198 PRO 198 198 198 PRO PRO A . n A 1 199 PHE 199 199 199 PHE PHE A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 TYR 203 203 203 TYR TYR A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 TYR 205 205 205 TYR TYR A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 ASP 207 207 207 ASP ASP A . n A 1 208 GLY 208 208 208 GLY GLY A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 PRO 211 211 211 PRO PRO A . n A 1 212 ARG 212 212 212 ARG ARG A . n A 1 213 LYS 213 213 213 LYS LYS A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 PRO 216 216 216 PRO PRO A . n A 1 217 MSE 217 217 217 MSE MSE A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 ASP 219 219 219 ASP ASP A . n A 1 220 LYS 220 220 220 LYS LYS A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 TRP 222 222 222 TRP TRP A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 HIS 224 224 224 HIS HIS A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 GLU 226 226 226 GLU GLU A . n A 1 227 SER 227 227 227 SER SER A . n A 1 228 TYR 228 228 228 TYR TYR A . n A 1 229 ILE 229 229 229 ILE ILE A . n A 1 230 PHE 230 230 230 PHE PHE A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 LYS 232 232 232 LYS LYS A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 HIS 235 235 235 HIS HIS A . n A 1 236 ALA 236 236 236 ALA ALA A . n A 1 237 PRO 237 237 237 PRO PRO A . n A 1 238 PHE 238 238 238 PHE PHE A . n A 1 239 ILE 239 239 239 ILE ILE A . n A 1 240 SER 240 240 240 SER SER A . n A 1 241 HIS 241 241 241 HIS HIS A . n A 1 242 PRO 242 242 242 PRO PRO A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 GLU 244 244 244 GLU GLU A . n A 1 245 PHE 245 245 245 PHE PHE A . n A 1 246 CYS 246 246 246 CYS CYS A . n A 1 247 HIS 247 247 247 HIS HIS A . n A 1 248 LEU 248 248 248 LEU LEU A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 VAL 250 250 250 VAL VAL A . n A 1 251 ALA 251 251 251 ALA ALA A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 LYS 253 253 253 LYS LYS A . n A 1 254 GLN 254 254 254 GLN GLN A . n A 1 255 ARG 255 255 255 ARG ARG A . n A 1 256 VAL 256 256 256 VAL VAL A . n A 1 257 GLY 257 257 257 GLY GLY A . n A 1 258 SER 258 258 258 SER SER A . n # _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG _pdbx_SG_project.id 1 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 3OH 1 300 300 3OH 3OH A . C 3 EDO 1 301 301 EDO EGL A . D 3 EDO 1 302 302 EDO EGL A . E 4 HOH 1 303 1 HOH HOH A . E 4 HOH 2 304 2 HOH HOH A . E 4 HOH 3 305 3 HOH HOH A . E 4 HOH 4 306 4 HOH HOH A . E 4 HOH 5 307 5 HOH HOH A . E 4 HOH 6 308 6 HOH HOH A . E 4 HOH 7 309 7 HOH HOH A . E 4 HOH 8 310 8 HOH HOH A . E 4 HOH 9 311 9 HOH HOH A . E 4 HOH 10 312 10 HOH HOH A . E 4 HOH 11 313 11 HOH HOH A . E 4 HOH 12 314 12 HOH HOH A . E 4 HOH 13 315 13 HOH HOH A . E 4 HOH 14 316 14 HOH HOH A . E 4 HOH 15 317 15 HOH HOH A . E 4 HOH 16 318 16 HOH HOH A . E 4 HOH 17 319 17 HOH HOH A . E 4 HOH 18 320 18 HOH HOH A . E 4 HOH 19 321 19 HOH HOH A . E 4 HOH 20 322 20 HOH HOH A . E 4 HOH 21 323 21 HOH HOH A . E 4 HOH 22 324 22 HOH HOH A . E 4 HOH 23 325 23 HOH HOH A . E 4 HOH 24 326 24 HOH HOH A . E 4 HOH 25 327 25 HOH HOH A . E 4 HOH 26 328 26 HOH HOH A . E 4 HOH 27 329 27 HOH HOH A . E 4 HOH 28 330 28 HOH HOH A . E 4 HOH 29 331 29 HOH HOH A . E 4 HOH 30 332 30 HOH HOH A . E 4 HOH 31 333 31 HOH HOH A . E 4 HOH 32 334 32 HOH HOH A . E 4 HOH 33 335 33 HOH HOH A . E 4 HOH 34 336 34 HOH HOH A . E 4 HOH 35 337 35 HOH HOH A . E 4 HOH 36 338 36 HOH HOH A . E 4 HOH 37 339 37 HOH HOH A . E 4 HOH 38 340 38 HOH HOH A . E 4 HOH 39 341 39 HOH HOH A . E 4 HOH 40 342 40 HOH HOH A . E 4 HOH 41 343 41 HOH HOH A . E 4 HOH 42 344 42 HOH HOH A . E 4 HOH 43 345 43 HOH HOH A . E 4 HOH 44 346 44 HOH HOH A . E 4 HOH 45 347 45 HOH HOH A . E 4 HOH 46 348 46 HOH HOH A . E 4 HOH 47 349 47 HOH HOH A . E 4 HOH 48 350 48 HOH HOH A . E 4 HOH 49 351 49 HOH HOH A . E 4 HOH 50 352 50 HOH HOH A . E 4 HOH 51 353 51 HOH HOH A . E 4 HOH 52 354 52 HOH HOH A . E 4 HOH 53 355 53 HOH HOH A . E 4 HOH 54 356 54 HOH HOH A . E 4 HOH 55 357 55 HOH HOH A . E 4 HOH 56 358 56 HOH HOH A . E 4 HOH 57 359 57 HOH HOH A . E 4 HOH 58 360 58 HOH HOH A . E 4 HOH 59 361 59 HOH HOH A . E 4 HOH 60 362 60 HOH HOH A . E 4 HOH 61 363 61 HOH HOH A . E 4 HOH 62 364 62 HOH HOH A . E 4 HOH 63 365 63 HOH HOH A . E 4 HOH 64 366 64 HOH HOH A . E 4 HOH 65 367 65 HOH HOH A . E 4 HOH 66 368 66 HOH HOH A . E 4 HOH 67 369 67 HOH HOH A . E 4 HOH 68 370 68 HOH HOH A . E 4 HOH 69 371 69 HOH HOH A . E 4 HOH 70 372 70 HOH HOH A . E 4 HOH 71 373 71 HOH HOH A . E 4 HOH 72 374 72 HOH HOH A . E 4 HOH 73 375 73 HOH HOH A . E 4 HOH 74 376 74 HOH HOH A . E 4 HOH 75 377 75 HOH HOH A . E 4 HOH 76 378 76 HOH HOH A . E 4 HOH 77 379 77 HOH HOH A . E 4 HOH 78 380 78 HOH HOH A . E 4 HOH 79 381 79 HOH HOH A . E 4 HOH 80 382 80 HOH HOH A . E 4 HOH 81 383 81 HOH HOH A . E 4 HOH 82 384 82 HOH HOH A . E 4 HOH 83 385 83 HOH HOH A . E 4 HOH 84 386 84 HOH HOH A . E 4 HOH 85 387 85 HOH HOH A . E 4 HOH 86 388 86 HOH HOH A . E 4 HOH 87 389 87 HOH HOH A . E 4 HOH 88 390 88 HOH HOH A . E 4 HOH 89 391 89 HOH HOH A . E 4 HOH 90 392 90 HOH HOH A . E 4 HOH 91 393 91 HOH HOH A . E 4 HOH 92 394 92 HOH HOH A . E 4 HOH 93 395 93 HOH HOH A . E 4 HOH 94 396 94 HOH HOH A . E 4 HOH 95 397 95 HOH HOH A . E 4 HOH 96 398 96 HOH HOH A . E 4 HOH 97 399 97 HOH HOH A . E 4 HOH 98 400 98 HOH HOH A . E 4 HOH 99 401 99 HOH HOH A . E 4 HOH 100 402 100 HOH HOH A . E 4 HOH 101 403 101 HOH HOH A . E 4 HOH 102 404 102 HOH HOH A . E 4 HOH 103 405 103 HOH HOH A . E 4 HOH 104 406 104 HOH HOH A . E 4 HOH 105 407 105 HOH HOH A . E 4 HOH 106 408 106 HOH HOH A . E 4 HOH 107 409 107 HOH HOH A . E 4 HOH 108 410 108 HOH HOH A . E 4 HOH 109 411 109 HOH HOH A . E 4 HOH 110 412 110 HOH HOH A . E 4 HOH 111 413 111 HOH HOH A . E 4 HOH 112 414 112 HOH HOH A . E 4 HOH 113 415 113 HOH HOH A . E 4 HOH 114 416 114 HOH HOH A . E 4 HOH 115 417 115 HOH HOH A . E 4 HOH 116 418 116 HOH HOH A . E 4 HOH 117 419 117 HOH HOH A . E 4 HOH 118 420 118 HOH HOH A . E 4 HOH 119 421 119 HOH HOH A . E 4 HOH 120 422 120 HOH HOH A . E 4 HOH 121 423 121 HOH HOH A . E 4 HOH 122 424 122 HOH HOH A . E 4 HOH 123 425 123 HOH HOH A . E 4 HOH 124 426 124 HOH HOH A . E 4 HOH 125 427 125 HOH HOH A . E 4 HOH 126 428 126 HOH HOH A . E 4 HOH 127 429 127 HOH HOH A . E 4 HOH 128 430 128 HOH HOH A . E 4 HOH 129 431 129 HOH HOH A . E 4 HOH 130 432 130 HOH HOH A . E 4 HOH 131 433 131 HOH HOH A . E 4 HOH 132 434 132 HOH HOH A . E 4 HOH 133 435 133 HOH HOH A . E 4 HOH 134 436 134 HOH HOH A . E 4 HOH 135 437 135 HOH HOH A . E 4 HOH 136 438 136 HOH HOH A . E 4 HOH 137 439 137 HOH HOH A . E 4 HOH 138 440 138 HOH HOH A . E 4 HOH 139 441 139 HOH HOH A . E 4 HOH 140 442 140 HOH HOH A . E 4 HOH 141 443 141 HOH HOH A . E 4 HOH 142 444 142 HOH HOH A . E 4 HOH 143 445 143 HOH HOH A . E 4 HOH 144 446 144 HOH HOH A . E 4 HOH 145 447 145 HOH HOH A . E 4 HOH 146 448 146 HOH HOH A . E 4 HOH 147 449 147 HOH HOH A . E 4 HOH 148 450 148 HOH HOH A . E 4 HOH 149 451 149 HOH HOH A . E 4 HOH 150 452 150 HOH HOH A . E 4 HOH 151 453 151 HOH HOH A . E 4 HOH 152 454 152 HOH HOH A . E 4 HOH 153 455 153 HOH HOH A . E 4 HOH 154 456 154 HOH HOH A . E 4 HOH 155 457 155 HOH HOH A . E 4 HOH 156 458 156 HOH HOH A . E 4 HOH 157 459 157 HOH HOH A . E 4 HOH 158 460 158 HOH HOH A . E 4 HOH 159 461 159 HOH HOH A . E 4 HOH 160 462 160 HOH HOH A . E 4 HOH 161 463 161 HOH HOH A . E 4 HOH 162 464 162 HOH HOH A . E 4 HOH 163 465 163 HOH HOH A . E 4 HOH 164 466 164 HOH HOH A . E 4 HOH 165 467 166 HOH HOH A . E 4 HOH 166 468 167 HOH HOH A . E 4 HOH 167 469 168 HOH HOH A . E 4 HOH 168 470 169 HOH HOH A . E 4 HOH 169 471 170 HOH HOH A . E 4 HOH 170 472 171 HOH HOH A . E 4 HOH 171 473 172 HOH HOH A . E 4 HOH 172 474 173 HOH HOH A . E 4 HOH 173 475 174 HOH HOH A . E 4 HOH 174 476 175 HOH HOH A . E 4 HOH 175 477 176 HOH HOH A . E 4 HOH 176 478 177 HOH HOH A . E 4 HOH 177 479 178 HOH HOH A . E 4 HOH 178 480 179 HOH HOH A . E 4 HOH 179 481 180 HOH HOH A . E 4 HOH 180 482 181 HOH HOH A . E 4 HOH 181 483 182 HOH HOH A . E 4 HOH 182 484 183 HOH HOH A . E 4 HOH 183 485 184 HOH HOH A . E 4 HOH 184 486 185 HOH HOH A . E 4 HOH 185 487 186 HOH HOH A . E 4 HOH 186 488 187 HOH HOH A . E 4 HOH 187 489 188 HOH HOH A . E 4 HOH 188 490 189 HOH HOH A . E 4 HOH 189 491 190 HOH HOH A . E 4 HOH 190 492 191 HOH HOH A . E 4 HOH 191 493 192 HOH HOH A . E 4 HOH 192 494 193 HOH HOH A . E 4 HOH 193 495 194 HOH HOH A . E 4 HOH 194 496 195 HOH HOH A . E 4 HOH 195 497 196 HOH HOH A . E 4 HOH 196 498 197 HOH HOH A . E 4 HOH 197 499 198 HOH HOH A . E 4 HOH 198 500 199 HOH HOH A . E 4 HOH 199 501 200 HOH HOH A . E 4 HOH 200 502 201 HOH HOH A . E 4 HOH 201 503 202 HOH HOH A . E 4 HOH 202 504 203 HOH HOH A . E 4 HOH 203 505 204 HOH HOH A . E 4 HOH 204 506 205 HOH HOH A . E 4 HOH 205 507 206 HOH HOH A . E 4 HOH 206 508 208 HOH HOH A . E 4 HOH 207 509 209 HOH HOH A . E 4 HOH 208 510 210 HOH HOH A . E 4 HOH 209 511 211 HOH HOH A . E 4 HOH 210 512 212 HOH HOH A . E 4 HOH 211 513 213 HOH HOH A . E 4 HOH 212 514 214 HOH HOH A . E 4 HOH 213 515 215 HOH HOH A . E 4 HOH 214 516 216 HOH HOH A . E 4 HOH 215 517 217 HOH HOH A . E 4 HOH 216 518 218 HOH HOH A . E 4 HOH 217 519 219 HOH HOH A . E 4 HOH 218 520 220 HOH HOH A . E 4 HOH 219 521 221 HOH HOH A . E 4 HOH 220 522 222 HOH HOH A . E 4 HOH 221 523 223 HOH HOH A . E 4 HOH 222 524 224 HOH HOH A . E 4 HOH 223 525 225 HOH HOH A . E 4 HOH 224 526 226 HOH HOH A . E 4 HOH 225 527 227 HOH HOH A . E 4 HOH 226 528 228 HOH HOH A . E 4 HOH 227 529 229 HOH HOH A . E 4 HOH 228 530 230 HOH HOH A . E 4 HOH 229 531 231 HOH HOH A . E 4 HOH 230 532 232 HOH HOH A . E 4 HOH 231 533 233 HOH HOH A . E 4 HOH 232 534 234 HOH HOH A . E 4 HOH 233 535 235 HOH HOH A . E 4 HOH 234 536 236 HOH HOH A . E 4 HOH 235 537 237 HOH HOH A . E 4 HOH 236 538 238 HOH HOH A . E 4 HOH 237 539 239 HOH HOH A . E 4 HOH 238 540 240 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 64 A MSE 64 ? MET SELENOMETHIONINE 2 A MSE 149 A MSE 149 ? MET SELENOMETHIONINE 3 A MSE 170 A MSE 170 ? MET SELENOMETHIONINE 4 A MSE 197 A MSE 197 ? MET SELENOMETHIONINE 5 A MSE 217 A MSE 217 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-01-21 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-11 5 'Structure model' 1 4 2019-07-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' Advisory 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Derived calculations' 8 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 2 4 'Structure model' software 3 5 'Structure model' software 4 5 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.name' 3 5 'Structure model' '_software.classification' 4 5 'Structure model' '_software.name' 5 5 'Structure model' '_software.version' 6 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.pdbx_refine_id 1 ? refined 18.9707 10.8230 14.3217 0.0210 0.0190 0.0393 0.0147 0.0092 -0.0111 1.5960 2.1184 1.7319 -0.2217 0.2992 -0.0851 0.0179 0.0109 0.0518 0.0451 -0.0312 0.0583 -0.0046 -0.0260 0.0133 'X-RAY DIFFRACTION' 2 ? refined 34.4722 2.5709 11.6658 0.1338 0.1620 0.1404 0.0224 -0.0063 -0.0055 0.9386 1.3232 1.1053 -0.4449 -0.1438 -0.4501 0.0483 0.2257 -0.0386 -0.1064 -0.0571 -0.3146 0.0521 0.3817 0.0088 'X-RAY DIFFRACTION' 3 ? refined 22.4028 9.3391 13.2230 0.1710 0.1592 0.1408 0.0069 -0.0114 -0.0155 1.6269 1.8027 1.4051 -0.3573 0.0707 -0.1525 0.0233 0.0193 0.0915 0.0099 -0.0147 -0.0578 -0.0585 0.0426 -0.0086 'X-RAY DIFFRACTION' # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.selection_details 1 1 A 3 3 A 109 109 ? A A 'X-RAY DIFFRACTION' ? 2 1 A 188 188 A 258 258 ? A A 'X-RAY DIFFRACTION' ? 3 2 A 110 110 A 187 187 ? A A 'X-RAY DIFFRACTION' ? 4 3 A 1 303 A 238 540 ? A A 'X-RAY DIFFRACTION' ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.1.05 ? 1 dtDisplay 'data collection' . ? 2 HKL-2000 'data reduction' . ? 3 CNS refinement . ? 4 d*TREK 'data scaling' . ? 5 d*TREK 'data reduction' . ? 6 DTDISPLAY 'data reduction' . ? 7 HKL-2000 'data scaling' . ? 8 CNS phasing . ? 9 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 SER _pdbx_validate_rmsd_bond.auth_seq_id_1 196 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 SER _pdbx_validate_rmsd_bond.auth_seq_id_2 196 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.317 _pdbx_validate_rmsd_bond.bond_target_value 1.418 _pdbx_validate_rmsd_bond.bond_deviation -0.101 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.013 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A CYS 31 ? A CB A CYS 31 ? A SG A CYS 31 ? A 125.13 114.20 10.93 1.10 N 2 1 NE A ARG 54 ? A CZ A ARG 54 ? A NH1 A ARG 54 ? A 123.32 120.30 3.02 0.50 N 3 1 NE A ARG 98 ? ? CZ A ARG 98 ? ? NH1 A ARG 98 ? ? 123.57 120.30 3.27 0.50 N 4 1 CB A ASP 135 ? A CG A ASP 135 ? A OD2 A ASP 135 ? A 124.15 118.30 5.85 0.90 N 5 1 CG1 A VAL 173 ? B CB A VAL 173 ? ? CG2 A VAL 173 ? B 120.79 110.90 9.89 1.60 N 6 1 CG1 A VAL 195 ? B CB A VAL 195 ? ? CG2 A VAL 195 ? B 120.88 110.90 9.98 1.60 N 7 1 NE A ARG 201 ? ? CZ A ARG 201 ? ? NH1 A ARG 201 ? ? 123.38 120.30 3.08 0.50 N 8 1 NE A ARG 201 ? ? CZ A ARG 201 ? ? NH2 A ARG 201 ? ? 116.76 120.30 -3.54 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 24 ? ? -103.67 -160.66 2 1 SER A 82 ? ? 62.09 -118.33 3 1 CYS A 110 ? ? -157.13 89.91 4 1 ASP A 115 ? A 6.14 -96.07 5 1 ALA A 234 ? ? -102.17 -131.95 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 116 ? CG ? A GLU 116 CG 2 1 Y 1 A GLU 116 ? CD ? A GLU 116 CD 3 1 Y 1 A GLU 116 ? OE1 ? A GLU 116 OE1 4 1 Y 1 A GLU 116 ? OE2 ? A GLU 116 OE2 5 1 Y 1 A LYS 121 ? CG ? A LYS 121 CG 6 1 Y 1 A LYS 121 ? CD ? A LYS 121 CD 7 1 Y 1 A LYS 121 ? CE ? A LYS 121 CE 8 1 Y 1 A LYS 121 ? NZ ? A LYS 121 NZ 9 1 Y 1 A ASP 123 ? OD1 ? A ASP 123 OD1 10 1 Y 1 A ASP 123 ? OD2 ? A ASP 123 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A ASN 2 ? A ASN 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-HYDROXY-PROPANOIC ACID' 3OH 3 1,2-ETHANEDIOL EDO 4 water HOH #