data_1M4M # _entry.id 1M4M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1M4M RCSB RCSB016591 WWPDB D_1000016591 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1M4M _pdbx_database_status.recvd_initial_deposition_date 2002-07-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Muchmore, S.W.' 1 'Chen, J.' 2 'Jakob, C.' 3 'Zakula, D.' 4 'Matayoshi, E.D.' 5 'Wu, W.' 6 'Zhang, H.' 7 'Li, F.' 8 'Ng, S.C.' 9 'Altieri, D.C.' 10 # _citation.id primary _citation.title 'CRYSTAL STRUCTURE AND MUTAGENIC ANALYSIS OF THE INHIBITOR-OF-APOPTOSIS PROTEIN SURVIVIN' _citation.journal_abbrev MOL.CELL _citation.journal_volume 6 _citation.page_first 173 _citation.page_last 182 _citation.year 2000 _citation.journal_id_ASTM MOCEFL _citation.country US _citation.journal_id_ISSN 1097-2765 _citation.journal_id_CSD 2168 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10949038 _citation.pdbx_database_id_DOI '10.1016/S1097-2765(00)00018-6' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Muchmore, S.W.' 1 primary 'Chen, J.' 2 primary 'Jakob, C.' 3 primary 'Zakula, D.' 4 primary 'Matayoshi, E.D.' 5 primary 'Wu, W.' 6 primary 'Zhang, H.' 7 primary 'Li, F.' 8 primary 'Ng, S.C.' 9 primary 'Altieri, D.C.' 10 # _cell.entry_id 1M4M _cell.length_a 41.43 _cell.length_b 41.43 _cell.length_c 291.34 _cell.angle_alpha 90.0 _cell.angle_beta 90.0 _cell.angle_gamma 120.0 _cell.pdbx_unique_axis ? _cell.Z_PDB 12 # _symmetry.entry_id 1M4M _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 178 _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'BACULOVIRAL IAP REPEAT-CONTAINING PROTEIN 5' 16319.548 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Apoptosis inhibitor survivin, Apoptosis inhibitor 4, TIAP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKH SPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKH SPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ALA n 1 4 PRO n 1 5 ALA n 1 6 LEU n 1 7 PRO n 1 8 GLN n 1 9 ILE n 1 10 TRP n 1 11 GLN n 1 12 LEU n 1 13 TYR n 1 14 LEU n 1 15 LYS n 1 16 ASN n 1 17 TYR n 1 18 ARG n 1 19 ILE n 1 20 ALA n 1 21 THR n 1 22 PHE n 1 23 LYS n 1 24 ASN n 1 25 TRP n 1 26 PRO n 1 27 PHE n 1 28 LEU n 1 29 GLU n 1 30 ASP n 1 31 CYS n 1 32 ALA n 1 33 CYS n 1 34 THR n 1 35 PRO n 1 36 GLU n 1 37 ARG n 1 38 MET n 1 39 ALA n 1 40 GLU n 1 41 ALA n 1 42 GLY n 1 43 PHE n 1 44 ILE n 1 45 HIS n 1 46 CYS n 1 47 PRO n 1 48 THR n 1 49 GLU n 1 50 ASN n 1 51 GLU n 1 52 PRO n 1 53 ASP n 1 54 LEU n 1 55 ALA n 1 56 GLN n 1 57 CYS n 1 58 PHE n 1 59 PHE n 1 60 CYS n 1 61 PHE n 1 62 LYS n 1 63 GLU n 1 64 LEU n 1 65 GLU n 1 66 GLY n 1 67 TRP n 1 68 GLU n 1 69 PRO n 1 70 ASP n 1 71 ASP n 1 72 ASN n 1 73 PRO n 1 74 ILE n 1 75 GLU n 1 76 GLU n 1 77 HIS n 1 78 ARG n 1 79 LYS n 1 80 HIS n 1 81 SER n 1 82 PRO n 1 83 GLY n 1 84 CYS n 1 85 ALA n 1 86 PHE n 1 87 LEU n 1 88 THR n 1 89 VAL n 1 90 LYS n 1 91 LYS n 1 92 GLN n 1 93 MET n 1 94 GLU n 1 95 GLU n 1 96 LEU n 1 97 THR n 1 98 VAL n 1 99 SER n 1 100 GLU n 1 101 PHE n 1 102 LEU n 1 103 LYS n 1 104 LEU n 1 105 ASP n 1 106 ARG n 1 107 GLN n 1 108 ARG n 1 109 ALA n 1 110 LYS n 1 111 ASN n 1 112 LYS n 1 113 ILE n 1 114 ALA n 1 115 LYS n 1 116 GLU n 1 117 THR n 1 118 ASN n 1 119 ASN n 1 120 LYS n 1 121 GLN n 1 122 LYS n 1 123 GLU n 1 124 PHE n 1 125 GLU n 1 126 GLU n 1 127 THR n 1 128 ALA n 1 129 LYS n 1 130 THR n 1 131 THR n 1 132 ARG n 1 133 GLN n 1 134 SER n 1 135 ILE n 1 136 GLU n 1 137 GLN n 1 138 LEU n 1 139 ALA n 1 140 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain DH5alpha _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX-4T-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BIRC5_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKH SPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession O70201 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1M4M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O70201 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 140 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 140 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1M4M _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 2 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 44.35 _exptl_crystal.density_Matthews 2.21 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details 'Isopropanol, cacodylate potassium chloride, magnesium chloride, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 100 ? 1 2 ? ? 1 1,2 ? ? 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.pdbx_collection_date 2002-03-20 _diffrn_detector.details ? # loop_ _diffrn_radiation.diffrn_id _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.monochromator _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_scattering_type 1 1 M 'Si 111' MAD x-ray 2 1 M 'Si 111' 'SINGLE WAVELENGTH' x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.2822 1.0 2 1.2831 1.0 3 1.2716 1.0 4 1.200 1.0 # loop_ _diffrn_source.diffrn_id _diffrn_source.source _diffrn_source.type _diffrn_source.pdbx_synchrotron_site _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_wavelength_list 1 SYNCHROTRON 'APS BEAMLINE 17-ID' APS 17-ID ? '1.2822, 1.2831, 1.2716' 2 SYNCHROTRON 'APS BEAMLINE 17-ID' APS 17-ID ? 1.200 # _reflns.entry_id 1M4M _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.0 _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 50 _reflns.number_all ? _reflns.number_obs 4576 _reflns.percent_possible_obs 97.2 _reflns.pdbx_Rmerge_I_obs 0.043 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1,2 # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low ? _reflns_shell.percent_possible_all 81. _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1,2 # _refine.entry_id 1M4M _refine.ls_d_res_high 2.80 _refine.ls_d_res_low 50.00 _refine.pdbx_ls_sigma_F 2 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3891 _refine.ls_number_reflns_R_free 388 _refine.ls_percent_reflns_obs 94.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_work 0.243 _refine.ls_R_factor_R_free 0.312 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'AB INITIO PHASING' _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details Random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 928 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 930 _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 50.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.011 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.54 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1M4M _struct.title 'Mouse Survivin' _struct.pdbx_descriptor 'BACULOVIRAL IAP REPEAT-CONTAINING PROTEIN 5' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1M4M _struct_keywords.pdbx_keywords APOPTOSIS _struct_keywords.text 'Zn Finger Baculovirus IAP repeat, APOPTOSIS' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TRP A 10 ? TYR A 13 ? TRP A 10 TYR A 13 5 ? 4 HELX_P HELX_P2 2 LEU A 14 ? THR A 21 ? LEU A 14 THR A 21 1 ? 8 HELX_P HELX_P3 3 THR A 34 ? ALA A 41 ? THR A 34 ALA A 41 1 ? 8 HELX_P HELX_P4 4 ASN A 72 ? HIS A 80 ? ASN A 72 HIS A 80 1 ? 9 HELX_P HELX_P5 5 CYS A 84 ? VAL A 89 ? CYS A 84 VAL A 89 1 ? 6 HELX_P HELX_P6 6 GLN A 92 ? LEU A 96 ? GLN A 92 LEU A 96 5 ? 5 HELX_P HELX_P7 7 THR A 97 ? THR A 117 ? THR A 97 THR A 117 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 60 SG ? ? ? 1_555 A CYS 84 SG ? ? A CYS 60 A CYS 84 1_555 ? ? ? ? ? ? ? 2.542 ? metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 80 NE2 ? ? A ZN 501 A HIS 80 1_555 ? ? ? ? ? ? ? 1.838 ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A GLU 76 OE2 ? ? A ZN 501 A GLU 76 1_555 ? ? ? ? ? ? ? 2.241 ? metalc3 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 77 NE2 ? ? A ZN 502 A HIS 77 1_555 ? ? ? ? ? ? ? 2.106 ? metalc4 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 60 SG ? ? A ZN 502 A CYS 60 1_555 ? ? ? ? ? ? ? 2.312 ? metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 84 SG ? ? A ZN 502 A CYS 84 1_555 ? ? ? ? ? ? ? 2.282 ? metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 57 SG ? ? A ZN 502 A CYS 57 1_555 ? ? ? ? ? ? ? 2.303 ? metalc7 metalc ? ? B ZN . ZN ? ? ? 1_555 A GLU 76 OE2 ? ? A ZN 501 A GLU 76 8_555 ? ? ? ? ? ? ? 2.241 ? metalc8 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 80 NE2 ? ? A ZN 501 A HIS 80 8_555 ? ? ? ? ? ? ? 1.838 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 43 ? HIS A 45 ? PHE A 43 HIS A 45 A 2 ALA A 55 ? CYS A 57 ? ALA A 55 CYS A 57 A 3 GLU A 63 ? LEU A 64 ? GLU A 63 LEU A 64 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 44 ? N ILE A 44 O GLN A 56 ? O GLN A 56 A 2 3 N ALA A 55 ? N ALA A 55 O LEU A 64 ? O LEU A 64 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 501' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 502' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 76 ? GLU A 76 . ? 8_555 ? 2 AC1 4 GLU A 76 ? GLU A 76 . ? 1_555 ? 3 AC1 4 HIS A 80 ? HIS A 80 . ? 1_555 ? 4 AC1 4 HIS A 80 ? HIS A 80 . ? 8_555 ? 5 AC2 4 CYS A 57 ? CYS A 57 . ? 1_555 ? 6 AC2 4 CYS A 60 ? CYS A 60 . ? 1_555 ? 7 AC2 4 HIS A 77 ? HIS A 77 . ? 1_555 ? 8 AC2 4 CYS A 84 ? CYS A 84 . ? 1_555 ? # _database_PDB_matrix.entry_id 1M4M _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1M4M _atom_sites.fract_transf_matrix[1][1] 0.024137 _atom_sites.fract_transf_matrix[1][2] 0.013936 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027871 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003432 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 TRP 10 10 10 TRP TRP A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 TRP 67 67 67 TRP TRP A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 ASN 119 119 ? ? ? A . n A 1 120 LYS 120 120 ? ? ? A . n A 1 121 GLN 121 121 ? ? ? A . n A 1 122 LYS 122 122 ? ? ? A . n A 1 123 GLU 123 123 ? ? ? A . n A 1 124 PHE 124 124 ? ? ? A . n A 1 125 GLU 125 125 ? ? ? A . n A 1 126 GLU 126 126 ? ? ? A . n A 1 127 THR 127 127 ? ? ? A . n A 1 128 ALA 128 128 ? ? ? A . n A 1 129 LYS 129 129 ? ? ? A . n A 1 130 THR 130 130 ? ? ? A . n A 1 131 THR 131 131 ? ? ? A . n A 1 132 ARG 132 132 ? ? ? A . n A 1 133 GLN 133 133 ? ? ? A . n A 1 134 SER 134 134 ? ? ? A . n A 1 135 ILE 135 135 ? ? ? A . n A 1 136 GLU 136 136 ? ? ? A . n A 1 137 GLN 137 137 ? ? ? A . n A 1 138 LEU 138 138 ? ? ? A . n A 1 139 ALA 139 139 ? ? ? A . n A 1 140 ALA 140 140 ? ? ? A . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 3 software_defined_assembly PQS dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 2 1,2 A,B,C 3 1,3 A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 1050 ? 2 MORE -55 ? 2 'SSA (A^2)' 13500 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 x-y,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 12_555 x,x-y,-z+1/6 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 48.5566666667 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id ZN _pdbx_struct_special_symmetry.auth_seq_id 501 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id ZN _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 80 ? A HIS 80 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 OE2 ? A GLU 76 ? A GLU 76 ? 1_555 98.2 ? 2 NE2 ? A HIS 80 ? A HIS 80 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 OE2 ? A GLU 76 ? A GLU 76 ? 8_555 120.1 ? 3 OE2 ? A GLU 76 ? A GLU 76 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 OE2 ? A GLU 76 ? A GLU 76 ? 8_555 103.3 ? 4 NE2 ? A HIS 80 ? A HIS 80 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 80 ? A HIS 80 ? 8_555 117.5 ? 5 OE2 ? A GLU 76 ? A GLU 76 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 80 ? A HIS 80 ? 8_555 120.1 ? 6 OE2 ? A GLU 76 ? A GLU 76 ? 8_555 ZN ? B ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 80 ? A HIS 80 ? 8_555 98.2 ? 7 NE2 ? A HIS 77 ? A HIS 77 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 129.7 ? 8 NE2 ? A HIS 77 ? A HIS 77 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 84 ? A CYS 84 ? 1_555 109.0 ? 9 SG ? A CYS 60 ? A CYS 60 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 84 ? A CYS 84 ? 1_555 67.2 ? 10 NE2 ? A HIS 77 ? A HIS 77 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 57 ? A CYS 57 ? 1_555 108.7 ? 11 SG ? A CYS 60 ? A CYS 60 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 57 ? A CYS 57 ? 1_555 120.0 ? 12 SG ? A CYS 84 ? A CYS 84 ? 1_555 ZN ? C ZN . ? A ZN 502 ? 1_555 SG ? A CYS 57 ? A CYS 57 ? 1_555 109.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-09-25 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 SCALEPACK 'data scaling' . ? 2 SHARP phasing . ? 3 CNX refinement . ? 4 HKL-2000 'data reduction' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 8 ? ? 37.27 -167.78 2 1 TRP A 10 ? ? 179.06 43.39 3 1 ASN A 16 ? ? -36.62 -39.80 4 1 ASN A 24 ? ? 82.95 9.13 5 1 PRO A 26 ? ? -64.94 -173.11 6 1 PHE A 27 ? ? 63.02 74.75 7 1 GLU A 29 ? ? 76.40 143.88 8 1 ASP A 30 ? ? 49.70 83.63 9 1 CYS A 31 ? ? 173.48 146.98 10 1 CYS A 33 ? ? -108.30 47.12 11 1 GLU A 51 ? ? -118.53 72.36 12 1 PRO A 69 ? ? -23.18 -47.26 13 1 ASP A 70 ? ? -101.82 59.73 14 1 SER A 81 ? ? -170.57 51.36 15 1 VAL A 89 ? ? -56.32 89.21 16 1 MET A 93 ? ? -33.83 -38.83 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A ASN 119 ? A ASN 119 8 1 Y 1 A LYS 120 ? A LYS 120 9 1 Y 1 A GLN 121 ? A GLN 121 10 1 Y 1 A LYS 122 ? A LYS 122 11 1 Y 1 A GLU 123 ? A GLU 123 12 1 Y 1 A PHE 124 ? A PHE 124 13 1 Y 1 A GLU 125 ? A GLU 125 14 1 Y 1 A GLU 126 ? A GLU 126 15 1 Y 1 A THR 127 ? A THR 127 16 1 Y 1 A ALA 128 ? A ALA 128 17 1 Y 1 A LYS 129 ? A LYS 129 18 1 Y 1 A THR 130 ? A THR 130 19 1 Y 1 A THR 131 ? A THR 131 20 1 Y 1 A ARG 132 ? A ARG 132 21 1 Y 1 A GLN 133 ? A GLN 133 22 1 Y 1 A SER 134 ? A SER 134 23 1 Y 1 A ILE 135 ? A ILE 135 24 1 Y 1 A GLU 136 ? A GLU 136 25 1 Y 1 A GLN 137 ? A GLN 137 26 1 Y 1 A LEU 138 ? A LEU 138 27 1 Y 1 A ALA 139 ? A ALA 139 28 1 Y 1 A ALA 140 ? A ALA 140 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 501 501 ZN ZN2 A . C 2 ZN 1 502 502 ZN ZN2 A . #