data_1M94 # _entry.id 1M94 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1M94 pdb_00001m94 10.2210/pdb1m94/pdb RCSB RCSB016750 ? ? WWPDB D_1000016750 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id YTYst190 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1M94 _pdbx_database_status.recvd_initial_deposition_date 2002-07-26 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_mr REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ramelot, T.A.' 1 'Cort, J.R.' 2 'Yee, A.A.' 3 'Semesi, A.' 4 'Edwards, A.M.' 5 'Arrowsmith, C.H.' 6 'Kennedy, M.A.' 7 'Northeast Structural Genomics Consortium (NESG)' 8 # _citation.id primary _citation.title 'Solution Structure of the Yeast Ubiquitin-Like Modifier Protein Hub1' _citation.journal_abbrev J.STRUCT.FUNCT.GENOM. _citation.journal_volume 4 _citation.page_first 25 _citation.page_last 30 _citation.year 2003 _citation.journal_id_ASTM ? _citation.country NE _citation.journal_id_ISSN 1345-711X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12943364 _citation.pdbx_database_id_DOI 10.1023/A:1024674220425 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ramelot, T.A.' 1 ? primary 'Cort, J.R.' 2 ? primary 'Yee, A.A.' 3 ? primary 'Semesi, A.' 4 ? primary 'Edwards, A.M.' 5 ? primary 'Arrowsmith, C.H.' 6 ? primary 'Kennedy, M.A.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein YNR032c-a' _entity.formula_weight 10454.938 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Hub1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMIEVVVNDRLGKKVRVKCLAEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDY EVHDQTNLELYYL ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMIEVVVNDRLGKKVRVKCLAEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDY EVHDQTNLELYYL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier YTYst190 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ILE n 1 23 GLU n 1 24 VAL n 1 25 VAL n 1 26 VAL n 1 27 ASN n 1 28 ASP n 1 29 ARG n 1 30 LEU n 1 31 GLY n 1 32 LYS n 1 33 LYS n 1 34 VAL n 1 35 ARG n 1 36 VAL n 1 37 LYS n 1 38 CYS n 1 39 LEU n 1 40 ALA n 1 41 GLU n 1 42 ASP n 1 43 SER n 1 44 VAL n 1 45 GLY n 1 46 ASP n 1 47 PHE n 1 48 LYS n 1 49 LYS n 1 50 VAL n 1 51 LEU n 1 52 SER n 1 53 LEU n 1 54 GLN n 1 55 ILE n 1 56 GLY n 1 57 THR n 1 58 GLN n 1 59 PRO n 1 60 ASN n 1 61 LYS n 1 62 ILE n 1 63 VAL n 1 64 LEU n 1 65 GLN n 1 66 LYS n 1 67 GLY n 1 68 GLY n 1 69 SER n 1 70 VAL n 1 71 LEU n 1 72 LYS n 1 73 ASP n 1 74 HIS n 1 75 ILE n 1 76 SER n 1 77 LEU n 1 78 GLU n 1 79 ASP n 1 80 TYR n 1 81 GLU n 1 82 VAL n 1 83 HIS n 1 84 ASP n 1 85 GLN n 1 86 THR n 1 87 ASN n 1 88 LEU n 1 89 GLU n 1 90 LEU n 1 91 TYR n 1 92 TYR n 1 93 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene YNR032c-a/HUB1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-(Gold lamdaDE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HUB1_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MIEVVVNDRLGKKVRVKCLAEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDQTNLELYYL _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession Q6Q546 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1M94 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 93 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6Q546 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 73 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1M94 MET A 1 ? UNP Q6Q546 ? ? 'expression tag' -19 1 1 1M94 GLY A 2 ? UNP Q6Q546 ? ? 'expression tag' -18 2 1 1M94 SER A 3 ? UNP Q6Q546 ? ? 'expression tag' -17 3 1 1M94 SER A 4 ? UNP Q6Q546 ? ? 'expression tag' -16 4 1 1M94 HIS A 5 ? UNP Q6Q546 ? ? 'expression tag' -15 5 1 1M94 HIS A 6 ? UNP Q6Q546 ? ? 'expression tag' -14 6 1 1M94 HIS A 7 ? UNP Q6Q546 ? ? 'expression tag' -13 7 1 1M94 HIS A 8 ? UNP Q6Q546 ? ? 'expression tag' -12 8 1 1M94 HIS A 9 ? UNP Q6Q546 ? ? 'expression tag' -11 9 1 1M94 HIS A 10 ? UNP Q6Q546 ? ? 'expression tag' -10 10 1 1M94 SER A 11 ? UNP Q6Q546 ? ? 'expression tag' -9 11 1 1M94 SER A 12 ? UNP Q6Q546 ? ? 'expression tag' -8 12 1 1M94 GLY A 13 ? UNP Q6Q546 ? ? 'expression tag' -7 13 1 1M94 LEU A 14 ? UNP Q6Q546 ? ? 'expression tag' -6 14 1 1M94 VAL A 15 ? UNP Q6Q546 ? ? 'expression tag' -5 15 1 1M94 PRO A 16 ? UNP Q6Q546 ? ? 'expression tag' -4 16 1 1M94 ARG A 17 ? UNP Q6Q546 ? ? 'expression tag' -3 17 1 1M94 GLY A 18 ? UNP Q6Q546 ? ? 'expression tag' -2 18 1 1M94 SER A 19 ? UNP Q6Q546 ? ? 'expression tag' -1 19 1 1M94 HIS A 20 ? UNP Q6Q546 ? ? 'expression tag' 0 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 HNHA 3 1 1 3D_13C-separated_NOESY 4 2 1 4D_13C/15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10 mM NaOAc, 300 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1-3 mM Hub1, U-15N, 13C, NaOAc, pH 5.0' '90% H2O, 10% D20' 2 '1-3 mM Hub1, U-15N, 13C, NaOAc, pH* 4.6' '99% H2O, 1% D20' 3 '1-3 mM Hub1, U-15N, NaOAc, pH 5.0' '90% H2O, 10% D20' 4 '1-3 mM Hub1, U-15N, 10%-13C, NaOAc, pH 5.0' '90% H2O, 10% D20' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 800 2 ? Varian INOVA 750 3 ? Varian INOVA 600 # _pdbx_nmr_refine.entry_id 1M94 _pdbx_nmr_refine.method 'distance geometry and simulated annealing' _pdbx_nmr_refine.details ;THE STRUCTURES ARE BASED ON A TOTAL OF 869 RESTRAINTS. SUMMARY OF EXPERIMENTAL CONSTRAINTS: DISTANCE CONSTRAINTS: TOTAL = 783; INTRA-RESIDUE [I=J] = 4; SEQUENTIAL [(I-J)=1] = 229; MEDIUM RANGE [1<(I-J)<5] = 159; LONG RANGE [(I-J)>=5] = 333; HYDROGEN BOND CONSTRAINTS = 58 (2 PER H-BOND); NUMBER OF DISTANCE CONSTRAINTS PER RESIDUE = 10.7; DIHEDRAL-ANGLE CONSTRAINTS = 86 (50 PHI, 36 PSI); TOTAL NUMBER OF CONSTRAINTS PER RESIDUE = 11.9; NUMBER OF LONG RANGE CONSTRAINTS PER RESIDUE = 4.6; NUMBER OF STRUCTURES COMPUTED = 20; NUMBER OF STRUCTURES USED = 20. AVERAGE DISTANCE VIOLATIONS >0 ANG = 22.9; AVERAGE R.M.S. DISTANCE VIOLATION = 0.006 ANG; MAXIMUM NUMBER OF DISTANCE VIOLATIONS 28. AVERAGE DIHEDRAL ANGLE VIOLATIONS: >0 DEG = 4.6; MAX NUMBER OF ANGLE VIOLATION = 7 DEG; AVERAGE R.M.S. ANGLE VIOLATION = 0.14 DEG. RMSD VALUES: BACKBONE ATOMS (N,C,C',O) = 0.61 ANG; ALL HEAVY ATOMS = 1.17 ANG; PROCHECK: MOST FAVORED REGIONS = 92%; ADDITIONAL ALLOWED REGIONS = 4%; GENEROUSLY ALLOWED REGIONS = 2%; DISALLOWED REGIONS = 2%. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1M94 _pdbx_nmr_details.text '1H-13C HSQC on 10% C13, U-15N sample for stereospecific assignments of Leu and Val' # _pdbx_nmr_ensemble.entry_id 1M94 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1M94 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.84 'structure solution' 'Brunger, A.T.' 1 Felix 98 processing MSI 2 VNMR 6.1C collection Varian 3 Sparky 3.98 'data analysis' 'Goddard, Kneller' 4 X-PLOR 3.84 refinement 'Brunger, A.T.' 5 # _exptl.entry_id 1M94 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1M94 _struct.title 'Solution Structure of the Yeast Ubiquitin-Like Modifier Protein Hub1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1M94 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, SIGNALING PROTEIN' _struct_keywords.text ;ubiquitin-like fold or beta-grasp fold, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 43 ? GLY A 56 ? SER A 23 GLY A 36 1 ? 14 HELX_P HELX_P2 2 SER A 76 ? GLU A 81 ? SER A 56 GLU A 61 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 32 ? CYS A 38 ? LYS A 12 CYS A 18 A 2 ILE A 22 ? ASP A 28 ? ILE A 2 ASP A 8 A 3 THR A 86 ? TYR A 92 ? THR A 66 TYR A 72 A 4 ILE A 62 ? GLN A 65 ? ILE A 42 GLN A 45 A 5 VAL A 70 ? LEU A 71 ? VAL A 50 LEU A 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O CYS A 38 ? O CYS A 18 N ILE A 22 ? N ILE A 2 A 2 3 N VAL A 25 ? N VAL A 5 O LEU A 88 ? O LEU A 68 A 3 4 O TYR A 91 ? O TYR A 71 N VAL A 63 ? N VAL A 43 A 4 5 N LEU A 64 ? N LEU A 44 O LEU A 71 ? O LEU A 51 # _database_PDB_matrix.entry_id 1M94 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1M94 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 ILE 22 2 2 ILE ILE A . n A 1 23 GLU 23 3 3 GLU GLU A . n A 1 24 VAL 24 4 4 VAL VAL A . n A 1 25 VAL 25 5 5 VAL VAL A . n A 1 26 VAL 26 6 6 VAL VAL A . n A 1 27 ASN 27 7 7 ASN ASN A . n A 1 28 ASP 28 8 8 ASP ASP A . n A 1 29 ARG 29 9 9 ARG ARG A . n A 1 30 LEU 30 10 10 LEU LEU A . n A 1 31 GLY 31 11 11 GLY GLY A . n A 1 32 LYS 32 12 12 LYS LYS A . n A 1 33 LYS 33 13 13 LYS LYS A . n A 1 34 VAL 34 14 14 VAL VAL A . n A 1 35 ARG 35 15 15 ARG ARG A . n A 1 36 VAL 36 16 16 VAL VAL A . n A 1 37 LYS 37 17 17 LYS LYS A . n A 1 38 CYS 38 18 18 CYS CYS A . n A 1 39 LEU 39 19 19 LEU LEU A . n A 1 40 ALA 40 20 20 ALA ALA A . n A 1 41 GLU 41 21 21 GLU GLU A . n A 1 42 ASP 42 22 22 ASP ASP A . n A 1 43 SER 43 23 23 SER SER A . n A 1 44 VAL 44 24 24 VAL VAL A . n A 1 45 GLY 45 25 25 GLY GLY A . n A 1 46 ASP 46 26 26 ASP ASP A . n A 1 47 PHE 47 27 27 PHE PHE A . n A 1 48 LYS 48 28 28 LYS LYS A . n A 1 49 LYS 49 29 29 LYS LYS A . n A 1 50 VAL 50 30 30 VAL VAL A . n A 1 51 LEU 51 31 31 LEU LEU A . n A 1 52 SER 52 32 32 SER SER A . n A 1 53 LEU 53 33 33 LEU LEU A . n A 1 54 GLN 54 34 34 GLN GLN A . n A 1 55 ILE 55 35 35 ILE ILE A . n A 1 56 GLY 56 36 36 GLY GLY A . n A 1 57 THR 57 37 37 THR THR A . n A 1 58 GLN 58 38 38 GLN GLN A . n A 1 59 PRO 59 39 39 PRO PRO A . n A 1 60 ASN 60 40 40 ASN ASN A . n A 1 61 LYS 61 41 41 LYS LYS A . n A 1 62 ILE 62 42 42 ILE ILE A . n A 1 63 VAL 63 43 43 VAL VAL A . n A 1 64 LEU 64 44 44 LEU LEU A . n A 1 65 GLN 65 45 45 GLN GLN A . n A 1 66 LYS 66 46 46 LYS LYS A . n A 1 67 GLY 67 47 47 GLY GLY A . n A 1 68 GLY 68 48 48 GLY GLY A . n A 1 69 SER 69 49 49 SER SER A . n A 1 70 VAL 70 50 50 VAL VAL A . n A 1 71 LEU 71 51 51 LEU LEU A . n A 1 72 LYS 72 52 52 LYS LYS A . n A 1 73 ASP 73 53 53 ASP ASP A . n A 1 74 HIS 74 54 54 HIS HIS A . n A 1 75 ILE 75 55 55 ILE ILE A . n A 1 76 SER 76 56 56 SER SER A . n A 1 77 LEU 77 57 57 LEU LEU A . n A 1 78 GLU 78 58 58 GLU GLU A . n A 1 79 ASP 79 59 59 ASP ASP A . n A 1 80 TYR 80 60 60 TYR TYR A . n A 1 81 GLU 81 61 61 GLU GLU A . n A 1 82 VAL 82 62 62 VAL VAL A . n A 1 83 HIS 83 63 63 HIS HIS A . n A 1 84 ASP 84 64 64 ASP ASP A . n A 1 85 GLN 85 65 65 GLN GLN A . n A 1 86 THR 86 66 66 THR THR A . n A 1 87 ASN 87 67 67 ASN ASN A . n A 1 88 LEU 88 68 68 LEU LEU A . n A 1 89 GLU 89 69 69 GLU GLU A . n A 1 90 LEU 90 70 70 LEU LEU A . n A 1 91 TYR 91 71 71 TYR TYR A . n A 1 92 TYR 92 72 72 TYR TYR A . n A 1 93 LEU 93 73 73 LEU LEU A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-12-11 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 18 ? ? -163.10 -153.51 2 1 GLN A 38 ? ? 66.31 152.29 3 1 GLU A 61 ? ? 78.52 67.07 4 2 GLN A 38 ? ? 67.69 155.95 5 2 ASN A 40 ? ? -166.61 -43.71 6 2 GLU A 61 ? ? 73.04 75.95 7 3 ASP A 8 ? ? -78.30 -77.44 8 3 ARG A 9 ? ? -174.11 -54.52 9 3 GLN A 38 ? ? 66.00 152.10 10 3 GLU A 61 ? ? 75.85 55.97 11 4 GLN A 38 ? ? 68.18 149.71 12 4 GLU A 61 ? ? 75.46 56.01 13 5 GLN A 38 ? ? 70.81 150.86 14 5 ASN A 40 ? ? -152.31 -45.75 15 5 GLU A 61 ? ? 71.93 64.84 16 6 LEU A 10 ? ? -134.06 -57.17 17 6 GLN A 38 ? ? 65.35 154.09 18 6 GLU A 61 ? ? 72.30 68.50 19 7 GLN A 38 ? ? 71.50 153.55 20 7 ASN A 40 ? ? -173.90 -41.75 21 7 GLU A 61 ? ? 77.33 62.76 22 8 GLN A 38 ? ? 66.69 156.32 23 8 GLU A 61 ? ? 83.04 71.87 24 9 GLN A 38 ? ? 67.85 150.15 25 9 ASN A 40 ? ? -160.82 -42.85 26 9 GLU A 61 ? ? 72.37 76.29 27 10 ARG A 9 ? ? -162.26 -64.46 28 10 GLN A 38 ? ? 67.36 156.02 29 10 GLU A 61 ? ? 72.48 54.21 30 11 ARG A 9 ? ? -138.96 -66.66 31 11 GLN A 38 ? ? 65.44 154.90 32 11 GLU A 61 ? ? 82.12 75.52 33 12 ARG A 9 ? ? -136.31 -66.63 34 12 LEU A 10 ? ? -161.65 114.44 35 12 GLN A 38 ? ? 70.78 156.07 36 12 ASN A 40 ? ? -164.66 -46.61 37 12 GLU A 61 ? ? 77.22 68.56 38 13 LEU A 10 ? ? -155.29 -60.64 39 13 GLN A 38 ? ? 71.22 149.78 40 13 ASN A 40 ? ? -167.48 -43.69 41 13 GLU A 61 ? ? 74.15 76.59 42 14 GLN A 38 ? ? 63.67 155.88 43 14 ASN A 40 ? ? -169.27 -41.73 44 14 GLU A 61 ? ? 73.79 64.77 45 15 GLN A 38 ? ? 66.96 154.53 46 15 GLU A 61 ? ? 83.85 63.42 47 16 LEU A 10 ? ? 57.00 72.65 48 16 GLN A 38 ? ? 68.05 153.97 49 16 GLU A 61 ? ? 73.39 76.42 50 17 ARG A 9 ? ? -128.79 -63.06 51 17 LEU A 10 ? ? -158.36 -63.82 52 17 GLN A 38 ? ? 66.30 156.26 53 17 GLU A 61 ? ? 77.82 64.15 54 18 GLN A 38 ? ? 66.12 153.58 55 18 GLU A 61 ? ? 70.17 66.96 56 19 ARG A 9 ? ? -153.29 -63.42 57 19 LEU A 10 ? ? -166.46 113.93 58 19 GLN A 38 ? ? 65.97 156.47 59 19 GLU A 61 ? ? 75.80 70.46 60 20 ASP A 8 ? ? -78.14 -80.79 61 20 ARG A 9 ? ? -176.28 -55.34 62 20 GLN A 38 ? ? 66.13 153.26 63 20 GLU A 61 ? ? 75.69 64.37 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 9 ? ? 0.305 'SIDE CHAIN' 2 1 ARG A 15 ? ? 0.307 'SIDE CHAIN' 3 2 ARG A 9 ? ? 0.259 'SIDE CHAIN' 4 2 ARG A 15 ? ? 0.305 'SIDE CHAIN' 5 3 ARG A 9 ? ? 0.314 'SIDE CHAIN' 6 3 ARG A 15 ? ? 0.247 'SIDE CHAIN' 7 4 ARG A 9 ? ? 0.317 'SIDE CHAIN' 8 4 ARG A 15 ? ? 0.308 'SIDE CHAIN' 9 5 ARG A 9 ? ? 0.318 'SIDE CHAIN' 10 5 ARG A 15 ? ? 0.319 'SIDE CHAIN' 11 6 ARG A 9 ? ? 0.317 'SIDE CHAIN' 12 6 ARG A 15 ? ? 0.304 'SIDE CHAIN' 13 7 ARG A 9 ? ? 0.306 'SIDE CHAIN' 14 7 ARG A 15 ? ? 0.316 'SIDE CHAIN' 15 8 ARG A 9 ? ? 0.314 'SIDE CHAIN' 16 8 ARG A 15 ? ? 0.309 'SIDE CHAIN' 17 9 ARG A 9 ? ? 0.318 'SIDE CHAIN' 18 9 ARG A 15 ? ? 0.288 'SIDE CHAIN' 19 10 ARG A 9 ? ? 0.315 'SIDE CHAIN' 20 10 ARG A 15 ? ? 0.311 'SIDE CHAIN' 21 11 ARG A 9 ? ? 0.312 'SIDE CHAIN' 22 11 ARG A 15 ? ? 0.315 'SIDE CHAIN' 23 12 ARG A 9 ? ? 0.291 'SIDE CHAIN' 24 12 ARG A 15 ? ? 0.316 'SIDE CHAIN' 25 13 ARG A 9 ? ? 0.251 'SIDE CHAIN' 26 13 ARG A 15 ? ? 0.296 'SIDE CHAIN' 27 14 ARG A 9 ? ? 0.313 'SIDE CHAIN' 28 14 ARG A 15 ? ? 0.315 'SIDE CHAIN' 29 15 ARG A 9 ? ? 0.299 'SIDE CHAIN' 30 15 ARG A 15 ? ? 0.316 'SIDE CHAIN' 31 16 ARG A 9 ? ? 0.317 'SIDE CHAIN' 32 16 ARG A 15 ? ? 0.312 'SIDE CHAIN' 33 17 ARG A 9 ? ? 0.316 'SIDE CHAIN' 34 17 ARG A 15 ? ? 0.317 'SIDE CHAIN' 35 18 ARG A 9 ? ? 0.308 'SIDE CHAIN' 36 18 ARG A 15 ? ? 0.294 'SIDE CHAIN' 37 19 ARG A 9 ? ? 0.314 'SIDE CHAIN' 38 19 ARG A 15 ? ? 0.310 'SIDE CHAIN' 39 20 ARG A 9 ? ? 0.312 'SIDE CHAIN' 40 20 ARG A 15 ? ? 0.316 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 2 Y 1 A MET -19 ? A MET 1 22 2 Y 1 A GLY -18 ? A GLY 2 23 2 Y 1 A SER -17 ? A SER 3 24 2 Y 1 A SER -16 ? A SER 4 25 2 Y 1 A HIS -15 ? A HIS 5 26 2 Y 1 A HIS -14 ? A HIS 6 27 2 Y 1 A HIS -13 ? A HIS 7 28 2 Y 1 A HIS -12 ? A HIS 8 29 2 Y 1 A HIS -11 ? A HIS 9 30 2 Y 1 A HIS -10 ? A HIS 10 31 2 Y 1 A SER -9 ? A SER 11 32 2 Y 1 A SER -8 ? A SER 12 33 2 Y 1 A GLY -7 ? A GLY 13 34 2 Y 1 A LEU -6 ? A LEU 14 35 2 Y 1 A VAL -5 ? A VAL 15 36 2 Y 1 A PRO -4 ? A PRO 16 37 2 Y 1 A ARG -3 ? A ARG 17 38 2 Y 1 A GLY -2 ? A GLY 18 39 2 Y 1 A SER -1 ? A SER 19 40 2 Y 1 A HIS 0 ? A HIS 20 41 3 Y 1 A MET -19 ? A MET 1 42 3 Y 1 A GLY -18 ? A GLY 2 43 3 Y 1 A SER -17 ? A SER 3 44 3 Y 1 A SER -16 ? A SER 4 45 3 Y 1 A HIS -15 ? A HIS 5 46 3 Y 1 A HIS -14 ? A HIS 6 47 3 Y 1 A HIS -13 ? A HIS 7 48 3 Y 1 A HIS -12 ? A HIS 8 49 3 Y 1 A HIS -11 ? A HIS 9 50 3 Y 1 A HIS -10 ? A HIS 10 51 3 Y 1 A SER -9 ? A SER 11 52 3 Y 1 A SER -8 ? A SER 12 53 3 Y 1 A GLY -7 ? A GLY 13 54 3 Y 1 A LEU -6 ? A LEU 14 55 3 Y 1 A VAL -5 ? A VAL 15 56 3 Y 1 A PRO -4 ? A PRO 16 57 3 Y 1 A ARG -3 ? A ARG 17 58 3 Y 1 A GLY -2 ? A GLY 18 59 3 Y 1 A SER -1 ? A SER 19 60 3 Y 1 A HIS 0 ? A HIS 20 61 4 Y 1 A MET -19 ? A MET 1 62 4 Y 1 A GLY -18 ? A GLY 2 63 4 Y 1 A SER -17 ? A SER 3 64 4 Y 1 A SER -16 ? A SER 4 65 4 Y 1 A HIS -15 ? A HIS 5 66 4 Y 1 A HIS -14 ? A HIS 6 67 4 Y 1 A HIS -13 ? A HIS 7 68 4 Y 1 A HIS -12 ? A HIS 8 69 4 Y 1 A HIS -11 ? A HIS 9 70 4 Y 1 A HIS -10 ? A HIS 10 71 4 Y 1 A SER -9 ? A SER 11 72 4 Y 1 A SER -8 ? A SER 12 73 4 Y 1 A GLY -7 ? A GLY 13 74 4 Y 1 A LEU -6 ? A LEU 14 75 4 Y 1 A VAL -5 ? A VAL 15 76 4 Y 1 A PRO -4 ? A PRO 16 77 4 Y 1 A ARG -3 ? A ARG 17 78 4 Y 1 A GLY -2 ? A GLY 18 79 4 Y 1 A SER -1 ? A SER 19 80 4 Y 1 A HIS 0 ? A HIS 20 81 5 Y 1 A MET -19 ? A MET 1 82 5 Y 1 A GLY -18 ? A GLY 2 83 5 Y 1 A SER -17 ? A SER 3 84 5 Y 1 A SER -16 ? A SER 4 85 5 Y 1 A HIS -15 ? A HIS 5 86 5 Y 1 A HIS -14 ? A HIS 6 87 5 Y 1 A HIS -13 ? A HIS 7 88 5 Y 1 A HIS -12 ? A HIS 8 89 5 Y 1 A HIS -11 ? A HIS 9 90 5 Y 1 A HIS -10 ? A HIS 10 91 5 Y 1 A SER -9 ? A SER 11 92 5 Y 1 A SER -8 ? A SER 12 93 5 Y 1 A GLY -7 ? A GLY 13 94 5 Y 1 A LEU -6 ? A LEU 14 95 5 Y 1 A VAL -5 ? A VAL 15 96 5 Y 1 A PRO -4 ? A PRO 16 97 5 Y 1 A ARG -3 ? A ARG 17 98 5 Y 1 A GLY -2 ? A GLY 18 99 5 Y 1 A SER -1 ? A SER 19 100 5 Y 1 A HIS 0 ? A HIS 20 101 6 Y 1 A MET -19 ? A MET 1 102 6 Y 1 A GLY -18 ? A GLY 2 103 6 Y 1 A SER -17 ? A SER 3 104 6 Y 1 A SER -16 ? A SER 4 105 6 Y 1 A HIS -15 ? A HIS 5 106 6 Y 1 A HIS -14 ? A HIS 6 107 6 Y 1 A HIS -13 ? A HIS 7 108 6 Y 1 A HIS -12 ? A HIS 8 109 6 Y 1 A HIS -11 ? A HIS 9 110 6 Y 1 A HIS -10 ? A HIS 10 111 6 Y 1 A SER -9 ? A SER 11 112 6 Y 1 A SER -8 ? A SER 12 113 6 Y 1 A GLY -7 ? A GLY 13 114 6 Y 1 A LEU -6 ? A LEU 14 115 6 Y 1 A VAL -5 ? A VAL 15 116 6 Y 1 A PRO -4 ? A PRO 16 117 6 Y 1 A ARG -3 ? A ARG 17 118 6 Y 1 A GLY -2 ? A GLY 18 119 6 Y 1 A SER -1 ? A SER 19 120 6 Y 1 A HIS 0 ? A HIS 20 121 7 Y 1 A MET -19 ? A MET 1 122 7 Y 1 A GLY -18 ? A GLY 2 123 7 Y 1 A SER -17 ? A SER 3 124 7 Y 1 A SER -16 ? A SER 4 125 7 Y 1 A HIS -15 ? A HIS 5 126 7 Y 1 A HIS -14 ? A HIS 6 127 7 Y 1 A HIS -13 ? A HIS 7 128 7 Y 1 A HIS -12 ? A HIS 8 129 7 Y 1 A HIS -11 ? A HIS 9 130 7 Y 1 A HIS -10 ? A HIS 10 131 7 Y 1 A SER -9 ? A SER 11 132 7 Y 1 A SER -8 ? A SER 12 133 7 Y 1 A GLY -7 ? A GLY 13 134 7 Y 1 A LEU -6 ? A LEU 14 135 7 Y 1 A VAL -5 ? A VAL 15 136 7 Y 1 A PRO -4 ? A PRO 16 137 7 Y 1 A ARG -3 ? A ARG 17 138 7 Y 1 A GLY -2 ? A GLY 18 139 7 Y 1 A SER -1 ? A SER 19 140 7 Y 1 A HIS 0 ? A HIS 20 141 8 Y 1 A MET -19 ? A MET 1 142 8 Y 1 A GLY -18 ? A GLY 2 143 8 Y 1 A SER -17 ? A SER 3 144 8 Y 1 A SER -16 ? A SER 4 145 8 Y 1 A HIS -15 ? A HIS 5 146 8 Y 1 A HIS -14 ? A HIS 6 147 8 Y 1 A HIS -13 ? A HIS 7 148 8 Y 1 A HIS -12 ? A HIS 8 149 8 Y 1 A HIS -11 ? A HIS 9 150 8 Y 1 A HIS -10 ? A HIS 10 151 8 Y 1 A SER -9 ? A SER 11 152 8 Y 1 A SER -8 ? A SER 12 153 8 Y 1 A GLY -7 ? A GLY 13 154 8 Y 1 A LEU -6 ? A LEU 14 155 8 Y 1 A VAL -5 ? A VAL 15 156 8 Y 1 A PRO -4 ? A PRO 16 157 8 Y 1 A ARG -3 ? A ARG 17 158 8 Y 1 A GLY -2 ? A GLY 18 159 8 Y 1 A SER -1 ? A SER 19 160 8 Y 1 A HIS 0 ? A HIS 20 161 9 Y 1 A MET -19 ? A MET 1 162 9 Y 1 A GLY -18 ? A GLY 2 163 9 Y 1 A SER -17 ? A SER 3 164 9 Y 1 A SER -16 ? A SER 4 165 9 Y 1 A HIS -15 ? A HIS 5 166 9 Y 1 A HIS -14 ? A HIS 6 167 9 Y 1 A HIS -13 ? A HIS 7 168 9 Y 1 A HIS -12 ? A HIS 8 169 9 Y 1 A HIS -11 ? A HIS 9 170 9 Y 1 A HIS -10 ? A HIS 10 171 9 Y 1 A SER -9 ? A SER 11 172 9 Y 1 A SER -8 ? A SER 12 173 9 Y 1 A GLY -7 ? A GLY 13 174 9 Y 1 A LEU -6 ? A LEU 14 175 9 Y 1 A VAL -5 ? A VAL 15 176 9 Y 1 A PRO -4 ? A PRO 16 177 9 Y 1 A ARG -3 ? A ARG 17 178 9 Y 1 A GLY -2 ? A GLY 18 179 9 Y 1 A SER -1 ? A SER 19 180 9 Y 1 A HIS 0 ? A HIS 20 181 10 Y 1 A MET -19 ? A MET 1 182 10 Y 1 A GLY -18 ? A GLY 2 183 10 Y 1 A SER -17 ? A SER 3 184 10 Y 1 A SER -16 ? A SER 4 185 10 Y 1 A HIS -15 ? A HIS 5 186 10 Y 1 A HIS -14 ? A HIS 6 187 10 Y 1 A HIS -13 ? A HIS 7 188 10 Y 1 A HIS -12 ? A HIS 8 189 10 Y 1 A HIS -11 ? A HIS 9 190 10 Y 1 A HIS -10 ? A HIS 10 191 10 Y 1 A SER -9 ? A SER 11 192 10 Y 1 A SER -8 ? A SER 12 193 10 Y 1 A GLY -7 ? A GLY 13 194 10 Y 1 A LEU -6 ? A LEU 14 195 10 Y 1 A VAL -5 ? A VAL 15 196 10 Y 1 A PRO -4 ? A PRO 16 197 10 Y 1 A ARG -3 ? A ARG 17 198 10 Y 1 A GLY -2 ? A GLY 18 199 10 Y 1 A SER -1 ? A SER 19 200 10 Y 1 A HIS 0 ? A HIS 20 201 11 Y 1 A MET -19 ? A MET 1 202 11 Y 1 A GLY -18 ? A GLY 2 203 11 Y 1 A SER -17 ? A SER 3 204 11 Y 1 A SER -16 ? A SER 4 205 11 Y 1 A HIS -15 ? A HIS 5 206 11 Y 1 A HIS -14 ? A HIS 6 207 11 Y 1 A HIS -13 ? A HIS 7 208 11 Y 1 A HIS -12 ? A HIS 8 209 11 Y 1 A HIS -11 ? A HIS 9 210 11 Y 1 A HIS -10 ? A HIS 10 211 11 Y 1 A SER -9 ? A SER 11 212 11 Y 1 A SER -8 ? A SER 12 213 11 Y 1 A GLY -7 ? A GLY 13 214 11 Y 1 A LEU -6 ? A LEU 14 215 11 Y 1 A VAL -5 ? A VAL 15 216 11 Y 1 A PRO -4 ? A PRO 16 217 11 Y 1 A ARG -3 ? A ARG 17 218 11 Y 1 A GLY -2 ? A GLY 18 219 11 Y 1 A SER -1 ? A SER 19 220 11 Y 1 A HIS 0 ? A HIS 20 221 12 Y 1 A MET -19 ? A MET 1 222 12 Y 1 A GLY -18 ? A GLY 2 223 12 Y 1 A SER -17 ? A SER 3 224 12 Y 1 A SER -16 ? A SER 4 225 12 Y 1 A HIS -15 ? A HIS 5 226 12 Y 1 A HIS -14 ? A HIS 6 227 12 Y 1 A HIS -13 ? A HIS 7 228 12 Y 1 A HIS -12 ? A HIS 8 229 12 Y 1 A HIS -11 ? A HIS 9 230 12 Y 1 A HIS -10 ? A HIS 10 231 12 Y 1 A SER -9 ? A SER 11 232 12 Y 1 A SER -8 ? A SER 12 233 12 Y 1 A GLY -7 ? A GLY 13 234 12 Y 1 A LEU -6 ? A LEU 14 235 12 Y 1 A VAL -5 ? A VAL 15 236 12 Y 1 A PRO -4 ? A PRO 16 237 12 Y 1 A ARG -3 ? A ARG 17 238 12 Y 1 A GLY -2 ? A GLY 18 239 12 Y 1 A SER -1 ? A SER 19 240 12 Y 1 A HIS 0 ? A HIS 20 241 13 Y 1 A MET -19 ? A MET 1 242 13 Y 1 A GLY -18 ? A GLY 2 243 13 Y 1 A SER -17 ? A SER 3 244 13 Y 1 A SER -16 ? A SER 4 245 13 Y 1 A HIS -15 ? A HIS 5 246 13 Y 1 A HIS -14 ? A HIS 6 247 13 Y 1 A HIS -13 ? A HIS 7 248 13 Y 1 A HIS -12 ? A HIS 8 249 13 Y 1 A HIS -11 ? A HIS 9 250 13 Y 1 A HIS -10 ? A HIS 10 251 13 Y 1 A SER -9 ? A SER 11 252 13 Y 1 A SER -8 ? A SER 12 253 13 Y 1 A GLY -7 ? A GLY 13 254 13 Y 1 A LEU -6 ? A LEU 14 255 13 Y 1 A VAL -5 ? A VAL 15 256 13 Y 1 A PRO -4 ? A PRO 16 257 13 Y 1 A ARG -3 ? A ARG 17 258 13 Y 1 A GLY -2 ? A GLY 18 259 13 Y 1 A SER -1 ? A SER 19 260 13 Y 1 A HIS 0 ? A HIS 20 261 14 Y 1 A MET -19 ? A MET 1 262 14 Y 1 A GLY -18 ? A GLY 2 263 14 Y 1 A SER -17 ? A SER 3 264 14 Y 1 A SER -16 ? A SER 4 265 14 Y 1 A HIS -15 ? A HIS 5 266 14 Y 1 A HIS -14 ? A HIS 6 267 14 Y 1 A HIS -13 ? A HIS 7 268 14 Y 1 A HIS -12 ? A HIS 8 269 14 Y 1 A HIS -11 ? A HIS 9 270 14 Y 1 A HIS -10 ? A HIS 10 271 14 Y 1 A SER -9 ? A SER 11 272 14 Y 1 A SER -8 ? A SER 12 273 14 Y 1 A GLY -7 ? A GLY 13 274 14 Y 1 A LEU -6 ? A LEU 14 275 14 Y 1 A VAL -5 ? A VAL 15 276 14 Y 1 A PRO -4 ? A PRO 16 277 14 Y 1 A ARG -3 ? A ARG 17 278 14 Y 1 A GLY -2 ? A GLY 18 279 14 Y 1 A SER -1 ? A SER 19 280 14 Y 1 A HIS 0 ? A HIS 20 281 15 Y 1 A MET -19 ? A MET 1 282 15 Y 1 A GLY -18 ? A GLY 2 283 15 Y 1 A SER -17 ? A SER 3 284 15 Y 1 A SER -16 ? A SER 4 285 15 Y 1 A HIS -15 ? A HIS 5 286 15 Y 1 A HIS -14 ? A HIS 6 287 15 Y 1 A HIS -13 ? A HIS 7 288 15 Y 1 A HIS -12 ? A HIS 8 289 15 Y 1 A HIS -11 ? A HIS 9 290 15 Y 1 A HIS -10 ? A HIS 10 291 15 Y 1 A SER -9 ? A SER 11 292 15 Y 1 A SER -8 ? A SER 12 293 15 Y 1 A GLY -7 ? A GLY 13 294 15 Y 1 A LEU -6 ? A LEU 14 295 15 Y 1 A VAL -5 ? A VAL 15 296 15 Y 1 A PRO -4 ? A PRO 16 297 15 Y 1 A ARG -3 ? A ARG 17 298 15 Y 1 A GLY -2 ? A GLY 18 299 15 Y 1 A SER -1 ? A SER 19 300 15 Y 1 A HIS 0 ? A HIS 20 301 16 Y 1 A MET -19 ? A MET 1 302 16 Y 1 A GLY -18 ? A GLY 2 303 16 Y 1 A SER -17 ? A SER 3 304 16 Y 1 A SER -16 ? A SER 4 305 16 Y 1 A HIS -15 ? A HIS 5 306 16 Y 1 A HIS -14 ? A HIS 6 307 16 Y 1 A HIS -13 ? A HIS 7 308 16 Y 1 A HIS -12 ? A HIS 8 309 16 Y 1 A HIS -11 ? A HIS 9 310 16 Y 1 A HIS -10 ? A HIS 10 311 16 Y 1 A SER -9 ? A SER 11 312 16 Y 1 A SER -8 ? A SER 12 313 16 Y 1 A GLY -7 ? A GLY 13 314 16 Y 1 A LEU -6 ? A LEU 14 315 16 Y 1 A VAL -5 ? A VAL 15 316 16 Y 1 A PRO -4 ? A PRO 16 317 16 Y 1 A ARG -3 ? A ARG 17 318 16 Y 1 A GLY -2 ? A GLY 18 319 16 Y 1 A SER -1 ? A SER 19 320 16 Y 1 A HIS 0 ? A HIS 20 321 17 Y 1 A MET -19 ? A MET 1 322 17 Y 1 A GLY -18 ? A GLY 2 323 17 Y 1 A SER -17 ? A SER 3 324 17 Y 1 A SER -16 ? A SER 4 325 17 Y 1 A HIS -15 ? A HIS 5 326 17 Y 1 A HIS -14 ? A HIS 6 327 17 Y 1 A HIS -13 ? A HIS 7 328 17 Y 1 A HIS -12 ? A HIS 8 329 17 Y 1 A HIS -11 ? A HIS 9 330 17 Y 1 A HIS -10 ? A HIS 10 331 17 Y 1 A SER -9 ? A SER 11 332 17 Y 1 A SER -8 ? A SER 12 333 17 Y 1 A GLY -7 ? A GLY 13 334 17 Y 1 A LEU -6 ? A LEU 14 335 17 Y 1 A VAL -5 ? A VAL 15 336 17 Y 1 A PRO -4 ? A PRO 16 337 17 Y 1 A ARG -3 ? A ARG 17 338 17 Y 1 A GLY -2 ? A GLY 18 339 17 Y 1 A SER -1 ? A SER 19 340 17 Y 1 A HIS 0 ? A HIS 20 341 18 Y 1 A MET -19 ? A MET 1 342 18 Y 1 A GLY -18 ? A GLY 2 343 18 Y 1 A SER -17 ? A SER 3 344 18 Y 1 A SER -16 ? A SER 4 345 18 Y 1 A HIS -15 ? A HIS 5 346 18 Y 1 A HIS -14 ? A HIS 6 347 18 Y 1 A HIS -13 ? A HIS 7 348 18 Y 1 A HIS -12 ? A HIS 8 349 18 Y 1 A HIS -11 ? A HIS 9 350 18 Y 1 A HIS -10 ? A HIS 10 351 18 Y 1 A SER -9 ? A SER 11 352 18 Y 1 A SER -8 ? A SER 12 353 18 Y 1 A GLY -7 ? A GLY 13 354 18 Y 1 A LEU -6 ? A LEU 14 355 18 Y 1 A VAL -5 ? A VAL 15 356 18 Y 1 A PRO -4 ? A PRO 16 357 18 Y 1 A ARG -3 ? A ARG 17 358 18 Y 1 A GLY -2 ? A GLY 18 359 18 Y 1 A SER -1 ? A SER 19 360 18 Y 1 A HIS 0 ? A HIS 20 361 19 Y 1 A MET -19 ? A MET 1 362 19 Y 1 A GLY -18 ? A GLY 2 363 19 Y 1 A SER -17 ? A SER 3 364 19 Y 1 A SER -16 ? A SER 4 365 19 Y 1 A HIS -15 ? A HIS 5 366 19 Y 1 A HIS -14 ? A HIS 6 367 19 Y 1 A HIS -13 ? A HIS 7 368 19 Y 1 A HIS -12 ? A HIS 8 369 19 Y 1 A HIS -11 ? A HIS 9 370 19 Y 1 A HIS -10 ? A HIS 10 371 19 Y 1 A SER -9 ? A SER 11 372 19 Y 1 A SER -8 ? A SER 12 373 19 Y 1 A GLY -7 ? A GLY 13 374 19 Y 1 A LEU -6 ? A LEU 14 375 19 Y 1 A VAL -5 ? A VAL 15 376 19 Y 1 A PRO -4 ? A PRO 16 377 19 Y 1 A ARG -3 ? A ARG 17 378 19 Y 1 A GLY -2 ? A GLY 18 379 19 Y 1 A SER -1 ? A SER 19 380 19 Y 1 A HIS 0 ? A HIS 20 381 20 Y 1 A MET -19 ? A MET 1 382 20 Y 1 A GLY -18 ? A GLY 2 383 20 Y 1 A SER -17 ? A SER 3 384 20 Y 1 A SER -16 ? A SER 4 385 20 Y 1 A HIS -15 ? A HIS 5 386 20 Y 1 A HIS -14 ? A HIS 6 387 20 Y 1 A HIS -13 ? A HIS 7 388 20 Y 1 A HIS -12 ? A HIS 8 389 20 Y 1 A HIS -11 ? A HIS 9 390 20 Y 1 A HIS -10 ? A HIS 10 391 20 Y 1 A SER -9 ? A SER 11 392 20 Y 1 A SER -8 ? A SER 12 393 20 Y 1 A GLY -7 ? A GLY 13 394 20 Y 1 A LEU -6 ? A LEU 14 395 20 Y 1 A VAL -5 ? A VAL 15 396 20 Y 1 A PRO -4 ? A PRO 16 397 20 Y 1 A ARG -3 ? A ARG 17 398 20 Y 1 A GLY -2 ? A GLY 18 399 20 Y 1 A SER -1 ? A SER 19 400 20 Y 1 A HIS 0 ? A HIS 20 #