data_1MBE # _entry.id 1MBE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1MBE WWPDB D_1000174920 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1MBF _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1MBE _pdbx_database_status.recvd_initial_deposition_date 1995-05-19 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ogata, K.' 1 'Morikawa, S.' 2 'Nakamura, H.' 3 'Hojo, H.' 4 'Yoshimura, S.' 5 'Zhang, R.' 6 'Aimoto, S.' 7 'Ametani, Y.' 8 'Hirata, Z.' 9 'Sarai, A.' 10 'Ishii, S.' 11 'Nishimura, Y.' 12 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.' Nat.Struct.Biol. 2 309 320 1995 NSBIEW US 1072-8368 2024 ? 7796266 10.1038/nsb0495-309 1 'Solution Structure of a Specific DNA Complex of the Myb DNA-Binding Domain with Cooperative Recognition Helices' 'Cell(Cambridge,Mass.)' 79 639 ? 1994 CELLB5 US 0092-8674 0998 ? ? ? 2 ;Solution Structure of a DNA-Binding Unit of Myb: A Helix-Turn-Helix-Related Motif with Conserved Tryptophans Forming a Hydrophobic Core ; Proc.Natl.Acad.Sci.USA 89 6428 ? 1992 PNASA6 US 0027-8424 0040 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ogata, K.' 1 primary 'Morikawa, S.' 2 primary 'Nakamura, H.' 3 primary 'Hojo, H.' 4 primary 'Yoshimura, S.' 5 primary 'Zhang, R.' 6 primary 'Aimoto, S.' 7 primary 'Ametani, Y.' 8 primary 'Hirata, Z.' 9 primary 'Sarai, A.' 10 primary 'Ishii, S.' 11 primary 'Nishimura, Y.' 12 1 'Ogata, K.' 13 1 'Morikawa, S.' 14 1 'Nakamura, H.' 15 1 'Sekikawa, A.' 16 1 'Inoue, T.' 17 1 'Kanai, H.' 18 1 'Sarai, A.' 19 1 'Ishii, S.' 20 1 'Nishimura, Y.' 21 2 'Ogata, K.' 22 2 'Hojo, H.' 23 2 'Aimoto, S.' 24 2 'Nakai, T.' 25 2 'Nakamura, H.' 26 2 'Sarai, A.' 27 2 'Ishii, S.' 28 2 'Nishimura, Y.' 29 # _cell.entry_id 1MBE _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1MBE _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'MYB PROTO-ONCOGENE PROTEIN' _entity.formula_weight 6317.113 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'GENE C-MYB, NMR, MINIMIZED AVERAGE STRUCTURE; ENGINEERED' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'LGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPE(NH2)' _entity_poly.pdbx_seq_one_letter_code_can LGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPEX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 GLY n 1 3 LYS n 1 4 THR n 1 5 ARG n 1 6 TRP n 1 7 THR n 1 8 ARG n 1 9 GLU n 1 10 GLU n 1 11 ASP n 1 12 GLU n 1 13 LYS n 1 14 LEU n 1 15 LYS n 1 16 LYS n 1 17 LEU n 1 18 VAL n 1 19 GLU n 1 20 GLN n 1 21 ASN n 1 22 GLY n 1 23 THR n 1 24 ASP n 1 25 ASP n 1 26 TRP n 1 27 LYS n 1 28 VAL n 1 29 ILE n 1 30 ALA n 1 31 ASN n 1 32 TYR n 1 33 LEU n 1 34 PRO n 1 35 ASN n 1 36 ARG n 1 37 THR n 1 38 ASP n 1 39 VAL n 1 40 GLN n 1 41 CYS n 1 42 GLN n 1 43 HIS n 1 44 ARG n 1 45 TRP n 1 46 GLN n 1 47 LYS n 1 48 VAL n 1 49 LEU n 1 50 ASN n 1 51 PRO n 1 52 GLU n 1 53 NH2 n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'house mouse' _entity_src_nat.pdbx_organism_scientific 'Mus musculus' _entity_src_nat.pdbx_ncbi_taxonomy_id 10090 _entity_src_nat.genus Mus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYB_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P06876 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MARRPRHSIYSSDEDDEDIEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQH RWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHK RLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQEPSKASQTPVATSFQKNNHLMGFGHASPPSQLSPSGQSSV NSEYPYYHIAEAQNISSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQALPTQNH TCSYPGWHSTSIVDQTRPHGDSAPVSCLGEHHATPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFID SFLNTSSNHESSGLDAPTLPSTPLIGHKLTPCRDQTVKTQKENSIFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPL KMLPQTPSHAVEDLQDVIKRESDESGIVAEFQESGPPLLKKIKQEVESPTEKSGNFFCSNHWAENSLSTQLFSQASPVAD APNILTSSVLMTPVSEDEDNVLKAFTVPKNRPLVGPLQPCSGAWEPASCGKTEDQMTASGPARKYVNAFSARTLVM ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1MBE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 52 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06876 _struct_ref_seq.db_align_beg 38 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 89 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 38 _struct_ref_seq.pdbx_auth_seq_align_end 89 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 290 ? 6.8 ? ? K 2 300 ? 6.8 ? ? K # _pdbx_nmr_refine.entry_id 1MBE _pdbx_nmr_refine.method ? _pdbx_nmr_refine.details ;A TOTAL OF 50 STRUCTURES WERE CALCULATED. THE COORDINATES OF THE RESTRAINED MINIMIZED AVERAGED STRUCTURE WERE OBTAINED BY AVERAGING THE COORDINATES OF THE INDIVIDUAL STRUCTURES AND THEN BY SUBJECTING THE RESULTING COORDINATES TO THE RESTRAINED ENERGY MINIMIZATION BY PRESTO. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1MBE _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement EMBOSS ? NAKAI,KIDERA,NAKAMURA 1 refinement PRESTO ? MORIKAMI,NAKAI,KIDERA,SAITO,NAKAMURA 2 # _exptl.entry_id 1MBE _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1MBE _struct.title 'MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 1' _struct.pdbx_descriptor 'MYB PROTO-ONCOGENE PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1MBE _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'PROTOONCOGENE PRODUCT, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 ARG A 8 ? ASN A 21 ? ARG A 45 ASN A 58 1 ? 14 HELX_P HELX_P2 H2 TRP A 26 ? TYR A 32 ? TRP A 63 TYR A 69 1 ? 7 HELX_P HELX_P3 H3 ASP A 38 ? LYS A 47 ? ASP A 75 LYS A 84 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id GLU _struct_conn.ptnr1_label_seq_id 52 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id NH2 _struct_conn.ptnr2_label_seq_id 53 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id GLU _struct_conn.ptnr1_auth_seq_id 89 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NH2 _struct_conn.ptnr2_auth_seq_id 90 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.333 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 90' # _struct_site_gen.id 1 _struct_site_gen.site_id AC1 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id GLU _struct_site_gen.label_asym_id A _struct_site_gen.label_seq_id 52 _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id GLU _struct_site_gen.auth_asym_id A _struct_site_gen.auth_seq_id 89 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # _database_PDB_matrix.entry_id 1MBE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1MBE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 38 38 LEU LEU A . n A 1 2 GLY 2 39 39 GLY GLY A . n A 1 3 LYS 3 40 40 LYS LYS A . n A 1 4 THR 4 41 41 THR THR A . n A 1 5 ARG 5 42 42 ARG ARG A . n A 1 6 TRP 6 43 43 TRP TRP A . n A 1 7 THR 7 44 44 THR THR A . n A 1 8 ARG 8 45 45 ARG ARG A . n A 1 9 GLU 9 46 46 GLU GLU A . n A 1 10 GLU 10 47 47 GLU GLU A . n A 1 11 ASP 11 48 48 ASP ASP A . n A 1 12 GLU 12 49 49 GLU GLU A . n A 1 13 LYS 13 50 50 LYS LYS A . n A 1 14 LEU 14 51 51 LEU LEU A . n A 1 15 LYS 15 52 52 LYS LYS A . n A 1 16 LYS 16 53 53 LYS LYS A . n A 1 17 LEU 17 54 54 LEU LEU A . n A 1 18 VAL 18 55 55 VAL VAL A . n A 1 19 GLU 19 56 56 GLU GLU A . n A 1 20 GLN 20 57 57 GLN GLN A . n A 1 21 ASN 21 58 58 ASN ASN A . n A 1 22 GLY 22 59 59 GLY GLY A . n A 1 23 THR 23 60 60 THR THR A . n A 1 24 ASP 24 61 61 ASP ASP A . n A 1 25 ASP 25 62 62 ASP ASP A . n A 1 26 TRP 26 63 63 TRP TRP A . n A 1 27 LYS 27 64 64 LYS LYS A . n A 1 28 VAL 28 65 65 VAL VAL A . n A 1 29 ILE 29 66 66 ILE ILE A . n A 1 30 ALA 30 67 67 ALA ALA A . n A 1 31 ASN 31 68 68 ASN ASN A . n A 1 32 TYR 32 69 69 TYR TYR A . n A 1 33 LEU 33 70 70 LEU LEU A . n A 1 34 PRO 34 71 71 PRO PRO A . n A 1 35 ASN 35 72 72 ASN ASN A . n A 1 36 ARG 36 73 73 ARG ARG A . n A 1 37 THR 37 74 74 THR THR A . n A 1 38 ASP 38 75 75 ASP ASP A . n A 1 39 VAL 39 76 76 VAL VAL A . n A 1 40 GLN 40 77 77 GLN GLN A . n A 1 41 CYS 41 78 78 CYS CYS A . n A 1 42 GLN 42 79 79 GLN GLN A . n A 1 43 HIS 43 80 80 HIS HIS A . n A 1 44 ARG 44 81 81 ARG ARG A . n A 1 45 TRP 45 82 82 TRP TRP A . n A 1 46 GLN 46 83 83 GLN GLN A . n A 1 47 LYS 47 84 84 LYS LYS A . n A 1 48 VAL 48 85 85 VAL VAL A . n A 1 49 LEU 49 86 86 LEU LEU A . n A 1 50 ASN 50 87 87 ASN ASN A . n A 1 51 PRO 51 88 88 PRO PRO A . n A 1 52 GLU 52 89 89 GLU GLU A . n A 1 53 NH2 53 90 90 NH2 NH2 A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-07-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-02-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' # _software.name AMBER _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 58 ? ? -90.15 -79.11 2 1 THR A 60 ? ? -83.83 48.96 3 1 ASP A 61 ? ? -90.45 -134.11 4 1 ASN A 72 ? ? 76.96 -44.60 5 1 TRP A 82 ? ? -84.91 -75.55 6 1 VAL A 85 ? ? -134.88 -75.08 7 1 ASN A 87 ? ? -153.75 79.70 #