data_1MBH # _entry.id 1MBH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1MBH WWPDB D_1000174923 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1MBG _pdbx_database_related.details . _pdbx_database_related.content_type 'representative structure' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1MBH _pdbx_database_status.recvd_initial_deposition_date 1995-05-19 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ogata, K.' 1 'Morikawa, S.' 2 'Nakamura, H.' 3 'Hojo, H.' 4 'Yoshimura, S.' 5 'Zhang, R.' 6 'Aimoto, S.' 7 'Ametani, Y.' 8 'Hirata, Z.' 9 'Sarai, A.' 10 'Ishii, S.' 11 'Nishimura, Y.' 12 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.' Nat.Struct.Biol. 2 309 320 1995 NSBIEW US 1072-8368 2024 ? 7796266 10.1038/nsb0495-309 1 'Solution Structure of a Specific DNA Complex of the Myb DNA-Binding Domain with Cooperative Recognition Helices' 'Cell(Cambridge,Mass.)' 79 639 ? 1994 CELLB5 US 0092-8674 0998 ? ? ? 2 ;Solution Structure of a DNA-Binding Unit of Myb: A Helix-Turn-Helix-Related Motif with Conserved Tryptophans Forming a Hydrophobic Core ; Proc.Natl.Acad.Sci.USA 89 6428 ? 1992 PNASA6 US 0027-8424 0040 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ogata, K.' 1 primary 'Morikawa, S.' 2 primary 'Nakamura, H.' 3 primary 'Hojo, H.' 4 primary 'Yoshimura, S.' 5 primary 'Zhang, R.' 6 primary 'Aimoto, S.' 7 primary 'Ametani, Y.' 8 primary 'Hirata, Z.' 9 primary 'Sarai, A.' 10 primary 'Ishii, S.' 11 primary 'Nishimura, Y.' 12 1 'Ogata, K.' 13 1 'Morikawa, S.' 14 1 'Nakamura, H.' 15 1 'Sekikawa, A.' 16 1 'Inoue, T.' 17 1 'Kanai, H.' 18 1 'Sarai, A.' 19 1 'Ishii, S.' 20 1 'Nishimura, Y.' 21 2 'Ogata, K.' 22 2 'Hojo, H.' 23 2 'Aimoto, S.' 24 2 'Nakai, T.' 25 2 'Nakamura, H.' 26 2 'Sarai, A.' 27 2 'Ishii, S.' 28 2 'Nishimura, Y.' 29 # _cell.entry_id 1MBH _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1MBH _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description C-MYB _entity.formula_weight 6300.351 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'LIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPE(NH2)' _entity_poly.pdbx_seq_one_letter_code_can LIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 ILE n 1 3 LYS n 1 4 GLY n 1 5 PRO n 1 6 TRP n 1 7 THR n 1 8 LYS n 1 9 GLU n 1 10 GLU n 1 11 ASP n 1 12 GLN n 1 13 ARG n 1 14 VAL n 1 15 ILE n 1 16 GLU n 1 17 LEU n 1 18 VAL n 1 19 GLN n 1 20 LYS n 1 21 TYR n 1 22 GLY n 1 23 PRO n 1 24 LYS n 1 25 ARG n 1 26 TRP n 1 27 SER n 1 28 VAL n 1 29 ILE n 1 30 ALA n 1 31 LYS n 1 32 HIS n 1 33 LEU n 1 34 LYS n 1 35 GLY n 1 36 ARG n 1 37 ILE n 1 38 GLY n 1 39 LYS n 1 40 GLN n 1 41 CYS n 1 42 ARG n 1 43 GLU n 1 44 ARG n 1 45 TRP n 1 46 HIS n 1 47 ASN n 1 48 HIS n 1 49 LEU n 1 50 ASN n 1 51 PRO n 1 52 GLU n 1 53 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYB_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P06876 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MARRPRHSIYSSDEDDEDIEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQH RWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHK RLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQEPSKASQTPVATSFQKNNHLMGFGHASPPSQLSPSGQSSV NSEYPYYHIAEAQNISSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQALPTQNH TCSYPGWHSTSIVDQTRPHGDSAPVSCLGEHHATPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFID SFLNTSSNHESSGLDAPTLPSTPLIGHKLTPCRDQTVKTQKENSIFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPL KMLPQTPSHAVEDLQDVIKRESDESGIVAEFQESGPPLLKKIKQEVESPTEKSGNFFCSNHWAENSLSTQLFSQASPVAD APNILTSSVLMTPVSEDEDNVLKAFTVPKNRPLVGPLQPCSGAWEPASCGKTEDQMTASGPARKYVNAFSARTLVM ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1MBH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 52 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06876 _struct_ref_seq.db_align_beg 90 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 141 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 90 _struct_ref_seq.pdbx_auth_seq_align_end 141 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 290 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_refine.entry_id 1MBH _pdbx_nmr_refine.method ? _pdbx_nmr_refine.details ;A TOTAL OF 50 STRUCTURES WERE CALCULATED. THE COORDINATES OF THE RESTRAINTED MINIMIZED AVERAGED STRUCTURE WERE OBTAINED BY AVERAGING THE COORDINATES OF THE INDIVIDUAL STRUCTURES, AND THEN BY SUBJECTING THE RESULTING COORDINATES TO THE RESTRAINED ENERGY MINIZATION BY PRESTO. THE MINIMIZED AVERAGE STRUCTURE IS PRESENTED IN PROTEIN DATA BANK ENTRY 1MBG. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1MBH _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 50 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement EMBOSS ? NAKAI,KIDERA,NAKAMURA 1 refinement PRESTO ? MORIKAMI,NAKAI,KIDERA,SAITO,NAKAMURA 2 # _exptl.entry_id 1MBH _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1MBH _struct.title 'MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 2' _struct.pdbx_descriptor C-MYB _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1MBH _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'PROTOONCOGENE PRODUCT, DNA-BINDING PROTEIN, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 LYS A 8 ? TYR A 21 ? LYS A 97 TYR A 110 1 ? 14 HELX_P HELX_P2 H2 TRP A 26 ? HIS A 32 ? TRP A 115 HIS A 121 1 ? 7 HELX_P HELX_P3 H3 GLY A 38 ? ASN A 47 ? GLY A 127 ASN A 136 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id GLU _struct_conn.ptnr1_label_seq_id 52 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id NH2 _struct_conn.ptnr2_label_seq_id 53 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id GLU _struct_conn.ptnr1_auth_seq_id 141 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NH2 _struct_conn.ptnr2_auth_seq_id 142 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.328 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 142' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ASN A 50 ? ASN A 139 . ? 1_555 ? 2 AC1 3 PRO A 51 ? PRO A 140 . ? 1_555 ? 3 AC1 3 GLU A 52 ? GLU A 141 . ? 1_555 ? # _database_PDB_matrix.entry_id 1MBH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1MBH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 90 90 LEU LEU A . n A 1 2 ILE 2 91 91 ILE ILE A . n A 1 3 LYS 3 92 92 LYS LYS A . n A 1 4 GLY 4 93 93 GLY GLY A . n A 1 5 PRO 5 94 94 PRO PRO A . n A 1 6 TRP 6 95 95 TRP TRP A . n A 1 7 THR 7 96 96 THR THR A . n A 1 8 LYS 8 97 97 LYS LYS A . n A 1 9 GLU 9 98 98 GLU GLU A . n A 1 10 GLU 10 99 99 GLU GLU A . n A 1 11 ASP 11 100 100 ASP ASP A . n A 1 12 GLN 12 101 101 GLN GLN A . n A 1 13 ARG 13 102 102 ARG ARG A . n A 1 14 VAL 14 103 103 VAL VAL A . n A 1 15 ILE 15 104 104 ILE ILE A . n A 1 16 GLU 16 105 105 GLU GLU A . n A 1 17 LEU 17 106 106 LEU LEU A . n A 1 18 VAL 18 107 107 VAL VAL A . n A 1 19 GLN 19 108 108 GLN GLN A . n A 1 20 LYS 20 109 109 LYS LYS A . n A 1 21 TYR 21 110 110 TYR TYR A . n A 1 22 GLY 22 111 111 GLY GLY A . n A 1 23 PRO 23 112 112 PRO PRO A . n A 1 24 LYS 24 113 113 LYS LYS A . n A 1 25 ARG 25 114 114 ARG ARG A . n A 1 26 TRP 26 115 115 TRP TRP A . n A 1 27 SER 27 116 116 SER SER A . n A 1 28 VAL 28 117 117 VAL VAL A . n A 1 29 ILE 29 118 118 ILE ILE A . n A 1 30 ALA 30 119 119 ALA ALA A . n A 1 31 LYS 31 120 120 LYS LYS A . n A 1 32 HIS 32 121 121 HIS HIS A . n A 1 33 LEU 33 122 122 LEU LEU A . n A 1 34 LYS 34 123 123 LYS LYS A . n A 1 35 GLY 35 124 124 GLY GLY A . n A 1 36 ARG 36 125 125 ARG ARG A . n A 1 37 ILE 37 126 126 ILE ILE A . n A 1 38 GLY 38 127 127 GLY GLY A . n A 1 39 LYS 39 128 128 LYS LYS A . n A 1 40 GLN 40 129 129 GLN GLN A . n A 1 41 CYS 41 130 130 CYS CYS A . n A 1 42 ARG 42 131 131 ARG ARG A . n A 1 43 GLU 43 132 132 GLU GLU A . n A 1 44 ARG 44 133 133 ARG ARG A . n A 1 45 TRP 45 134 134 TRP TRP A . n A 1 46 HIS 46 135 135 HIS HIS A . n A 1 47 ASN 47 136 136 ASN ASN A . n A 1 48 HIS 48 137 137 HIS HIS A . n A 1 49 LEU 49 138 138 LEU LEU A . n A 1 50 ASN 50 139 139 ASN ASN A . n A 1 51 PRO 51 140 140 PRO PRO A . n A 1 52 GLU 52 141 141 GLU GLU A . n A 1 53 NH2 53 142 142 NH2 NH2 A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-09-15 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-02-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' # _software.name AMBER _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 95 ? ? 64.82 150.20 2 1 TYR A 110 ? ? -89.85 -72.16 3 1 PRO A 112 ? ? -74.29 30.64 4 1 LYS A 123 ? ? -61.30 96.11 5 1 HIS A 135 ? ? -75.57 30.63 6 1 ASN A 136 ? ? -129.59 -75.16 7 1 HIS A 137 ? ? -100.67 -63.12 8 2 TRP A 95 ? ? 58.23 -175.46 9 2 TYR A 110 ? ? -87.77 -71.57 10 2 PRO A 112 ? ? -73.06 32.35 11 2 LYS A 128 ? ? -157.35 -49.56 12 2 HIS A 135 ? ? -74.82 29.21 13 2 ASN A 136 ? ? -137.47 -64.86 14 2 ASN A 139 ? ? -159.51 70.30 15 2 PRO A 140 ? ? -75.30 -78.52 16 3 TRP A 95 ? ? 63.54 164.13 17 3 TYR A 110 ? ? -88.47 -70.80 18 3 LYS A 113 ? ? 60.82 -151.26 19 3 HIS A 135 ? ? -74.34 30.78 20 3 ASN A 136 ? ? -142.62 -65.47 21 4 LYS A 92 ? ? -144.20 55.79 22 4 PRO A 94 ? ? -77.53 43.02 23 4 TRP A 95 ? ? 61.93 169.91 24 4 LYS A 113 ? ? 62.66 -151.80 25 4 HIS A 135 ? ? -145.63 28.37 26 4 ASN A 136 ? ? -127.36 -60.34 27 4 ASN A 139 ? ? -162.61 49.38 28 5 TYR A 110 ? ? -96.66 -72.88 29 5 PRO A 112 ? ? -73.71 31.28 30 5 HIS A 135 ? ? -79.94 41.51 31 5 ASN A 136 ? ? -152.25 -62.08 32 5 HIS A 137 ? ? -83.86 -70.19 33 5 LEU A 138 ? ? -75.81 -79.98 34 6 PRO A 94 ? ? -68.87 5.49 35 6 TRP A 95 ? ? 60.17 179.06 36 6 LYS A 113 ? ? 64.26 -147.78 37 6 HIS A 135 ? ? -100.80 40.39 38 6 ASN A 136 ? ? -143.41 -62.36 39 6 HIS A 137 ? ? -132.96 -156.41 40 6 LEU A 138 ? ? 58.60 -146.99 41 6 ASN A 139 ? ? 60.05 73.08 42 7 ILE A 91 ? ? 55.11 73.32 43 7 TYR A 110 ? ? -90.23 -71.64 44 7 LYS A 113 ? ? 61.00 -148.50 45 7 HIS A 135 ? ? -80.56 41.14 46 7 ASN A 136 ? ? -147.27 -66.09 47 7 HIS A 137 ? ? -90.71 -133.13 48 7 ASN A 139 ? ? -164.51 69.06 49 7 PRO A 140 ? ? -78.97 47.93 50 8 LYS A 113 ? ? 60.30 -148.22 51 8 SER A 116 ? ? -148.26 -53.32 52 8 HIS A 135 ? ? -77.51 27.22 53 8 ASN A 136 ? ? -142.58 -61.04 54 8 HIS A 137 ? ? -85.57 -134.80 55 8 ASN A 139 ? ? -159.94 71.52 56 8 PRO A 140 ? ? -72.49 -77.17 57 9 ARG A 114 ? ? -141.50 44.08 58 9 LYS A 128 ? ? -160.39 -47.01 59 9 HIS A 135 ? ? -76.60 38.27 60 9 ASN A 136 ? ? -147.97 -59.71 61 9 HIS A 137 ? ? -82.94 -70.31 62 10 PRO A 94 ? ? -62.67 -174.06 63 10 LYS A 113 ? ? 61.69 -147.30 64 10 SER A 116 ? ? -147.98 -56.22 65 10 LYS A 123 ? ? -66.83 86.88 66 10 LYS A 128 ? ? -169.80 -55.44 67 10 HIS A 135 ? ? -148.78 37.90 68 10 ASN A 136 ? ? -151.24 -74.29 69 11 ILE A 91 ? ? 67.31 132.81 70 11 TRP A 95 ? ? 61.64 168.93 71 11 LYS A 113 ? ? 60.99 -148.64 72 11 LYS A 128 ? ? -160.62 -59.32 73 11 HIS A 135 ? ? -80.81 49.20 74 11 ASN A 136 ? ? -149.71 -61.74 75 11 HIS A 137 ? ? -88.30 -129.68 76 11 ASN A 139 ? ? -152.59 71.60 77 12 LYS A 113 ? ? 64.32 -155.64 78 12 LYS A 123 ? ? 67.49 142.28 79 12 LYS A 128 ? ? -157.84 -51.09 80 12 HIS A 135 ? ? -79.34 33.04 81 12 ASN A 136 ? ? -132.61 -58.77 82 12 HIS A 137 ? ? -150.87 54.84 83 12 LEU A 138 ? ? -171.38 84.60 84 13 LYS A 113 ? ? 62.11 -145.47 85 13 ASN A 136 ? ? -123.01 -80.31 86 13 HIS A 137 ? ? -79.50 -84.74 87 14 TRP A 95 ? ? 60.43 -177.77 88 14 LYS A 113 ? ? 65.10 -174.59 89 14 LYS A 123 ? ? -49.76 109.53 90 14 LYS A 128 ? ? -174.75 -49.60 91 14 HIS A 135 ? ? -142.68 39.29 92 14 ASN A 136 ? ? -147.34 -76.57 93 14 HIS A 137 ? ? -93.32 -61.55 94 14 ASN A 139 ? ? -177.59 -43.23 95 15 ILE A 91 ? ? 68.05 159.01 96 15 LYS A 92 ? ? -146.26 -141.87 97 15 TRP A 95 ? ? 60.13 173.39 98 15 LYS A 113 ? ? 62.20 -155.86 99 15 SER A 116 ? ? -151.10 -54.64 100 15 LYS A 123 ? ? -62.40 98.87 101 15 LYS A 128 ? ? -152.50 -56.09 102 15 HIS A 135 ? ? -155.53 36.15 103 15 ASN A 136 ? ? -141.22 -68.38 104 15 ASN A 139 ? ? 95.08 66.69 105 16 TRP A 95 ? ? 46.67 91.56 106 16 TYR A 110 ? ? -90.40 -72.18 107 16 HIS A 135 ? ? -86.16 33.95 108 16 ASN A 136 ? ? -138.83 -57.45 109 16 HIS A 137 ? ? -144.23 -158.72 110 16 LEU A 138 ? ? 64.06 -146.14 111 17 ILE A 91 ? ? 63.13 167.87 112 17 TRP A 95 ? ? 62.49 154.62 113 17 TYR A 110 ? ? -87.12 -70.22 114 17 LYS A 113 ? ? -140.72 -46.84 115 17 LYS A 128 ? ? -165.18 -56.05 116 17 HIS A 135 ? ? -141.75 38.14 117 17 ASN A 136 ? ? -145.83 -70.03 118 17 HIS A 137 ? ? -100.69 -62.43 119 17 ASN A 139 ? ? -171.26 -52.58 120 17 PRO A 140 ? ? -85.80 -83.74 121 18 PRO A 94 ? ? -77.62 40.41 122 18 TRP A 95 ? ? 59.77 -177.27 123 18 LYS A 113 ? ? 61.66 -155.39 124 18 LYS A 123 ? ? -64.04 94.41 125 18 HIS A 137 ? ? -128.10 -124.86 126 18 ASN A 139 ? ? -156.57 68.71 127 18 PRO A 140 ? ? -71.78 -79.69 128 19 LYS A 92 ? ? 48.21 -126.28 129 19 TRP A 95 ? ? 61.89 172.01 130 19 TYR A 110 ? ? -94.74 -68.01 131 19 PRO A 112 ? ? -73.51 27.10 132 19 HIS A 135 ? ? -87.62 31.72 133 19 ASN A 136 ? ? -127.21 -80.45 134 19 HIS A 137 ? ? -99.33 -64.48 135 20 ILE A 91 ? ? 69.00 150.34 136 20 LYS A 92 ? ? -89.64 -137.17 137 20 TRP A 95 ? ? 61.53 162.56 138 20 LYS A 113 ? ? 65.87 -164.27 139 20 LYS A 128 ? ? -79.09 27.47 140 20 GLN A 129 ? ? -138.61 -52.63 141 20 HIS A 135 ? ? -146.02 31.18 142 20 ASN A 136 ? ? -137.21 -68.91 143 20 ASN A 139 ? ? -179.06 -43.95 144 21 LYS A 92 ? ? -161.36 89.87 145 21 PRO A 94 ? ? -64.39 79.37 146 21 TRP A 95 ? ? 61.08 173.71 147 21 TYR A 110 ? ? -90.51 -79.24 148 21 PRO A 112 ? ? -76.02 38.60 149 21 LYS A 123 ? ? -66.52 83.61 150 21 LYS A 128 ? ? -163.05 -50.81 151 21 HIS A 135 ? ? -80.00 31.91 152 21 ASN A 136 ? ? -129.66 -86.24 153 21 LEU A 138 ? ? -75.22 -161.96 154 21 ASN A 139 ? ? 80.52 59.66 155 21 PRO A 140 ? ? -75.46 -74.41 156 22 ILE A 91 ? ? 64.34 176.70 157 22 LYS A 92 ? ? -73.96 -152.14 158 22 PRO A 94 ? ? -64.61 89.32 159 22 TRP A 95 ? ? 51.23 82.02 160 22 HIS A 135 ? ? -76.50 25.93 161 22 ASN A 136 ? ? -140.68 -54.65 162 22 HIS A 137 ? ? -93.31 -133.76 163 22 ASN A 139 ? ? -153.77 56.12 164 23 ILE A 91 ? ? 67.29 155.93 165 23 PRO A 94 ? ? -65.41 98.79 166 23 LYS A 113 ? ? 62.74 -149.37 167 23 LYS A 123 ? ? -64.89 88.41 168 23 LYS A 128 ? ? -168.69 -48.90 169 23 HIS A 135 ? ? -80.68 31.10 170 23 ASN A 136 ? ? -124.94 -62.40 171 23 HIS A 137 ? ? -102.83 -81.44 172 23 ASN A 139 ? ? -154.67 63.73 173 24 LYS A 92 ? ? -147.31 49.49 174 24 LYS A 109 ? ? -90.58 -64.15 175 24 LYS A 113 ? ? 73.49 -169.90 176 24 ASN A 136 ? ? -109.10 -84.78 177 24 LEU A 138 ? ? -77.13 -109.68 178 25 PRO A 94 ? ? -65.68 -174.57 179 25 PRO A 112 ? ? -74.56 38.03 180 25 HIS A 135 ? ? -77.56 32.40 181 25 ASN A 136 ? ? -121.09 -81.04 182 25 LEU A 138 ? ? -79.68 -111.32 183 26 PRO A 94 ? ? -59.08 84.81 184 26 TRP A 95 ? ? 57.35 90.59 185 26 PRO A 112 ? ? -74.74 38.84 186 26 LYS A 123 ? ? -51.57 109.53 187 26 LYS A 128 ? ? -158.20 -60.41 188 26 HIS A 135 ? ? -79.06 40.85 189 26 ASN A 136 ? ? -135.32 -68.98 190 26 ASN A 139 ? ? -25.40 92.69 191 27 ILE A 91 ? ? 66.14 166.74 192 27 LYS A 92 ? ? -163.72 -150.41 193 27 TRP A 95 ? ? 59.96 169.65 194 27 LYS A 113 ? ? 60.17 -149.81 195 27 LYS A 123 ? ? -59.40 95.03 196 27 LYS A 128 ? ? -153.37 -59.90 197 27 HIS A 135 ? ? -81.38 46.78 198 27 ASN A 136 ? ? -152.96 -74.83 199 27 HIS A 137 ? ? -73.35 -71.05 200 28 ILE A 91 ? ? 70.69 132.99 201 28 LYS A 92 ? ? 53.95 -166.96 202 28 PRO A 94 ? ? -67.33 90.24 203 28 TYR A 110 ? ? -81.39 -81.12 204 28 HIS A 135 ? ? -78.27 33.96 205 28 ASN A 136 ? ? -134.61 -66.07 206 28 HIS A 137 ? ? -141.21 48.10 207 28 LEU A 138 ? ? -171.36 90.11 208 29 TRP A 95 ? ? 61.43 168.08 209 29 TYR A 110 ? ? -85.39 -71.32 210 29 LYS A 113 ? ? 61.99 -150.41 211 29 LYS A 128 ? ? -162.55 -58.83 212 29 ASN A 136 ? ? -78.28 -84.67 213 29 LEU A 138 ? ? -77.93 -114.97 214 30 LYS A 92 ? ? -147.69 46.19 215 30 TYR A 110 ? ? -92.00 -79.52 216 30 PRO A 112 ? ? -75.87 40.22 217 30 HIS A 135 ? ? -77.44 35.69 218 30 ASN A 136 ? ? -147.47 -70.01 219 30 HIS A 137 ? ? -75.04 -72.97 220 31 ILE A 91 ? ? 68.96 159.37 221 31 LYS A 92 ? ? -79.64 -160.66 222 31 LYS A 113 ? ? 60.28 -149.43 223 31 LYS A 128 ? ? -154.87 -50.00 224 31 HIS A 137 ? ? -87.96 -133.92 225 32 TRP A 95 ? ? 62.11 176.67 226 32 TYR A 110 ? ? -77.18 -70.06 227 32 LYS A 128 ? ? -161.01 -48.94 228 32 HIS A 135 ? ? -87.12 46.47 229 32 ASN A 136 ? ? -129.48 -71.28 230 32 LEU A 138 ? ? -80.21 -149.59 231 32 ASN A 139 ? ? 67.99 70.79 232 33 PRO A 94 ? ? -68.65 81.69 233 33 TRP A 95 ? ? 60.24 -176.80 234 33 LYS A 109 ? ? -90.30 -62.77 235 33 LYS A 113 ? ? 63.74 -156.65 236 33 LYS A 123 ? ? -64.59 89.20 237 33 ASN A 136 ? ? -140.53 -59.26 238 33 HIS A 137 ? ? -90.59 -128.67 239 33 LEU A 138 ? ? -54.85 104.63 240 34 TRP A 95 ? ? 60.02 174.35 241 34 TYR A 110 ? ? -90.17 -81.51 242 34 PRO A 112 ? ? -75.69 46.79 243 34 LYS A 113 ? ? -138.28 -41.16 244 34 LYS A 128 ? ? -165.05 -48.81 245 34 ASN A 136 ? ? -127.87 -74.41 246 34 HIS A 137 ? ? -82.52 -76.06 247 35 ILE A 91 ? ? 68.70 118.83 248 35 TRP A 95 ? ? 61.30 179.00 249 35 LYS A 113 ? ? 63.70 -146.88 250 35 HIS A 135 ? ? -143.04 21.16 251 35 HIS A 137 ? ? -80.72 -74.91 252 35 ASN A 139 ? ? -164.40 69.51 253 36 ILE A 91 ? ? 58.61 72.96 254 36 LYS A 92 ? ? 53.47 -135.84 255 36 PRO A 94 ? ? -54.67 108.19 256 36 TYR A 110 ? ? -92.83 -80.47 257 36 PRO A 112 ? ? -74.70 31.08 258 36 LYS A 123 ? ? -69.60 76.67 259 36 LYS A 128 ? ? -164.24 -59.79 260 36 HIS A 137 ? ? -96.45 -118.98 261 36 PRO A 140 ? ? -69.45 -86.22 262 37 ILE A 91 ? ? 65.25 169.51 263 37 LYS A 92 ? ? -75.76 -166.43 264 37 TRP A 95 ? ? 61.43 172.86 265 37 LYS A 113 ? ? 64.01 -144.75 266 37 HIS A 135 ? ? -150.21 33.06 267 37 ASN A 136 ? ? -142.70 -73.29 268 37 ASN A 139 ? ? -167.81 61.49 269 38 LYS A 92 ? ? -72.60 -160.95 270 38 TRP A 95 ? ? 59.62 173.28 271 38 HIS A 135 ? ? -84.07 48.59 272 38 ASN A 136 ? ? -144.21 -69.38 273 38 LEU A 138 ? ? -165.36 -144.34 274 38 ASN A 139 ? ? 70.15 67.43 275 39 LYS A 113 ? ? 61.88 -149.43 276 39 LYS A 128 ? ? -164.61 -55.30 277 39 HIS A 135 ? ? -142.01 28.12 278 39 ASN A 136 ? ? -132.25 -66.01 279 39 ASN A 139 ? ? -174.03 -44.96 280 40 LYS A 113 ? ? 62.11 -145.47 281 40 ASN A 136 ? ? -123.01 -80.31 282 40 HIS A 137 ? ? -79.50 -84.74 283 41 PRO A 94 ? ? -61.39 93.93 284 41 TRP A 95 ? ? 64.19 167.40 285 41 TYR A 110 ? ? -89.68 -74.45 286 41 PRO A 112 ? ? -75.84 36.15 287 41 LYS A 128 ? ? -161.05 -48.21 288 41 HIS A 135 ? ? -82.20 44.45 289 41 ASN A 136 ? ? -149.29 -79.36 290 41 HIS A 137 ? ? -87.94 -80.80 291 42 LYS A 92 ? ? -74.14 -155.60 292 42 PRO A 94 ? ? -68.93 75.75 293 42 TRP A 95 ? ? 58.40 -177.96 294 42 TYR A 110 ? ? -94.18 -70.11 295 42 LYS A 113 ? ? 69.14 -175.94 296 42 LYS A 123 ? ? -59.85 108.11 297 42 HIS A 135 ? ? -149.58 27.78 298 42 ASN A 136 ? ? -133.85 -66.67 299 42 HIS A 137 ? ? -94.43 -69.57 300 42 LEU A 138 ? ? -90.07 -121.61 301 42 ASN A 139 ? ? 64.11 72.33 302 42 PRO A 140 ? ? -75.70 -72.66 303 43 TRP A 95 ? ? 63.08 159.31 304 43 TYR A 110 ? ? -96.22 -81.86 305 43 TRP A 115 ? ? -117.74 56.20 306 43 SER A 116 ? ? -145.02 -54.22 307 43 LYS A 123 ? ? -55.91 105.88 308 43 LYS A 128 ? ? -162.19 -48.41 309 43 HIS A 135 ? ? -79.67 27.82 310 43 ASN A 136 ? ? -131.37 -70.01 311 43 HIS A 137 ? ? -143.71 53.86 312 43 LEU A 138 ? ? -164.16 93.95 313 43 ASN A 139 ? ? -153.82 67.46 314 43 PRO A 140 ? ? -75.67 -149.86 315 44 LYS A 92 ? ? -107.74 52.09 316 44 PRO A 112 ? ? -74.78 30.67 317 44 LYS A 123 ? ? 69.40 127.79 318 44 HIS A 135 ? ? -88.36 48.10 319 44 ASN A 136 ? ? -142.65 -83.29 320 44 HIS A 137 ? ? -86.96 -80.26 321 44 ASN A 139 ? ? -156.59 54.50 322 45 TYR A 110 ? ? -92.69 -77.09 323 45 PRO A 112 ? ? -75.15 38.11 324 45 LYS A 123 ? ? -69.38 76.37 325 45 HIS A 135 ? ? -85.86 33.26 326 45 ASN A 136 ? ? -131.08 -65.55 327 45 HIS A 137 ? ? -150.97 72.41 328 45 LEU A 138 ? ? -166.26 -66.90 329 45 ASN A 139 ? ? -26.07 92.92 330 45 PRO A 140 ? ? -82.96 -74.71 331 46 TRP A 95 ? ? 61.92 177.38 332 46 SER A 116 ? ? -149.25 -58.98 333 46 HIS A 135 ? ? -79.47 38.98 334 46 ASN A 136 ? ? -138.78 -71.41 335 46 HIS A 137 ? ? -77.57 -72.15 336 47 TRP A 95 ? ? 60.59 -176.74 337 47 LYS A 113 ? ? 60.84 -151.41 338 47 HIS A 135 ? ? -75.61 20.25 339 47 ASN A 136 ? ? -131.78 -79.35 340 48 ARG A 114 ? ? -140.80 54.27 341 48 SER A 116 ? ? -154.63 -55.23 342 48 LYS A 123 ? ? -65.59 87.24 343 48 LYS A 128 ? ? -161.97 -55.72 344 48 HIS A 135 ? ? -79.60 40.25 345 48 ASN A 136 ? ? -136.60 -58.42 346 48 HIS A 137 ? ? -152.68 54.50 347 48 LEU A 138 ? ? -169.97 103.83 348 48 ASN A 139 ? ? -163.81 67.93 349 48 PRO A 140 ? ? -73.01 -75.73 350 49 LYS A 92 ? ? -167.32 55.67 351 49 PRO A 94 ? ? -78.73 26.04 352 49 TRP A 95 ? ? 61.98 -179.70 353 49 ASN A 136 ? ? -147.28 -72.58 354 49 LEU A 138 ? ? -166.73 -143.17 355 49 ASN A 139 ? ? 72.47 61.56 356 49 PRO A 140 ? ? -72.72 -74.75 357 50 TRP A 95 ? ? 60.74 174.44 358 50 TYR A 110 ? ? -93.24 -82.20 359 50 LYS A 123 ? ? -69.60 78.43 360 50 HIS A 135 ? ? -77.62 33.83 361 50 ASN A 136 ? ? -146.37 -71.05 362 50 ASN A 139 ? ? -165.83 73.94 363 50 PRO A 140 ? ? -73.64 -83.67 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 9 ARG A 125 ? ? 0.118 'SIDE CHAIN' 2 10 ARG A 125 ? ? 0.115 'SIDE CHAIN' 3 13 ARG A 125 ? ? 0.108 'SIDE CHAIN' 4 18 ARG A 125 ? ? 0.115 'SIDE CHAIN' 5 21 ARG A 125 ? ? 0.155 'SIDE CHAIN' 6 24 ARG A 125 ? ? 0.100 'SIDE CHAIN' 7 25 ARG A 125 ? ? 0.131 'SIDE CHAIN' 8 26 ARG A 125 ? ? 0.078 'SIDE CHAIN' 9 27 ARG A 125 ? ? 0.174 'SIDE CHAIN' 10 30 ARG A 125 ? ? 0.098 'SIDE CHAIN' 11 33 ARG A 125 ? ? 0.117 'SIDE CHAIN' 12 36 ARG A 125 ? ? 0.221 'SIDE CHAIN' 13 38 ARG A 125 ? ? 0.135 'SIDE CHAIN' 14 40 ARG A 125 ? ? 0.108 'SIDE CHAIN' 15 41 ARG A 125 ? ? 0.126 'SIDE CHAIN' 16 42 ARG A 114 ? ? 0.134 'SIDE CHAIN' 17 46 ARG A 125 ? ? 0.082 'SIDE CHAIN' 18 48 ARG A 102 ? ? 0.125 'SIDE CHAIN' 19 48 ARG A 125 ? ? 0.189 'SIDE CHAIN' 20 49 ARG A 125 ? ? 0.164 'SIDE CHAIN' 21 50 ARG A 125 ? ? 0.163 'SIDE CHAIN' #