data_1MBJ # _entry.id 1MBJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1MBJ WWPDB D_1000174925 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1MBK _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1MBJ _pdbx_database_status.recvd_initial_deposition_date 1995-05-19 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ogata, K.' 1 'Morikawa, S.' 2 'Nakamura, H.' 3 'Hojo, H.' 4 'Yoshimura, S.' 5 'Zhang, R.' 6 'Aimoto, S.' 7 'Ametani, Y.' 8 'Hirata, Z.' 9 'Sarai, A.' 10 'Ishii, S.' 11 'Nishimura, Y.' 12 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.' Nat.Struct.Biol. 2 309 320 1995 NSBIEW US 1072-8368 2024 ? 7796266 10.1038/nsb0495-309 1 'Solution Structure of a Specific DNA Complex of the Myb DNA-Binding Domain with Cooperative Recognition Helices' 'Cell(Cambridge,Mass.)' 79 639 ? 1994 CELLB5 US 0092-8674 0998 ? ? ? 2 ;Solution Structure of a DNA-Binding Unit of Myb: A Helix-Turn-Helix-Related Motif with Conserved Tryptophans Forming a Hydrophobic Core ; Proc.Natl.Acad.Sci.USA 89 6428 ? 1992 PNASA6 US 0027-8424 0040 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ogata, K.' 1 primary 'Morikawa, S.' 2 primary 'Nakamura, H.' 3 primary 'Hojo, H.' 4 primary 'Yoshimura, S.' 5 primary 'Zhang, R.' 6 primary 'Aimoto, S.' 7 primary 'Ametani, Y.' 8 primary 'Hirata, Z.' 9 primary 'Sarai, A.' 10 primary 'Ishii, S.' 11 primary 'Nishimura, Y.' 12 1 'Ogata, K.' 13 1 'Morikawa, S.' 14 1 'Nakamura, H.' 15 1 'Sekikawa, A.' 16 1 'Inoue, T.' 17 1 'Kanai, H.' 18 1 'Sarai, A.' 19 1 'Ishii, S.' 20 1 'Nishimura, Y.' 21 2 'Ogata, K.' 22 2 'Hojo, H.' 23 2 'Aimoto, S.' 24 2 'Nakai, T.' 25 2 'Nakamura, H.' 26 2 'Sarai, A.' 27 2 'Ishii, S.' 28 2 'Nishimura, Y.' 29 # _cell.entry_id 1MBJ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1MBJ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'MYB PROTO-ONCOGENE PROTEIN' _entity.formula_weight 6259.194 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'GENE C-MYB, NMR, MINIMIZED AVERAGE STRUCTURE; ENGINEERED' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'VKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV(NH2)' _entity_poly.pdbx_seq_one_letter_code_can VKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 LYS n 1 3 LYS n 1 4 THR n 1 5 SER n 1 6 TRP n 1 7 THR n 1 8 GLU n 1 9 GLU n 1 10 GLU n 1 11 ASP n 1 12 ARG n 1 13 ILE n 1 14 ILE n 1 15 TYR n 1 16 GLN n 1 17 ALA n 1 18 HIS n 1 19 LYS n 1 20 ARG n 1 21 LEU n 1 22 GLY n 1 23 ASN n 1 24 ARG n 1 25 TRP n 1 26 ALA n 1 27 GLU n 1 28 ILE n 1 29 ALA n 1 30 LYS n 1 31 LEU n 1 32 LEU n 1 33 PRO n 1 34 GLY n 1 35 ARG n 1 36 THR n 1 37 ASP n 1 38 ASN n 1 39 ALA n 1 40 ILE n 1 41 LYS n 1 42 ASN n 1 43 HIS n 1 44 TRP n 1 45 ASN n 1 46 SER n 1 47 THR n 1 48 MET n 1 49 ARG n 1 50 ARG n 1 51 LYS n 1 52 VAL n 1 53 NH2 n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'house mouse' _entity_src_nat.pdbx_organism_scientific 'Mus musculus' _entity_src_nat.pdbx_ncbi_taxonomy_id 10090 _entity_src_nat.genus Mus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYB_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P06876 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MARRPRHSIYSSDEDDEDIEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQH RWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHK RLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQEPSKASQTPVATSFQKNNHLMGFGHASPPSQLSPSGQSSV NSEYPYYHIAEAQNISSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQALPTQNH TCSYPGWHSTSIVDQTRPHGDSAPVSCLGEHHATPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFID SFLNTSSNHESSGLDAPTLPSTPLIGHKLTPCRDQTVKTQKENSIFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPL KMLPQTPSHAVEDLQDVIKRESDESGIVAEFQESGPPLLKKIKQEVESPTEKSGNFFCSNHWAENSLSTQLFSQASPVAD APNILTSSVLMTPVSEDEDNVLKAFTVPKNRPLVGPLQPCSGAWEPASCGKTEDQMTASGPARKYVNAFSARTLVM ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1MBJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 52 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06876 _struct_ref_seq.db_align_beg 142 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 193 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 142 _struct_ref_seq.pdbx_auth_seq_align_end 193 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 290 ? 6.8 ? ? K 2 300 ? 6.8 ? ? K # _pdbx_nmr_refine.entry_id 1MBJ _pdbx_nmr_refine.method ? _pdbx_nmr_refine.details ;A TOTAL OF 50 STRUCTURES WERE CALCULATED. THE COORDINATES OF THE RESTRAINED MINIMIZED AVERAGED STRUCTURE WERE OBTAINED BY AVERAGING THE COORDINATES OF THE INDIVIDUAL STRUCTURES, AND THEN BY SUBJECTING THE RESULTING COORDINATES TO THE RESTRAINED ENERGY MINIMIZATION BY PRESTO. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1MBJ _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement EMBOSS ? NAKAI,KIDERA,NAKAMURA 1 refinement PRESTO ? MORIKAMI,NAKAI,KIDERA,SAITO,NAKAMURA 2 # _exptl.entry_id 1MBJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1MBJ _struct.title 'MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3' _struct.pdbx_descriptor 'MYB PROTO-ONCOGENE PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1MBJ _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'PROTOONCOGENE PRODUCT, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 GLU A 8 ? LEU A 21 ? GLU A 149 LEU A 162 1 ? 14 HELX_P HELX_P2 H2 TRP A 25 ? LEU A 31 ? TRP A 166 LEU A 172 1 ? 7 HELX_P HELX_P3 H3 ASP A 37 ? SER A 46 ? ASP A 178 SER A 187 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id VAL _struct_conn.ptnr1_label_seq_id 52 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id NH2 _struct_conn.ptnr2_label_seq_id 53 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id VAL _struct_conn.ptnr1_auth_seq_id 193 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NH2 _struct_conn.ptnr2_auth_seq_id 194 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.337 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 194' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 TYR A 15 ? TYR A 156 . ? 1_555 ? 2 AC1 2 VAL A 52 ? VAL A 193 . ? 1_555 ? # _database_PDB_matrix.entry_id 1MBJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1MBJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 142 142 VAL VAL A . n A 1 2 LYS 2 143 143 LYS LYS A . n A 1 3 LYS 3 144 144 LYS LYS A . n A 1 4 THR 4 145 145 THR THR A . n A 1 5 SER 5 146 146 SER SER A . n A 1 6 TRP 6 147 147 TRP TRP A . n A 1 7 THR 7 148 148 THR THR A . n A 1 8 GLU 8 149 149 GLU GLU A . n A 1 9 GLU 9 150 150 GLU GLU A . n A 1 10 GLU 10 151 151 GLU GLU A . n A 1 11 ASP 11 152 152 ASP ASP A . n A 1 12 ARG 12 153 153 ARG ARG A . n A 1 13 ILE 13 154 154 ILE ILE A . n A 1 14 ILE 14 155 155 ILE ILE A . n A 1 15 TYR 15 156 156 TYR TYR A . n A 1 16 GLN 16 157 157 GLN GLN A . n A 1 17 ALA 17 158 158 ALA ALA A . n A 1 18 HIS 18 159 159 HIS HIS A . n A 1 19 LYS 19 160 160 LYS LYS A . n A 1 20 ARG 20 161 161 ARG ARG A . n A 1 21 LEU 21 162 162 LEU LEU A . n A 1 22 GLY 22 163 163 GLY GLY A . n A 1 23 ASN 23 164 164 ASN ASN A . n A 1 24 ARG 24 165 165 ARG ARG A . n A 1 25 TRP 25 166 166 TRP TRP A . n A 1 26 ALA 26 167 167 ALA ALA A . n A 1 27 GLU 27 168 168 GLU GLU A . n A 1 28 ILE 28 169 169 ILE ILE A . n A 1 29 ALA 29 170 170 ALA ALA A . n A 1 30 LYS 30 171 171 LYS LYS A . n A 1 31 LEU 31 172 172 LEU LEU A . n A 1 32 LEU 32 173 173 LEU LEU A . n A 1 33 PRO 33 174 174 PRO PRO A . n A 1 34 GLY 34 175 175 GLY GLY A . n A 1 35 ARG 35 176 176 ARG ARG A . n A 1 36 THR 36 177 177 THR THR A . n A 1 37 ASP 37 178 178 ASP ASP A . n A 1 38 ASN 38 179 179 ASN ASN A . n A 1 39 ALA 39 180 180 ALA ALA A . n A 1 40 ILE 40 181 181 ILE ILE A . n A 1 41 LYS 41 182 182 LYS LYS A . n A 1 42 ASN 42 183 183 ASN ASN A . n A 1 43 HIS 43 184 184 HIS HIS A . n A 1 44 TRP 44 185 185 TRP TRP A . n A 1 45 ASN 45 186 186 ASN ASN A . n A 1 46 SER 46 187 187 SER SER A . n A 1 47 THR 47 188 188 THR THR A . n A 1 48 MET 48 189 189 MET MET A . n A 1 49 ARG 49 190 190 ARG ARG A . n A 1 50 ARG 50 191 191 ARG ARG A . n A 1 51 LYS 51 192 192 LYS LYS A . n A 1 52 VAL 52 193 193 VAL VAL A . n A 1 53 NH2 53 194 194 NH2 NH2 A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-07-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-02-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' # _software.name AMBER _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 145 ? ? 42.86 -153.39 2 1 TRP A 147 ? ? 62.48 115.78 3 1 ASN A 164 ? ? -83.22 33.36 4 1 SER A 187 ? ? -165.57 -52.81 5 1 MET A 189 ? ? -106.18 66.54 6 1 ARG A 191 ? ? -119.05 67.21 #