data_1MYF # _entry.id 1MYF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1MYF pdb_00001myf 10.2210/pdb1myf/pdb WWPDB D_1000175185 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1MYF _pdbx_database_status.recvd_initial_deposition_date 1994-12-02 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Osapay, K.' 1 'Theriault, Y.' 2 'Wright, P.E.' 3 'Case, D.A.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of carbonmonoxy myoglobin determined from nuclear magnetic resonance distance and chemical shift constraints.' J.Mol.Biol. 244 183 197 1994 JMOBAK UK 0022-2836 0070 ? 7966330 10.1006/jmbi.1994.1718 1 'Computational Methods for Determining Protein Structures from NMR Data' Biochem.Pharm. 40 15 ? 1990 BCPCA6 UK 0006-2952 0725 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Osapay, K.' 1 ? primary 'Theriault, Y.' 2 ? primary 'Wright, P.E.' 3 ? primary 'Case, D.A.' 4 ? 1 'Gippert, G.P.' 5 ? 1 'Yip, P.F.' 6 ? 1 'Wright, P.E.' 7 ? 1 'Case, D.A.' 8 ? # _cell.entry_id 1MYF _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1MYF _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man MYOGLOBIN 17234.951 1 ? ? ? ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 3 non-polymer syn 'CARBON MONOXIDE' 28.010 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_seq_one_letter_code_can ;VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 LEU n 1 3 SER n 1 4 GLU n 1 5 GLY n 1 6 GLU n 1 7 TRP n 1 8 GLN n 1 9 LEU n 1 10 VAL n 1 11 LEU n 1 12 HIS n 1 13 VAL n 1 14 TRP n 1 15 ALA n 1 16 LYS n 1 17 VAL n 1 18 GLU n 1 19 ALA n 1 20 ASP n 1 21 VAL n 1 22 ALA n 1 23 GLY n 1 24 HIS n 1 25 GLY n 1 26 GLN n 1 27 ASP n 1 28 ILE n 1 29 LEU n 1 30 ILE n 1 31 ARG n 1 32 LEU n 1 33 PHE n 1 34 LYS n 1 35 SER n 1 36 HIS n 1 37 PRO n 1 38 GLU n 1 39 THR n 1 40 LEU n 1 41 GLU n 1 42 LYS n 1 43 PHE n 1 44 ASP n 1 45 ARG n 1 46 PHE n 1 47 LYS n 1 48 HIS n 1 49 LEU n 1 50 LYS n 1 51 THR n 1 52 GLU n 1 53 ALA n 1 54 GLU n 1 55 MET n 1 56 LYS n 1 57 ALA n 1 58 SER n 1 59 GLU n 1 60 ASP n 1 61 LEU n 1 62 LYS n 1 63 LYS n 1 64 HIS n 1 65 GLY n 1 66 VAL n 1 67 THR n 1 68 VAL n 1 69 LEU n 1 70 THR n 1 71 ALA n 1 72 LEU n 1 73 GLY n 1 74 ALA n 1 75 ILE n 1 76 LEU n 1 77 LYS n 1 78 LYS n 1 79 LYS n 1 80 GLY n 1 81 HIS n 1 82 HIS n 1 83 GLU n 1 84 ALA n 1 85 GLU n 1 86 LEU n 1 87 LYS n 1 88 PRO n 1 89 LEU n 1 90 ALA n 1 91 GLN n 1 92 SER n 1 93 HIS n 1 94 ALA n 1 95 THR n 1 96 LYS n 1 97 HIS n 1 98 LYS n 1 99 ILE n 1 100 PRO n 1 101 ILE n 1 102 LYS n 1 103 TYR n 1 104 LEU n 1 105 GLU n 1 106 PHE n 1 107 ILE n 1 108 SER n 1 109 GLU n 1 110 ALA n 1 111 ILE n 1 112 ILE n 1 113 HIS n 1 114 VAL n 1 115 LEU n 1 116 HIS n 1 117 SER n 1 118 ARG n 1 119 HIS n 1 120 PRO n 1 121 GLY n 1 122 ASP n 1 123 PHE n 1 124 GLY n 1 125 ALA n 1 126 ASP n 1 127 ALA n 1 128 GLN n 1 129 GLY n 1 130 ALA n 1 131 MET n 1 132 ASN n 1 133 LYS n 1 134 ALA n 1 135 LEU n 1 136 GLU n 1 137 LEU n 1 138 PHE n 1 139 ARG n 1 140 LYS n 1 141 ASP n 1 142 ILE n 1 143 ALA n 1 144 ALA n 1 145 LYS n 1 146 TYR n 1 147 LYS n 1 148 GLU n 1 149 LEU n 1 150 GLY n 1 151 TYR n 1 152 GLN n 1 153 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'sperm whale' _entity_src_gen.gene_src_genus Physeter _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Physeter catodon' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9755 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYG_PHYCA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02185 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1MYF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 153 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02185 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 153 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 153 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CMO non-polymer . 'CARBON MONOXIDE' ? 'C O' 28.010 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1MYF _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 12 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DISGEO ? HAVEL,WUTHRICH 1 refinement Amber ? PEARLMAN,CASE,CALDWELL,SEIBEL,SINGH,WEINER,KOLLMAN 2 # _exptl.entry_id 1MYF _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1MYF _struct.title 'SOLUTION STRUCTURE OF CARBONMONOXY MYOGLOBIN DETERMINED FROM NMR DISTANCE AND CHEMICAL SHIFT CONSTRAINTS' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1MYF _struct_keywords.pdbx_keywords 'OXYGEN TRANSPORT' _struct_keywords.text 'OXYGEN TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 4 ? SER A 35 ? GLU A 4 SER A 35 1 ? 32 HELX_P HELX_P2 2 PRO A 37 ? LYS A 42 ? PRO A 37 LYS A 42 1 ? 6 HELX_P HELX_P3 3 ASP A 44 ? LYS A 47 ? ASP A 44 LYS A 47 1 ? 4 HELX_P HELX_P4 4 ASP A 60 ? LYS A 77 ? ASP A 60 LYS A 77 1 ? 18 HELX_P HELX_P5 5 LYS A 87 ? THR A 95 ? LYS A 87 THR A 95 1 ? 9 HELX_P HELX_P6 6 ILE A 101 ? ARG A 118 ? ILE A 101 ARG A 118 5 ? 18 HELX_P HELX_P7 7 ALA A 125 ? GLU A 148 ? ALA A 125 GLU A 148 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 93 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 93 A HEM 154 1_555 ? ? ? ? ? ? ? 2.005 ? ? metalc2 metalc ? ? B HEM . FE ? ? ? 1_555 C CMO . C ? ? A HEM 154 A CMO 155 1_555 ? ? ? ? ? ? ? 1.741 ? ? metalc3 metalc ? ? B HEM . FE ? ? ? 1_555 C CMO . O ? ? A HEM 154 A CMO 155 1_555 ? ? ? ? ? ? ? 2.858 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A HEM 154 ? 14 'BINDING SITE FOR RESIDUE HEM A 154' AC2 Software A CMO 155 ? 4 'BINDING SITE FOR RESIDUE CMO A 155' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 THR A 39 ? THR A 39 . ? 1_555 ? 2 AC1 14 PHE A 43 ? PHE A 43 . ? 1_555 ? 3 AC1 14 ARG A 45 ? ARG A 45 . ? 1_555 ? 4 AC1 14 HIS A 64 ? HIS A 64 . ? 1_555 ? 5 AC1 14 THR A 67 ? THR A 67 . ? 1_555 ? 6 AC1 14 VAL A 68 ? VAL A 68 . ? 1_555 ? 7 AC1 14 LEU A 72 ? LEU A 72 . ? 1_555 ? 8 AC1 14 SER A 92 ? SER A 92 . ? 1_555 ? 9 AC1 14 HIS A 93 ? HIS A 93 . ? 1_555 ? 10 AC1 14 HIS A 97 ? HIS A 97 . ? 1_555 ? 11 AC1 14 TYR A 103 ? TYR A 103 . ? 1_555 ? 12 AC1 14 LEU A 104 ? LEU A 104 . ? 1_555 ? 13 AC1 14 ILE A 107 ? ILE A 107 . ? 1_555 ? 14 AC1 14 CMO C . ? CMO A 155 . ? 1_555 ? 15 AC2 4 PHE A 43 ? PHE A 43 . ? 1_555 ? 16 AC2 4 HIS A 64 ? HIS A 64 . ? 1_555 ? 17 AC2 4 VAL A 68 ? VAL A 68 . ? 1_555 ? 18 AC2 4 HEM B . ? HEM A 154 . ? 1_555 ? # _database_PDB_matrix.entry_id 1MYF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1MYF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 MET 131 131 131 MET MET A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 GLY 153 153 153 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEM 1 154 1 HEM HEM A . C 3 CMO 1 155 1 CMO CMO A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 NA ? B HEM . ? A HEM 154 ? 1_555 91.1 ? 2 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 NB ? B HEM . ? A HEM 154 ? 1_555 87.1 ? 3 NA ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 NB ? B HEM . ? A HEM 154 ? 1_555 88.6 ? 4 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 NC ? B HEM . ? A HEM 154 ? 1_555 93.5 ? 5 NA ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 NC ? B HEM . ? A HEM 154 ? 1_555 175.3 ? 6 NB ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 NC ? B HEM . ? A HEM 154 ? 1_555 91.1 ? 7 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 ND ? B HEM . ? A HEM 154 ? 1_555 91.9 ? 8 NA ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 ND ? B HEM . ? A HEM 154 ? 1_555 90.5 ? 9 NB ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 ND ? B HEM . ? A HEM 154 ? 1_555 178.6 ? 10 NC ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 ND ? B HEM . ? A HEM 154 ? 1_555 89.9 ? 11 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 C ? C CMO . ? A CMO 155 ? 1_555 175.5 ? 12 NA ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 C ? C CMO . ? A CMO 155 ? 1_555 93.3 ? 13 NB ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 C ? C CMO . ? A CMO 155 ? 1_555 93.2 ? 14 NC ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 C ? C CMO . ? A CMO 155 ? 1_555 82.0 ? 15 ND ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 C ? C CMO . ? A CMO 155 ? 1_555 87.9 ? 16 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 O ? C CMO . ? A CMO 155 ? 1_555 173.9 ? 17 NA ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 O ? C CMO . ? A CMO 155 ? 1_555 95.0 ? 18 NB ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 O ? C CMO . ? A CMO 155 ? 1_555 93.8 ? 19 NC ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 O ? C CMO . ? A CMO 155 ? 1_555 80.4 ? 20 ND ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 O ? C CMO . ? A CMO 155 ? 1_555 87.3 ? 21 C ? C CMO . ? A CMO 155 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 O ? C CMO . ? A CMO 155 ? 1_555 1.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-02-27 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.value' 18 4 'Structure model' '_struct_conn.pdbx_dist_value' 19 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _software.name AMBER _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A VAL 68 ? ? CB A VAL 68 ? ? CG1 A VAL 68 ? ? 121.10 110.90 10.20 1.50 N 2 1 CB A HIS 82 ? ? CA A HIS 82 ? ? C A HIS 82 ? ? 122.88 110.40 12.48 2.00 N 3 1 CB A TYR 103 ? ? CG A TYR 103 ? ? CD2 A TYR 103 ? ? 116.76 121.00 -4.24 0.60 N 4 1 CB A TYR 146 ? ? CG A TYR 146 ? ? CD2 A TYR 146 ? ? 116.71 121.00 -4.29 0.60 N 5 2 CA A VAL 68 ? ? CB A VAL 68 ? ? CG1 A VAL 68 ? ? 120.30 110.90 9.40 1.50 N 6 2 CB A TYR 103 ? ? CG A TYR 103 ? ? CD2 A TYR 103 ? ? 117.09 121.00 -3.91 0.60 N 7 3 CB A TYR 146 ? ? CG A TYR 146 ? ? CD2 A TYR 146 ? ? 117.28 121.00 -3.72 0.60 N 8 4 CA A VAL 68 ? ? CB A VAL 68 ? ? CG1 A VAL 68 ? ? 120.50 110.90 9.60 1.50 N 9 5 CA A VAL 68 ? ? CB A VAL 68 ? ? CG1 A VAL 68 ? ? 120.20 110.90 9.30 1.50 N 10 6 CA A VAL 68 ? ? CB A VAL 68 ? ? CG1 A VAL 68 ? ? 121.21 110.90 10.31 1.50 N 11 6 CB A TYR 151 ? ? CG A TYR 151 ? ? CD1 A TYR 151 ? ? 117.22 121.00 -3.78 0.60 N 12 7 CB A HIS 48 ? ? CG A HIS 48 ? ? CD2 A HIS 48 ? ? 116.38 129.70 -13.32 1.60 N 13 7 CA A VAL 68 ? ? CB A VAL 68 ? ? CG1 A VAL 68 ? ? 120.23 110.90 9.33 1.50 N 14 7 C A LYS 87 ? ? N A PRO 88 ? ? CA A PRO 88 ? ? 128.92 119.30 9.62 1.50 Y 15 8 CB A TYR 103 ? ? CG A TYR 103 ? ? CD2 A TYR 103 ? ? 116.34 121.00 -4.66 0.60 N 16 9 CA A VAL 68 ? ? CB A VAL 68 ? ? CG1 A VAL 68 ? ? 120.94 110.90 10.04 1.50 N 17 10 CA A VAL 68 ? ? CB A VAL 68 ? ? CG1 A VAL 68 ? ? 121.45 110.90 10.55 1.50 N 18 11 CA A VAL 68 ? ? CB A VAL 68 ? ? CG1 A VAL 68 ? ? 121.05 110.90 10.15 1.50 N 19 11 CB A TYR 103 ? ? CG A TYR 103 ? ? CD2 A TYR 103 ? ? 116.97 121.00 -4.03 0.60 N 20 11 CB A TYR 146 ? ? CG A TYR 146 ? ? CD2 A TYR 146 ? ? 117.25 121.00 -3.75 0.60 N 21 12 CB A HIS 48 ? ? CG A HIS 48 ? ? CD2 A HIS 48 ? ? 116.42 129.70 -13.28 1.60 N 22 12 CA A VAL 68 ? ? CB A VAL 68 ? ? CG1 A VAL 68 ? ? 120.27 110.90 9.37 1.50 N 23 12 C A LYS 87 ? ? N A PRO 88 ? ? CA A PRO 88 ? ? 128.96 119.30 9.66 1.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 52 ? ? 35.06 62.65 2 1 ALA A 53 ? ? 73.04 103.53 3 1 GLU A 54 ? ? -75.53 42.98 4 1 LYS A 56 ? ? -141.48 -83.98 5 1 ALA A 57 ? ? 32.08 55.86 6 1 GLU A 59 ? ? 65.05 -72.19 7 1 LYS A 79 ? ? 33.75 55.27 8 1 HIS A 82 ? ? -13.07 65.38 9 1 ALA A 84 ? ? 70.03 -23.37 10 1 GLU A 85 ? ? -146.35 -66.09 11 1 LEU A 86 ? ? 74.21 -50.04 12 1 LYS A 87 ? ? -26.37 -56.92 13 1 LYS A 98 ? ? 97.47 54.84 14 1 ILE A 99 ? ? 40.93 -100.97 15 1 LYS A 102 ? ? 33.62 -74.81 16 1 TYR A 151 ? ? -125.58 -64.46 17 2 HIS A 81 ? ? -117.03 61.74 18 2 ALA A 94 ? ? -93.12 -63.39 19 2 ASP A 122 ? ? -165.23 -49.25 20 2 GLN A 152 ? ? 67.15 -50.98 21 3 GLU A 18 ? ? 106.45 37.50 22 3 ALA A 19 ? ? 45.04 24.86 23 3 ASP A 20 ? ? -94.04 54.12 24 3 THR A 51 ? ? -161.54 -160.76 25 3 ALA A 53 ? ? 81.14 -45.72 26 3 HIS A 81 ? ? -107.69 56.24 27 3 GLU A 83 ? ? 174.30 -48.06 28 3 ALA A 94 ? ? -72.59 -79.29 29 3 LYS A 98 ? ? -172.89 -54.85 30 3 ILE A 99 ? ? 108.63 -75.72 31 4 SER A 3 ? ? -170.48 -177.01 32 4 SER A 35 ? ? -64.29 -72.03 33 4 PRO A 37 ? ? -35.40 -21.02 34 4 GLU A 52 ? ? -65.89 77.05 35 4 ALA A 53 ? ? -163.54 -50.19 36 4 HIS A 81 ? ? -114.18 66.05 37 4 HIS A 82 ? ? -112.87 -100.28 38 4 GLU A 83 ? ? 74.12 -40.27 39 4 ALA A 94 ? ? -76.23 -71.39 40 4 LYS A 98 ? ? 75.71 82.82 41 4 ILE A 99 ? ? 18.79 -84.61 42 4 PRO A 100 ? ? -22.66 102.96 43 4 ASP A 122 ? ? -160.70 -44.36 44 5 GLU A 38 ? ? -143.80 -44.48 45 5 ASP A 44 ? ? 68.01 -67.97 46 5 ARG A 45 ? ? -161.98 34.63 47 5 LYS A 47 ? ? 35.26 -1.52 48 5 HIS A 48 ? ? -172.81 -2.25 49 5 LYS A 50 ? ? -151.68 -60.85 50 5 SER A 58 ? ? -68.85 84.82 51 5 HIS A 81 ? ? -108.75 63.75 52 5 GLU A 83 ? ? -172.47 -61.87 53 5 LEU A 86 ? ? -165.72 -58.56 54 5 ALA A 94 ? ? -76.55 -74.29 55 5 LYS A 98 ? ? 71.37 80.86 56 5 ILE A 99 ? ? 3.18 -74.96 57 5 PRO A 100 ? ? -26.67 98.96 58 6 LYS A 47 ? ? 11.44 -81.05 59 6 LYS A 78 ? ? -79.72 31.26 60 6 LYS A 79 ? ? 35.61 43.02 61 6 HIS A 82 ? ? 72.53 155.90 62 6 GLU A 83 ? ? 64.20 -26.55 63 6 LEU A 86 ? ? 72.24 -56.82 64 6 LYS A 87 ? ? -29.33 -63.87 65 6 LYS A 98 ? ? 89.42 79.72 66 6 ILE A 99 ? ? -8.70 -68.61 67 6 ASP A 122 ? ? -131.48 -157.08 68 6 ALA A 127 ? ? -175.26 -57.28 69 7 PHE A 46 ? ? -90.19 57.82 70 7 LYS A 47 ? ? -28.20 110.57 71 7 HIS A 48 ? ? -69.05 58.64 72 7 GLU A 59 ? ? -38.01 -21.04 73 7 LYS A 79 ? ? -59.13 43.45 74 7 HIS A 81 ? ? -117.08 77.28 75 7 GLU A 83 ? ? 150.70 -56.41 76 7 PRO A 88 ? ? 2.16 53.83 77 7 GLN A 152 ? ? 1.54 -67.99 78 8 GLU A 18 ? ? 104.97 37.82 79 8 ALA A 19 ? ? 44.48 25.71 80 8 ASP A 20 ? ? -90.11 57.88 81 8 PHE A 43 ? ? -65.08 96.44 82 8 LYS A 79 ? ? 36.88 55.87 83 8 HIS A 81 ? ? -117.64 56.61 84 8 HIS A 82 ? ? -105.63 -100.21 85 8 GLU A 83 ? ? 69.81 -31.77 86 8 GLU A 85 ? ? -78.37 -151.91 87 8 LEU A 86 ? ? 71.21 -57.51 88 8 LYS A 98 ? ? 100.69 92.05 89 8 ILE A 99 ? ? 8.66 -81.76 90 8 PRO A 100 ? ? -20.93 99.11 91 8 TYR A 146 ? ? -67.68 4.59 92 8 TYR A 151 ? ? 57.35 -59.47 93 9 LYS A 79 ? ? 37.69 59.14 94 9 HIS A 82 ? ? 12.08 61.67 95 9 ALA A 84 ? ? 68.07 -10.80 96 9 GLU A 85 ? ? -137.84 -91.05 97 9 LEU A 86 ? ? 70.27 -46.65 98 9 LYS A 96 ? ? -96.93 -63.33 99 9 ILE A 101 ? ? 20.08 69.47 100 9 LYS A 102 ? ? -152.52 -46.12 101 9 ASP A 122 ? ? -161.28 -46.09 102 10 GLU A 38 ? ? 76.67 -48.26 103 10 PHE A 43 ? ? -82.88 49.27 104 10 ASP A 44 ? ? 65.95 -68.06 105 10 ARG A 45 ? ? -159.20 3.88 106 10 LYS A 47 ? ? -55.92 86.37 107 10 HIS A 48 ? ? 163.90 -31.00 108 10 ALA A 53 ? ? -169.87 -41.85 109 10 LYS A 79 ? ? -37.66 73.69 110 10 HIS A 82 ? ? -92.78 -63.94 111 10 GLU A 83 ? ? 72.30 -34.02 112 10 GLU A 85 ? ? 61.62 162.13 113 10 LEU A 86 ? ? -74.14 43.15 114 10 ALA A 94 ? ? -71.88 -70.64 115 10 LYS A 98 ? ? 59.84 77.13 116 10 ILE A 99 ? ? 12.72 -80.72 117 10 PRO A 100 ? ? -22.89 101.39 118 10 ALA A 125 ? ? -36.62 123.43 119 10 ASP A 126 ? ? 71.03 -41.96 120 11 ASP A 44 ? ? 67.92 -69.30 121 11 ARG A 45 ? ? -163.12 33.46 122 11 LYS A 47 ? ? 56.16 -34.60 123 11 SER A 58 ? ? -69.07 95.50 124 11 LYS A 79 ? ? 36.52 48.97 125 11 HIS A 81 ? ? -113.11 63.42 126 11 GLU A 83 ? ? -176.72 -60.83 127 11 LEU A 86 ? ? -177.79 -58.21 128 11 ALA A 94 ? ? -87.45 -71.37 129 11 ILE A 101 ? ? 38.67 68.01 130 11 LYS A 102 ? ? -144.35 -53.62 131 11 LEU A 135 ? ? 149.60 -23.18 132 11 GLU A 136 ? ? 69.89 -8.83 133 11 LEU A 137 ? ? -34.39 -32.04 134 12 PHE A 46 ? ? -90.20 57.84 135 12 LYS A 47 ? ? -28.23 110.60 136 12 HIS A 48 ? ? -69.05 58.64 137 12 GLU A 59 ? ? -37.97 -21.03 138 12 LYS A 79 ? ? -59.22 43.50 139 12 HIS A 81 ? ? -117.14 77.29 140 12 GLU A 83 ? ? 150.66 -56.41 141 12 PRO A 88 ? ? 2.05 53.90 142 12 GLN A 152 ? ? 1.63 -68.08 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 HIS A 81 ? ? 0.077 'SIDE CHAIN' 2 1 TYR A 103 ? ? 0.158 'SIDE CHAIN' 3 1 PHE A 106 ? ? 0.079 'SIDE CHAIN' 4 1 HIS A 116 ? ? 0.087 'SIDE CHAIN' 5 2 TYR A 103 ? ? 0.075 'SIDE CHAIN' 6 2 HIS A 116 ? ? 0.083 'SIDE CHAIN' 7 3 PHE A 46 ? ? 0.111 'SIDE CHAIN' 8 3 TYR A 103 ? ? 0.142 'SIDE CHAIN' 9 3 PHE A 106 ? ? 0.075 'SIDE CHAIN' 10 3 HIS A 119 ? ? 0.096 'SIDE CHAIN' 11 3 TYR A 151 ? ? 0.123 'SIDE CHAIN' 12 4 PHE A 46 ? ? 0.080 'SIDE CHAIN' 13 4 TYR A 103 ? ? 0.077 'SIDE CHAIN' 14 4 PHE A 106 ? ? 0.085 'SIDE CHAIN' 15 4 TYR A 151 ? ? 0.076 'SIDE CHAIN' 16 5 PHE A 46 ? ? 0.102 'SIDE CHAIN' 17 5 HIS A 48 ? ? 0.116 'SIDE CHAIN' 18 5 TYR A 103 ? ? 0.163 'SIDE CHAIN' 19 6 TYR A 103 ? ? 0.153 'SIDE CHAIN' 20 6 TYR A 151 ? ? 0.174 'SIDE CHAIN' 21 7 PHE A 46 ? ? 0.128 'SIDE CHAIN' 22 7 HIS A 48 ? ? 0.249 'SIDE CHAIN' 23 7 TYR A 103 ? ? 0.114 'SIDE CHAIN' 24 7 PHE A 106 ? ? 0.086 'SIDE CHAIN' 25 8 TYR A 103 ? ? 0.082 'SIDE CHAIN' 26 8 HIS A 113 ? ? 0.101 'SIDE CHAIN' 27 8 HIS A 119 ? ? 0.091 'SIDE CHAIN' 28 9 PHE A 46 ? ? 0.084 'SIDE CHAIN' 29 9 TYR A 103 ? ? 0.155 'SIDE CHAIN' 30 10 PHE A 46 ? ? 0.124 'SIDE CHAIN' 31 10 PHE A 106 ? ? 0.099 'SIDE CHAIN' 32 10 HIS A 113 ? ? 0.108 'SIDE CHAIN' 33 11 PHE A 46 ? ? 0.108 'SIDE CHAIN' 34 11 HIS A 48 ? ? 0.123 'SIDE CHAIN' 35 11 TYR A 103 ? ? 0.104 'SIDE CHAIN' 36 11 ARG A 118 ? ? 0.100 'SIDE CHAIN' 37 11 PHE A 138 ? ? 0.085 'SIDE CHAIN' 38 12 PHE A 46 ? ? 0.127 'SIDE CHAIN' 39 12 HIS A 48 ? ? 0.249 'SIDE CHAIN' 40 12 TYR A 103 ? ? 0.114 'SIDE CHAIN' 41 12 PHE A 106 ? ? 0.085 'SIDE CHAIN' # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 CA ? A HIS 82 ? PLANAR . 2 9 CA ? A HIS 82 ? PLANAR . # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PROTOPORPHYRIN IX CONTAINING FE' HEM 3 'CARBON MONOXIDE' CMO #