data_1MZT # _entry.id 1MZT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1MZT pdb_00001mzt 10.2210/pdb1mzt/pdb RCSB RCSB017341 ? ? WWPDB D_1000017341 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1FDM _pdbx_database_related.details 'Fd Major Coat Protein In SDS Micelles, NMR, 20 Structures' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1MZT _pdbx_database_status.recvd_initial_deposition_date 2002-10-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Marassi, F.M.' 1 'Opella, S.J.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Simultaneous assignment and structure determination of a membrane protein from NMR orientational restraints' 'Protein Sci.' 12 403 411 2003 PRCIEI US 0961-8368 0795 ? 12592011 10.1110/ps.0211503 1 'Using Pisa pies to resolve ambiguities in angular constraints from PISEMA spectra of aligned proteins' J.Biomol.NMR 23 239 242 2002 JBNME9 NE 0925-2738 0800 ? ? 10.1023/A:1019887612018 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Marassi, F.M.' 1 ? primary 'Opella, S.J.' 2 ? 1 'Marassi, F.M.' 3 ? 1 'Opella, S.J.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'major coat protein pVIII' _entity.formula_weight 5244.000 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Filamentous phage cloning vector fd-tet' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS _entity_poly.pdbx_seq_one_letter_code_can AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 GLY n 1 4 ASP n 1 5 ASP n 1 6 PRO n 1 7 ALA n 1 8 LYS n 1 9 ALA n 1 10 ALA n 1 11 PHE n 1 12 ASP n 1 13 SER n 1 14 LEU n 1 15 GLN n 1 16 ALA n 1 17 SER n 1 18 ALA n 1 19 THR n 1 20 GLU n 1 21 TYR n 1 22 ILE n 1 23 GLY n 1 24 TYR n 1 25 ALA n 1 26 TRP n 1 27 ALA n 1 28 MET n 1 29 VAL n 1 30 VAL n 1 31 VAL n 1 32 ILE n 1 33 VAL n 1 34 GLY n 1 35 ALA n 1 36 THR n 1 37 ILE n 1 38 GLY n 1 39 ILE n 1 40 LYS n 1 41 LEU n 1 42 PHE n 1 43 LYS n 1 44 LYS n 1 45 PHE n 1 46 THR n 1 47 SER n 1 48 LYS n 1 49 ALA n 1 50 SER n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Enterobacteria phage fd' _entity_src_nat.pdbx_ncbi_taxonomy_id 10864 _entity_src_nat.genus Inovirus _entity_src_nat.species 'Enterobacteria phage M13' _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code COATB_BPFD _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_accession P69539 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1MZT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P69539 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 73 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 50 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type '1H/15N PISEMA' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '8 mg 15N-labeled fd coat protein, 64 mg POPC, 16 mg POPG, lipid bilayers oriented on glass slides' _pdbx_nmr_sample_details.solvent_system 'Lipid bilayers hydrated in water' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Chemagnetics _pdbx_nmr_spectrometer.model CMX _pdbx_nmr_spectrometer.field_strength 400 # _pdbx_nmr_refine.entry_id 1MZT _pdbx_nmr_refine.method ;Calculation of bond orientations and dihedral angles from solid-state NMR restraints, followed by back-calculation of NMR data from oriented structure ; _pdbx_nmr_refine.details 'Structure calculated from 40 chemical shift and 40 dipolar coupling restraints' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1MZT _pdbx_nmr_details.text 'The structure was determined from one uniformly and four selectively 15N-labeled samples.' # _pdbx_nmr_ensemble.entry_id 1MZT _pdbx_nmr_ensemble.conformers_calculated_total_number 6 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1MZT _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal CMXW 95 collection Chemagnetics 1 Felix 95 'data analysis' Biosym 2 BACKTOR 2 'structure solution' 'Marassi, Opella' 3 BACKTOR 2 refinement 'Marassi, Opella' 4 # _exptl.entry_id 1MZT _exptl.method 'SOLID-STATE NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1MZT _struct.title 'NMR structure of the fd bacteriophage pVIII coat protein in lipid bilayer membranes' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1MZT _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'fd coat protein, membrane-bound, pVIII, Viral protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 7 ? THR A 19 ? ALA A 7 THR A 19 1 ? 13 HELX_P HELX_P2 2 GLU A 20 ? PHE A 45 ? GLU A 20 PHE A 45 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1MZT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1MZT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 ASP 5 5 ? ? ? A . n A 1 6 PRO 6 6 ? ? ? A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 THR 46 46 ? ? ? A . n A 1 47 SER 47 47 ? ? ? A . n A 1 48 LYS 48 48 ? ? ? A . n A 1 49 ALA 49 49 ? ? ? A . n A 1 50 SER 50 50 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-11-27 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE AUTHOR PROVIDED COORDINATES FOR THE PROTEIN BACKBONE ONLY. ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A VAL 33 ? ? H A ILE 37 ? ? 1.43 2 1 O A ALA 25 ? ? H A VAL 29 ? ? 1.48 3 1 O A GLY 34 ? ? H A GLY 38 ? ? 1.49 4 1 O A VAL 30 ? ? H A GLY 34 ? ? 1.50 5 1 O A SER 17 ? ? CA A TYR 24 ? ? 2.01 6 1 O A THR 36 ? ? N A LEU 41 ? ? 2.12 7 1 O A ILE 37 ? ? CA A LEU 41 ? ? 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 19 ? ? -93.08 -81.76 2 1 GLU A 20 ? ? -37.20 132.45 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ALA 7 ? CB ? A ALA 7 CB 2 1 Y 1 A LYS 8 ? CB ? A LYS 8 CB 3 1 Y 1 A LYS 8 ? CG ? A LYS 8 CG 4 1 Y 1 A LYS 8 ? CD ? A LYS 8 CD 5 1 Y 1 A LYS 8 ? CE ? A LYS 8 CE 6 1 Y 1 A LYS 8 ? NZ ? A LYS 8 NZ 7 1 Y 1 A ALA 9 ? CB ? A ALA 9 CB 8 1 Y 1 A ALA 10 ? CB ? A ALA 10 CB 9 1 Y 1 A PHE 11 ? CB ? A PHE 11 CB 10 1 Y 1 A PHE 11 ? CG ? A PHE 11 CG 11 1 Y 1 A PHE 11 ? CD1 ? A PHE 11 CD1 12 1 Y 1 A PHE 11 ? CD2 ? A PHE 11 CD2 13 1 Y 1 A PHE 11 ? CE1 ? A PHE 11 CE1 14 1 Y 1 A PHE 11 ? CE2 ? A PHE 11 CE2 15 1 Y 1 A PHE 11 ? CZ ? A PHE 11 CZ 16 1 Y 1 A ASP 12 ? CB ? A ASP 12 CB 17 1 Y 1 A ASP 12 ? CG ? A ASP 12 CG 18 1 Y 1 A ASP 12 ? OD1 ? A ASP 12 OD1 19 1 Y 1 A ASP 12 ? OD2 ? A ASP 12 OD2 20 1 Y 1 A SER 13 ? CB ? A SER 13 CB 21 1 Y 1 A SER 13 ? OG ? A SER 13 OG 22 1 Y 1 A LEU 14 ? CB ? A LEU 14 CB 23 1 Y 1 A LEU 14 ? CG ? A LEU 14 CG 24 1 Y 1 A LEU 14 ? CD1 ? A LEU 14 CD1 25 1 Y 1 A LEU 14 ? CD2 ? A LEU 14 CD2 26 1 Y 1 A GLN 15 ? CB ? A GLN 15 CB 27 1 Y 1 A GLN 15 ? CG ? A GLN 15 CG 28 1 Y 1 A GLN 15 ? CD ? A GLN 15 CD 29 1 Y 1 A GLN 15 ? OE1 ? A GLN 15 OE1 30 1 Y 1 A GLN 15 ? NE2 ? A GLN 15 NE2 31 1 Y 1 A ALA 16 ? CB ? A ALA 16 CB 32 1 Y 1 A SER 17 ? CB ? A SER 17 CB 33 1 Y 1 A SER 17 ? OG ? A SER 17 OG 34 1 Y 1 A ALA 18 ? CB ? A ALA 18 CB 35 1 Y 1 A THR 19 ? CB ? A THR 19 CB 36 1 Y 1 A THR 19 ? OG1 ? A THR 19 OG1 37 1 Y 1 A THR 19 ? CG2 ? A THR 19 CG2 38 1 Y 1 A GLU 20 ? CB ? A GLU 20 CB 39 1 Y 1 A GLU 20 ? CG ? A GLU 20 CG 40 1 Y 1 A GLU 20 ? CD ? A GLU 20 CD 41 1 Y 1 A GLU 20 ? OE1 ? A GLU 20 OE1 42 1 Y 1 A GLU 20 ? OE2 ? A GLU 20 OE2 43 1 Y 1 A TYR 21 ? CB ? A TYR 21 CB 44 1 Y 1 A TYR 21 ? CG ? A TYR 21 CG 45 1 Y 1 A TYR 21 ? CD1 ? A TYR 21 CD1 46 1 Y 1 A TYR 21 ? CD2 ? A TYR 21 CD2 47 1 Y 1 A TYR 21 ? CE1 ? A TYR 21 CE1 48 1 Y 1 A TYR 21 ? CE2 ? A TYR 21 CE2 49 1 Y 1 A TYR 21 ? CZ ? A TYR 21 CZ 50 1 Y 1 A TYR 21 ? OH ? A TYR 21 OH 51 1 Y 1 A ILE 22 ? CB ? A ILE 22 CB 52 1 Y 1 A ILE 22 ? CG1 ? A ILE 22 CG1 53 1 Y 1 A ILE 22 ? CG2 ? A ILE 22 CG2 54 1 Y 1 A ILE 22 ? CD1 ? A ILE 22 CD1 55 1 Y 1 A TYR 24 ? CB ? A TYR 24 CB 56 1 Y 1 A TYR 24 ? CG ? A TYR 24 CG 57 1 Y 1 A TYR 24 ? CD1 ? A TYR 24 CD1 58 1 Y 1 A TYR 24 ? CD2 ? A TYR 24 CD2 59 1 Y 1 A TYR 24 ? CE1 ? A TYR 24 CE1 60 1 Y 1 A TYR 24 ? CE2 ? A TYR 24 CE2 61 1 Y 1 A TYR 24 ? CZ ? A TYR 24 CZ 62 1 Y 1 A TYR 24 ? OH ? A TYR 24 OH 63 1 Y 1 A ALA 25 ? CB ? A ALA 25 CB 64 1 Y 1 A TRP 26 ? CB ? A TRP 26 CB 65 1 Y 1 A TRP 26 ? CG ? A TRP 26 CG 66 1 Y 1 A TRP 26 ? CD1 ? A TRP 26 CD1 67 1 Y 1 A TRP 26 ? CD2 ? A TRP 26 CD2 68 1 Y 1 A TRP 26 ? NE1 ? A TRP 26 NE1 69 1 Y 1 A TRP 26 ? CE2 ? A TRP 26 CE2 70 1 Y 1 A TRP 26 ? CE3 ? A TRP 26 CE3 71 1 Y 1 A TRP 26 ? CZ2 ? A TRP 26 CZ2 72 1 Y 1 A TRP 26 ? CZ3 ? A TRP 26 CZ3 73 1 Y 1 A TRP 26 ? CH2 ? A TRP 26 CH2 74 1 Y 1 A ALA 27 ? CB ? A ALA 27 CB 75 1 Y 1 A MET 28 ? CB ? A MET 28 CB 76 1 Y 1 A MET 28 ? CG ? A MET 28 CG 77 1 Y 1 A MET 28 ? SD ? A MET 28 SD 78 1 Y 1 A MET 28 ? CE ? A MET 28 CE 79 1 Y 1 A VAL 29 ? CB ? A VAL 29 CB 80 1 Y 1 A VAL 29 ? CG1 ? A VAL 29 CG1 81 1 Y 1 A VAL 29 ? CG2 ? A VAL 29 CG2 82 1 Y 1 A VAL 30 ? CB ? A VAL 30 CB 83 1 Y 1 A VAL 30 ? CG1 ? A VAL 30 CG1 84 1 Y 1 A VAL 30 ? CG2 ? A VAL 30 CG2 85 1 Y 1 A VAL 31 ? CB ? A VAL 31 CB 86 1 Y 1 A VAL 31 ? CG1 ? A VAL 31 CG1 87 1 Y 1 A VAL 31 ? CG2 ? A VAL 31 CG2 88 1 Y 1 A ILE 32 ? CB ? A ILE 32 CB 89 1 Y 1 A ILE 32 ? CG1 ? A ILE 32 CG1 90 1 Y 1 A ILE 32 ? CG2 ? A ILE 32 CG2 91 1 Y 1 A ILE 32 ? CD1 ? A ILE 32 CD1 92 1 Y 1 A VAL 33 ? CB ? A VAL 33 CB 93 1 Y 1 A VAL 33 ? CG1 ? A VAL 33 CG1 94 1 Y 1 A VAL 33 ? CG2 ? A VAL 33 CG2 95 1 Y 1 A ALA 35 ? CB ? A ALA 35 CB 96 1 Y 1 A THR 36 ? CB ? A THR 36 CB 97 1 Y 1 A THR 36 ? OG1 ? A THR 36 OG1 98 1 Y 1 A THR 36 ? CG2 ? A THR 36 CG2 99 1 Y 1 A ILE 37 ? CB ? A ILE 37 CB 100 1 Y 1 A ILE 37 ? CG1 ? A ILE 37 CG1 101 1 Y 1 A ILE 37 ? CG2 ? A ILE 37 CG2 102 1 Y 1 A ILE 37 ? CD1 ? A ILE 37 CD1 103 1 Y 1 A ILE 39 ? CB ? A ILE 39 CB 104 1 Y 1 A ILE 39 ? CG1 ? A ILE 39 CG1 105 1 Y 1 A ILE 39 ? CG2 ? A ILE 39 CG2 106 1 Y 1 A ILE 39 ? CD1 ? A ILE 39 CD1 107 1 Y 1 A LYS 40 ? CB ? A LYS 40 CB 108 1 Y 1 A LYS 40 ? CG ? A LYS 40 CG 109 1 Y 1 A LYS 40 ? CD ? A LYS 40 CD 110 1 Y 1 A LYS 40 ? CE ? A LYS 40 CE 111 1 Y 1 A LYS 40 ? NZ ? A LYS 40 NZ 112 1 Y 1 A LEU 41 ? CB ? A LEU 41 CB 113 1 Y 1 A LEU 41 ? CG ? A LEU 41 CG 114 1 Y 1 A LEU 41 ? CD1 ? A LEU 41 CD1 115 1 Y 1 A LEU 41 ? CD2 ? A LEU 41 CD2 116 1 Y 1 A PHE 42 ? CB ? A PHE 42 CB 117 1 Y 1 A PHE 42 ? CG ? A PHE 42 CG 118 1 Y 1 A PHE 42 ? CD1 ? A PHE 42 CD1 119 1 Y 1 A PHE 42 ? CD2 ? A PHE 42 CD2 120 1 Y 1 A PHE 42 ? CE1 ? A PHE 42 CE1 121 1 Y 1 A PHE 42 ? CE2 ? A PHE 42 CE2 122 1 Y 1 A PHE 42 ? CZ ? A PHE 42 CZ 123 1 Y 1 A LYS 43 ? CB ? A LYS 43 CB 124 1 Y 1 A LYS 43 ? CG ? A LYS 43 CG 125 1 Y 1 A LYS 43 ? CD ? A LYS 43 CD 126 1 Y 1 A LYS 43 ? CE ? A LYS 43 CE 127 1 Y 1 A LYS 43 ? NZ ? A LYS 43 NZ 128 1 Y 1 A LYS 44 ? CB ? A LYS 44 CB 129 1 Y 1 A LYS 44 ? CG ? A LYS 44 CG 130 1 Y 1 A LYS 44 ? CD ? A LYS 44 CD 131 1 Y 1 A LYS 44 ? CE ? A LYS 44 CE 132 1 Y 1 A LYS 44 ? NZ ? A LYS 44 NZ 133 1 Y 1 A PHE 45 ? CB ? A PHE 45 CB 134 1 Y 1 A PHE 45 ? CG ? A PHE 45 CG 135 1 Y 1 A PHE 45 ? CD1 ? A PHE 45 CD1 136 1 Y 1 A PHE 45 ? CD2 ? A PHE 45 CD2 137 1 Y 1 A PHE 45 ? CE1 ? A PHE 45 CE1 138 1 Y 1 A PHE 45 ? CE2 ? A PHE 45 CE2 139 1 Y 1 A PHE 45 ? CZ ? A PHE 45 CZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A ASP 4 ? A ASP 4 5 1 Y 1 A ASP 5 ? A ASP 5 6 1 Y 1 A PRO 6 ? A PRO 6 7 1 Y 1 A THR 46 ? A THR 46 8 1 Y 1 A SER 47 ? A SER 47 9 1 Y 1 A LYS 48 ? A LYS 48 10 1 Y 1 A ALA 49 ? A ALA 49 11 1 Y 1 A SER 50 ? A SER 50 #