data_1N6V # _entry.id 1N6V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1N6V pdb_00001n6v 10.2210/pdb1n6v/pdb RCSB RCSB017592 ? ? WWPDB D_1000017592 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1N6U _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1N6V _pdbx_database_status.recvd_initial_deposition_date 2002-11-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chill, J.H.' 1 'Quadt, S.R.' 2 'Levy, R.' 3 'Schreiber, G.' 4 'Anglister, J.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'The human type I interferon receptor. NMR structure reveals the molecular basis of ligand binding.' Structure 11 791 802 2003 STRUE6 UK 0969-2126 2005 ? 12842042 '10.1016/S0969-2126(03)00120-5' 1 'The human interferon receptor: NMR-based modeling, mapping of the IFN-alpha2 binding site, and observed ligand-induced tightening' Biochemistry 41 3575 3585 2002 BICHAW US 0006-2960 0033 ? ? 10.1021/bi011778f # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chill, J.H.' 1 ? primary 'Quadt, S.R.' 2 ? primary 'Levy, R.' 3 ? primary 'Schreiber, G.' 4 ? primary 'Anglister, J.' 5 ? 1 'Chill, J.H.' 6 ? 1 'Nivasch, R.' 7 ? 1 'Levy, R.' 8 ? 1 'Albeck, S.' 9 ? 1 'Schreiber, G.' 10 ? 1 'Anglister, J.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Interferon-alpha/beta receptor beta chain' _entity.formula_weight 24323.438 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'IFNAR2-EC, IFN-alpha-REC, Type I interferon receptor, IFN-R, Interferon alpha/beta receptor- 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWRSTHEAYV TVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKG NMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESEFS ; _entity_poly.pdbx_seq_one_letter_code_can ;SYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWRSTHEAYV TVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKG NMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESEFS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 TYR n 1 3 ASP n 1 4 SER n 1 5 PRO n 1 6 ASP n 1 7 TYR n 1 8 THR n 1 9 ASP n 1 10 GLU n 1 11 SER n 1 12 CYS n 1 13 THR n 1 14 PHE n 1 15 LYS n 1 16 ILE n 1 17 SER n 1 18 LEU n 1 19 ARG n 1 20 ASN n 1 21 PHE n 1 22 ARG n 1 23 SER n 1 24 ILE n 1 25 LEU n 1 26 SER n 1 27 TRP n 1 28 GLU n 1 29 LEU n 1 30 LYS n 1 31 ASN n 1 32 HIS n 1 33 SER n 1 34 ILE n 1 35 VAL n 1 36 PRO n 1 37 THR n 1 38 HIS n 1 39 TYR n 1 40 THR n 1 41 LEU n 1 42 LEU n 1 43 TYR n 1 44 THR n 1 45 ILE n 1 46 MET n 1 47 SER n 1 48 LYS n 1 49 PRO n 1 50 GLU n 1 51 ASP n 1 52 LEU n 1 53 LYS n 1 54 VAL n 1 55 VAL n 1 56 LYS n 1 57 ASN n 1 58 CYS n 1 59 ALA n 1 60 ASN n 1 61 THR n 1 62 THR n 1 63 ARG n 1 64 SER n 1 65 PHE n 1 66 CYS n 1 67 ASP n 1 68 LEU n 1 69 THR n 1 70 ASP n 1 71 GLU n 1 72 TRP n 1 73 ARG n 1 74 SER n 1 75 THR n 1 76 HIS n 1 77 GLU n 1 78 ALA n 1 79 TYR n 1 80 VAL n 1 81 THR n 1 82 VAL n 1 83 LEU n 1 84 GLU n 1 85 GLY n 1 86 PHE n 1 87 SER n 1 88 GLY n 1 89 ASN n 1 90 THR n 1 91 THR n 1 92 LEU n 1 93 PHE n 1 94 SER n 1 95 CYS n 1 96 SER n 1 97 HIS n 1 98 ASN n 1 99 PHE n 1 100 TRP n 1 101 LEU n 1 102 ALA n 1 103 ILE n 1 104 ASP n 1 105 MET n 1 106 SER n 1 107 PHE n 1 108 GLU n 1 109 PRO n 1 110 PRO n 1 111 GLU n 1 112 PHE n 1 113 GLU n 1 114 ILE n 1 115 VAL n 1 116 GLY n 1 117 PHE n 1 118 THR n 1 119 ASN n 1 120 HIS n 1 121 ILE n 1 122 ASN n 1 123 VAL n 1 124 MET n 1 125 VAL n 1 126 LYS n 1 127 PHE n 1 128 PRO n 1 129 SER n 1 130 ILE n 1 131 VAL n 1 132 GLU n 1 133 GLU n 1 134 GLU n 1 135 LEU n 1 136 GLN n 1 137 PHE n 1 138 ASP n 1 139 LEU n 1 140 SER n 1 141 LEU n 1 142 VAL n 1 143 ILE n 1 144 GLU n 1 145 GLU n 1 146 GLN n 1 147 SER n 1 148 GLU n 1 149 GLY n 1 150 ILE n 1 151 VAL n 1 152 LYS n 1 153 LYS n 1 154 HIS n 1 155 LYS n 1 156 PRO n 1 157 GLU n 1 158 ILE n 1 159 LYS n 1 160 GLY n 1 161 ASN n 1 162 MET n 1 163 SER n 1 164 GLY n 1 165 ASN n 1 166 PHE n 1 167 THR n 1 168 TYR n 1 169 ILE n 1 170 ILE n 1 171 ASP n 1 172 LYS n 1 173 LEU n 1 174 ILE n 1 175 PRO n 1 176 ASN n 1 177 THR n 1 178 ASN n 1 179 TYR n 1 180 CYS n 1 181 VAL n 1 182 SER n 1 183 VAL n 1 184 TYR n 1 185 LEU n 1 186 GLU n 1 187 HIS n 1 188 SER n 1 189 ASP n 1 190 GLU n 1 191 GLN n 1 192 ALA n 1 193 VAL n 1 194 ILE n 1 195 LYS n 1 196 SER n 1 197 PRO n 1 198 LEU n 1 199 LYS n 1 200 CYS n 1 201 THR n 1 202 LEU n 1 203 LEU n 1 204 PRO n 1 205 PRO n 1 206 GLY n 1 207 GLN n 1 208 GLU n 1 209 SER n 1 210 GLU n 1 211 PHE n 1 212 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain TG1 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code INAR2_HUMAN _struct_ref.pdbx_db_accession P48551 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWRSTHEAYV TVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKG NMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESE ; _struct_ref.pdbx_align_begin 28 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1N6V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 210 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P48551 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 237 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 210 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1N6V PHE A 211 ? UNP P48551 ? ? 'cloning artifact' 211 1 1 1N6V SER A 212 ? UNP P48551 ? ? 'cloning artifact' 212 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 HNHA 3 2 2 HNCA 4 2 2 HNCACB 5 2 2 CBCACONH 6 3 3 3D_13C-separated_NOESY # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 308 ambient 8 '20mM Tris buffer' ? K 2 308 ambient 8 '20mM Tris buffer' ? K 3 305 ambient 8 '20mM Tris buffer' ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.4mM U-15N IFNAR2-EC; 20mM d-Tris pH 8, 0.02% NaN3' '95% H2O/5% D2O' 2 '0.35mM U-13C,15N IFNAR2-EC; 20mM d-Tris pH 8, 0.02% NaN3' '95% H2O/5% D2O' 3 '0.3mM U-13C,15N IFNAR2-EC; 20mM d-Tris pH 8, 0.02% NaN3' '99% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 800 2 ? Bruker DMX 500 # _pdbx_nmr_refine.entry_id 1N6V _pdbx_nmr_refine.method 'distance geometry, simulated annealing' _pdbx_nmr_refine.details ;Structure based upon 1947 NOE-derived distance restraints (1066 of which long range), 172 dihedral angle restraints (of which 88 experimental and 84 TALOS-derived), 138 hydrogen-bond restraints and 109 residual dipolar coupling restraints ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1N6V _pdbx_nmr_details.text 'All experiments conducted in Shigemi tubes equipped with insert' # _pdbx_nmr_ensemble.entry_id 1N6V _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1N6V _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.0 processing Neidig 1 CNS 1.1 'structure solution' Brunger 2 NMRPipe 2.1 'data analysis' Delaglio 3 CNS 1.1 refinement Brunger 4 # _exptl.entry_id 1N6V _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1N6V _struct.title 'Average structure of the interferon-binding ectodomain of the human type I interferon receptor' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1N6V _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text 'immunoglobulin fold, fibronectin fold, two-domain structure, IMMUNE SYSTEM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 101 ? MET A 105 ? LEU A 101 MET A 105 1 ? 5 HELX_P HELX_P2 2 VAL A 131 ? LEU A 135 ? VAL A 131 LEU A 135 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 95 SG ? ? A CYS 12 A CYS 95 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf2 disulf ? ? A CYS 58 SG ? ? ? 1_555 A CYS 66 SG ? ? A CYS 58 A CYS 66 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf3 disulf ? ? A CYS 180 SG ? ? ? 1_555 A CYS 200 SG ? ? A CYS 180 A CYS 200 1_555 ? ? ? ? ? ? ? 2.035 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? C ? 4 ? D ? 2 ? E ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel D 1 2 ? anti-parallel E 1 2 ? anti-parallel E 2 3 ? anti-parallel E 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 13 ? LEU A 18 ? THR A 13 LEU A 18 A 2 SER A 23 ? GLU A 28 ? SER A 23 GLU A 28 A 3 CYS A 66 ? LEU A 68 ? CYS A 66 LEU A 68 B 1 LYS A 48 ? VAL A 54 ? LYS A 48 VAL A 54 B 2 TYR A 39 ? ILE A 45 ? TYR A 39 ILE A 45 B 3 ALA A 78 ? SER A 87 ? ALA A 78 SER A 87 B 4 THR A 90 ? THR A 91 ? THR A 90 THR A 91 C 1 LYS A 48 ? VAL A 54 ? LYS A 48 VAL A 54 C 2 TYR A 39 ? ILE A 45 ? TYR A 39 ILE A 45 C 3 ALA A 78 ? SER A 87 ? ALA A 78 SER A 87 C 4 CYS A 95 ? TRP A 100 ? CYS A 95 TRP A 100 D 1 GLU A 111 ? PHE A 117 ? GLU A 111 PHE A 117 D 2 HIS A 120 ? LYS A 126 ? HIS A 120 LYS A 126 E 1 ILE A 150 ? HIS A 154 ? ILE A 150 HIS A 154 E 2 SER A 140 ? SER A 147 ? SER A 140 SER A 147 E 3 TYR A 179 ? GLU A 186 ? TYR A 179 GLU A 186 E 4 LYS A 199 ? THR A 201 ? LYS A 199 THR A 201 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 15 ? N LYS A 15 O SER A 26 ? O SER A 26 A 2 3 N SER A 23 ? N SER A 23 O LEU A 68 ? O LEU A 68 B 1 2 O LYS A 48 ? O LYS A 48 N ILE A 45 ? N ILE A 45 B 2 3 N LEU A 42 ? N LEU A 42 O VAL A 82 ? O VAL A 82 B 3 4 N SER A 87 ? N SER A 87 O THR A 90 ? O THR A 90 C 1 2 O LYS A 48 ? O LYS A 48 N ILE A 45 ? N ILE A 45 C 2 3 N LEU A 42 ? N LEU A 42 O VAL A 82 ? O VAL A 82 C 3 4 N THR A 81 ? N THR A 81 O HIS A 97 ? O HIS A 97 D 1 2 N GLU A 113 ? N GLU A 113 O MET A 124 ? O MET A 124 E 1 2 O ILE A 150 ? O ILE A 150 N SER A 147 ? N SER A 147 E 2 3 N VAL A 142 ? N VAL A 142 O TYR A 184 ? O TYR A 184 E 3 4 N VAL A 181 ? N VAL A 181 O LYS A 199 ? O LYS A 199 # _database_PDB_matrix.entry_id 1N6V _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1N6V _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 TYR 2 2 2 TYR TYR A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 TRP 72 72 72 TRP TRP A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 TRP 100 100 100 TRP TRP A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 MET 124 124 124 MET MET A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 HIS 154 154 154 HIS HIS A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 MET 162 162 162 MET MET A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 ASN 176 176 176 ASN ASN A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 ASN 178 178 178 ASN ASN A . n A 1 179 TYR 179 179 179 TYR TYR A . n A 1 180 CYS 180 180 180 CYS CYS A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 TYR 184 184 184 TYR TYR A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 HIS 187 187 187 HIS HIS A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 ASP 189 189 189 ASP ASP A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 GLN 191 191 191 GLN GLN A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 PRO 197 197 197 PRO PRO A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 LYS 199 199 199 LYS LYS A . n A 1 200 CYS 200 200 200 CYS CYS A . n A 1 201 THR 201 201 201 THR THR A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 PRO 204 204 204 PRO PRO A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 GLY 206 206 206 GLY GLY A . n A 1 207 GLN 207 207 207 GLN GLN A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 SER 209 209 209 SER SER A . n A 1 210 GLU 210 210 210 GLU GLU A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 SER 212 212 212 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-07-15 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 3 ? ? 45.55 -169.25 2 1 ASP A 6 ? ? -69.85 95.65 3 1 TYR A 7 ? ? -69.89 73.55 4 1 GLU A 10 ? ? 174.19 63.83 5 1 CYS A 12 ? ? 38.40 34.60 6 1 HIS A 32 ? ? -120.31 -70.34 7 1 SER A 33 ? ? -100.75 -67.99 8 1 ASP A 51 ? ? -111.70 55.51 9 1 ASN A 57 ? ? 79.95 -9.29 10 1 ASN A 60 ? ? 13.08 75.49 11 1 LEU A 68 ? ? -171.49 88.74 12 1 TYR A 79 ? ? -59.51 88.47 13 1 SER A 94 ? ? -160.52 94.73 14 1 ALA A 102 ? ? -39.78 -33.11 15 1 MET A 105 ? ? 28.93 88.43 16 1 GLU A 108 ? ? -158.53 -59.03 17 1 PRO A 110 ? ? -33.66 153.50 18 1 ASP A 138 ? ? -156.83 34.48 19 1 GLN A 146 ? ? -110.00 68.29 20 1 LYS A 159 ? ? -69.81 67.20 21 1 MET A 162 ? ? -93.17 41.48 22 1 ASP A 171 ? ? -110.69 -165.70 23 1 PRO A 175 ? ? -38.70 156.17 24 1 ASN A 176 ? ? 64.67 67.96 25 1 SER A 188 ? ? 177.79 39.76 26 1 ALA A 192 ? ? -95.21 42.71 27 1 PRO A 197 ? ? -50.21 107.63 28 1 LEU A 198 ? ? -49.87 174.84 29 1 PRO A 204 ? ? -55.44 103.23 30 1 GLN A 207 ? ? -92.27 38.02 31 1 GLU A 208 ? ? -74.65 -159.65 32 1 SER A 209 ? ? -56.92 -166.72 #