data_1N87 # _entry.id 1N87 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1N87 pdb_00001n87 10.2210/pdb1n87/pdb RCSB RCSB017640 ? ? WWPDB D_1000017640 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1N87 _pdbx_database_status.recvd_initial_deposition_date 2002-11-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chazin, W.J.' 1 'Ohi, M.D.' 2 'Vander Kooi, C.W.' 3 # _citation.id primary _citation.title 'Structural insights into the U-box, a domain associated with multi-ubiquitination' _citation.journal_abbrev Nat.Struct.Biol. _citation.journal_volume 10 _citation.page_first 250 _citation.page_last 255 _citation.year 2003 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12627222 _citation.pdbx_database_id_DOI 10.1038/nsb906 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohi, M.D.' 1 ? primary 'Vander Kooi, C.W.' 2 ? primary 'Rosenberg, J.A.' 3 ? primary 'Chazin, W.J.' 4 ? primary 'Gould, K.L.' 5 ? # _cell.entry_id 1N87 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1N87 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Pre-mRNA splicing factor PRP19' _entity.formula_weight 6246.232 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPS _entity_poly.pdbx_seq_one_letter_code_can MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 CYS n 1 4 ALA n 1 5 ILE n 1 6 SER n 1 7 GLY n 1 8 LYS n 1 9 VAL n 1 10 PRO n 1 11 ARG n 1 12 ARG n 1 13 PRO n 1 14 VAL n 1 15 LEU n 1 16 SER n 1 17 PRO n 1 18 LYS n 1 19 SER n 1 20 ARG n 1 21 THR n 1 22 ILE n 1 23 PHE n 1 24 GLU n 1 25 LYS n 1 26 SER n 1 27 LEU n 1 28 LEU n 1 29 GLU n 1 30 GLN n 1 31 TYR n 1 32 VAL n 1 33 LYS n 1 34 ASP n 1 35 THR n 1 36 GLY n 1 37 ASN n 1 38 ASP n 1 39 PRO n 1 40 ILE n 1 41 THR n 1 42 ASN n 1 43 GLU n 1 44 PRO n 1 45 LEU n 1 46 SER n 1 47 ILE n 1 48 GLU n 1 49 GLU n 1 50 ILE n 1 51 VAL n 1 52 GLU n 1 53 ILE n 1 54 VAL n 1 55 PRO n 1 56 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene Prp19 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRP19_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPS _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P32523 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1N87 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 56 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P32523 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 56 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 56 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '2D TOCSY' 3 2 1 3D_15N-separated_NOESY 4 3 1 3D_13C-separated_NOESY 5 4 1 3D_13C-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.28 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM Prp19(1-73); UL 20mM phosphate buffer pH 7.0; 20mM NaCl' '95% H2O/5% D2O' 2 '1mM Prp19(1-73); U-15N 20mM phosphate buffer pH 7.0; 20mM NaCl' '95% H2O/5% D2O' 3 '1mM Prp19(1-73); U-15N,13C 20mM phosphate buffer pH 7.0; 20mM NaCl' '95% H2O/5% D2O' 4 '1mM Prp19(1-73); U-15N,13C 20mM phosphate buffer pH 7.0; 20mM NaCl' '99% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 800 2 ? Bruker AVANCE 600 3 ? Bruker AVANCE 500 # _pdbx_nmr_refine.entry_id 1N87 _pdbx_nmr_refine.method 'Torsion angle dynamics, Molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1N87 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1N87 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.5 'structure solution' Guentert 1 XwinNMR 2.6 collection Bruker 2 XEASY 1.3 'data analysis' Bartels 3 Amber 6.0 refinement Pearlman 4 # _exptl.entry_id 1N87 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1N87 _struct.title 'Solution structure of the U-box of Prp19' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1N87 _struct_keywords.pdbx_keywords 'LIGASE/CELL CYCLE' _struct_keywords.text 'Ubiquitin ligase, E3 ligase, U-box, LIGASE-CELL CYCLE COMPLEX' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 25 ? THR A 35 ? LYS A 25 THR A 35 1 ? 11 HELX_P HELX_P2 2 SER A 46 ? ILE A 50 ? SER A 46 ILE A 50 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 23 ? GLU A 24 ? PHE A 23 GLU A 24 A 2 PRO A 13 ? LEU A 15 ? PRO A 13 LEU A 15 A 3 VAL A 51 ? GLU A 52 ? VAL A 51 GLU A 52 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 23 ? O PHE A 23 N VAL A 14 ? N VAL A 14 A 2 3 N LEU A 15 ? N LEU A 15 O VAL A 51 ? O VAL A 51 # _database_PDB_matrix.entry_id 1N87 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1N87 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 SER 56 56 56 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-04-15 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 8 HG A SER 19 ? ? OD2 A ASP 38 ? ? 1.57 2 13 HG A SER 19 ? ? OD2 A ASP 38 ? ? 1.60 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 7 NE A ARG 11 ? ? CZ A ARG 11 ? ? NH1 A ARG 11 ? ? 123.55 120.30 3.25 0.50 N 2 9 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.37 120.30 4.07 0.50 N 3 11 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.89 120.30 3.59 0.50 N 4 17 NE A ARG 11 ? ? CZ A ARG 11 ? ? NH1 A ARG 11 ? ? 123.60 120.30 3.30 0.50 N 5 18 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.58 120.30 3.28 0.50 N 6 19 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.84 120.30 3.54 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 20 ? ? 58.62 1.14 2 1 ASN A 42 ? ? 48.71 24.75 3 1 LEU A 45 ? ? 72.19 144.59 4 1 SER A 46 ? ? -143.32 -61.50 5 2 ASN A 42 ? ? 47.42 25.17 6 2 LEU A 45 ? ? 71.79 133.92 7 2 SER A 46 ? ? -135.12 -45.03 8 3 SER A 6 ? ? -140.19 -6.62 9 3 PRO A 10 ? ? -55.73 109.99 10 3 ARG A 20 ? ? 64.30 -3.94 11 3 LEU A 45 ? ? 70.10 147.70 12 3 SER A 46 ? ? -146.38 -48.47 13 4 PRO A 17 ? ? -56.33 -8.06 14 4 ARG A 20 ? ? 55.40 13.40 15 4 PRO A 39 ? ? -56.76 -8.29 16 4 ASN A 42 ? ? 45.44 29.30 17 4 LEU A 45 ? ? 73.96 147.15 18 4 SER A 46 ? ? -145.89 -57.79 19 5 ARG A 20 ? ? 59.86 11.25 20 5 ILE A 40 ? ? -129.15 -50.16 21 5 LEU A 45 ? ? 69.25 139.87 22 5 SER A 46 ? ? -139.01 -55.12 23 6 ARG A 20 ? ? 50.37 11.60 24 6 LEU A 45 ? ? 71.80 139.10 25 6 SER A 46 ? ? -137.36 -51.58 26 7 ARG A 20 ? ? 55.61 4.50 27 7 LEU A 45 ? ? 66.33 128.27 28 7 VAL A 54 ? ? -23.56 98.57 29 8 ARG A 20 ? ? 63.60 -1.53 30 8 LEU A 45 ? ? 65.10 149.14 31 8 SER A 46 ? ? -142.86 -54.18 32 8 ILE A 53 ? ? -96.60 57.72 33 9 ARG A 20 ? ? 56.23 7.97 34 9 LEU A 45 ? ? 72.00 132.69 35 9 SER A 46 ? ? -132.95 -46.71 36 10 LEU A 45 ? ? 70.72 144.81 37 10 SER A 46 ? ? -145.09 -52.40 38 11 ARG A 20 ? ? 47.92 17.66 39 11 ASN A 42 ? ? 49.68 21.33 40 11 LEU A 45 ? ? 70.86 141.43 41 11 SER A 46 ? ? -140.99 -53.86 42 12 ILE A 40 ? ? -124.80 -52.34 43 12 ASN A 42 ? ? 49.17 22.40 44 12 LEU A 45 ? ? 65.89 132.43 45 12 SER A 46 ? ? -131.96 -48.00 46 13 PRO A 17 ? ? -52.46 -7.68 47 13 ASN A 42 ? ? 51.70 19.78 48 13 LEU A 45 ? ? 66.00 143.16 49 13 SER A 46 ? ? -136.15 -41.14 50 14 ARG A 20 ? ? 63.38 -2.00 51 14 ASN A 42 ? ? 48.44 23.50 52 14 LEU A 45 ? ? 73.72 137.71 53 14 SER A 46 ? ? -138.69 -44.91 54 15 PRO A 10 ? ? -54.85 105.16 55 15 ARG A 20 ? ? 58.32 -16.24 56 15 ASN A 42 ? ? 48.06 24.96 57 15 LEU A 45 ? ? 65.37 141.38 58 15 SER A 46 ? ? -136.29 -54.54 59 16 ARG A 20 ? ? 59.94 1.72 60 16 LEU A 45 ? ? 65.44 132.30 61 16 SER A 46 ? ? -129.63 -52.12 62 17 LYS A 18 ? ? -82.20 -70.87 63 17 ARG A 20 ? ? 56.11 5.54 64 17 ASN A 42 ? ? 49.52 23.72 65 17 LEU A 45 ? ? 67.82 144.34 66 17 SER A 46 ? ? -141.04 -49.52 67 18 LYS A 18 ? ? -92.69 -67.85 68 18 ARG A 20 ? ? 59.25 5.67 69 18 ASN A 42 ? ? 45.10 23.86 70 18 LEU A 45 ? ? 70.45 146.29 71 18 SER A 46 ? ? -143.70 -56.77 72 19 ASN A 42 ? ? 48.22 24.54 73 19 LEU A 45 ? ? 71.04 141.41 74 19 SER A 46 ? ? -140.57 -45.84 75 20 ARG A 20 ? ? 57.47 10.88 76 20 LEU A 45 ? ? 73.86 144.14 77 20 SER A 46 ? ? -147.50 -40.42 #