data_1N88 # _entry.id 1N88 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1N88 pdb_00001n88 10.2210/pdb1n88/pdb RCSB RCSB017641 ? ? WWPDB D_1000017641 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 6700 _pdbx_database_related.details 'BMRB entry for present structure.' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1N88 _pdbx_database_status.recvd_initial_deposition_date 2002-11-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohman, A.' 1 'Rak, A.' 2 'Dontsova, M.' 3 'Garber, M.B.' 4 'Hard, T.' 5 # _citation.id primary _citation.title 'NMR structure of the ribosomal protein L23 from Thermus thermophilus.' _citation.journal_abbrev J.Biomol.NMR _citation.journal_volume 26 _citation.page_first 131 _citation.page_last 137 _citation.year 2003 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12766408 _citation.pdbx_database_id_DOI 10.1023/A:1023502307069 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohman, A.' 1 ? primary 'Rak, A.' 2 ? primary 'Dontsova, M.' 3 ? primary 'Garber, M.B.' 4 ? primary 'Hard, T.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ribosomal protein L23' _entity.formula_weight 10759.808 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVVKVNTLHVRGKKKRLGRYLGKRPDRKKAI VQVAPGQKIEALEGLI ; _entity_poly.pdbx_seq_one_letter_code_can ;MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVVKVNTLHVRGKKKRLGRYLGKRPDRKKAI VQVAPGQKIEALEGLI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 THR n 1 4 ALA n 1 5 TYR n 1 6 ASP n 1 7 VAL n 1 8 ILE n 1 9 LEU n 1 10 ALA n 1 11 PRO n 1 12 VAL n 1 13 LEU n 1 14 SER n 1 15 GLU n 1 16 LYS n 1 17 ALA n 1 18 TYR n 1 19 ALA n 1 20 GLY n 1 21 PHE n 1 22 ALA n 1 23 GLU n 1 24 GLY n 1 25 LYS n 1 26 TYR n 1 27 THR n 1 28 PHE n 1 29 TRP n 1 30 VAL n 1 31 HIS n 1 32 PRO n 1 33 LYS n 1 34 ALA n 1 35 THR n 1 36 LYS n 1 37 THR n 1 38 GLU n 1 39 ILE n 1 40 LYS n 1 41 ASN n 1 42 ALA n 1 43 VAL n 1 44 GLU n 1 45 THR n 1 46 ALA n 1 47 PHE n 1 48 LYS n 1 49 VAL n 1 50 LYS n 1 51 VAL n 1 52 VAL n 1 53 LYS n 1 54 VAL n 1 55 ASN n 1 56 THR n 1 57 LEU n 1 58 HIS n 1 59 VAL n 1 60 ARG n 1 61 GLY n 1 62 LYS n 1 63 LYS n 1 64 LYS n 1 65 ARG n 1 66 LEU n 1 67 GLY n 1 68 ARG n 1 69 TYR n 1 70 LEU n 1 71 GLY n 1 72 LYS n 1 73 ARG n 1 74 PRO n 1 75 ASP n 1 76 ARG n 1 77 LYS n 1 78 LYS n 1 79 ALA n 1 80 ILE n 1 81 VAL n 1 82 GLN n 1 83 VAL n 1 84 ALA n 1 85 PRO n 1 86 GLY n 1 87 GLN n 1 88 LYS n 1 89 ILE n 1 90 GLU n 1 91 ALA n 1 92 LEU n 1 93 GLU n 1 94 GLY n 1 95 LEU n 1 96 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11c _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RL23_THETH _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVVKVNTLHVRGKKKRLGRYLGKRPDRKKAI VQVAPGQKIEALEGLI ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession Q9RA57 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1N88 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 96 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9RA57 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 96 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 96 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 'CBCANH,CBCA(CO)NH,HNCO,HNCA,HN(CO)CA,C(CO)NH,HC(CO)NH,HCCH-COSY,HCCH-TOCSY' 3 2 1 3D_15N-separated_NOESY 4 2 1 '2D 15N-HSQC,3D 15N-DIPSI-HSQC' 5 2 1 '2D 1H-DQF-COSY, 2D 1H-clean-TOCSY, 2D 1H-NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength '0.2M LiCl2' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.8mM L23 U-15N,13C; 50mM KH2PO4, pH=5.1, 200mM LiCl2' '90% H2O/10% D2O' 2 '0.8mM L23 U-15N; 50mM KH2PO4, pH=5.1, 200mM LiCl2' '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 600 2 ? Bruker AVANCE 500 3 ? Varian INOVA 800 # _pdbx_nmr_refine.entry_id 1N88 _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics, energy minimization' _pdbx_nmr_refine.details ;Distance restraints: 1660 Dihedral angle restraints: 61 ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1N88 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1N88 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 29 _pdbx_nmr_ensemble.conformer_selection_criteria 'accept.inp (XPLOR), low energy and good Ramachandran behaviour.' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1N88 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection 'Bruker Biospin' 1 XwinNMR 2.6 processing 'Bruker Biospin' 2 NMRPipe 2.1 processing 'Delaglio, F.' 3 ANSIG 1.02 'data analysis' 'Helgstrand, M.' 4 X-PLOR 3.851 refinement ? 5 AQUA 3.2 'data analysis' 'Laskowski, R.A.' 6 TALOS 1999.019.15.47 'data analysis' 'Cornilescu, G.' 7 MOLMOL 2K.1 'data analysis' 'Koradi, R.' 8 # _exptl.entry_id 1N88 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1N88 _struct.title 'NMR structure of the ribosomal protein L23 from Thermus thermophilus.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1N88 _struct_keywords.pdbx_keywords TRANSLATION _struct_keywords.text 'NMR spectroscopy, protein structure, L23, ribosome, translation' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 14 ? ALA A 22 ? SER A 14 ALA A 22 1 ? 9 HELX_P HELX_P2 2 THR A 35 ? PHE A 47 ? THR A 35 PHE A 47 1 ? 13 HELX_P HELX_P3 3 ILE A 89 ? GLY A 94 ? ILE A 89 GLY A 94 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 8 ? PRO A 11 ? ILE A 8 PRO A 11 A 2 LYS A 25 ? VAL A 30 ? LYS A 25 VAL A 30 A 3 ARG A 76 ? VAL A 83 ? ARG A 76 VAL A 83 A 4 VAL A 51 ? VAL A 59 ? VAL A 51 VAL A 59 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 9 ? N LEU A 9 O TRP A 29 ? O TRP A 29 A 2 3 N VAL A 30 ? N VAL A 30 O LYS A 77 ? O LYS A 77 A 3 4 O GLN A 82 ? O GLN A 82 N VAL A 52 ? N VAL A 52 # _database_PDB_matrix.entry_id 1N88 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1N88 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ILE 96 96 96 ILE ILE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-06-10 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 57 ? ? H A LYS 78 ? ? 1.46 2 1 O A ASN 55 ? ? H A ILE 80 ? ? 1.48 3 1 H A VAL 59 ? ? O A ARG 76 ? ? 1.49 4 1 O A SER 14 ? ? H A TYR 18 ? ? 1.49 5 1 H A ASN 55 ? ? O A ILE 80 ? ? 1.53 6 1 H A VAL 52 ? ? O A GLN 82 ? ? 1.56 7 1 O A ALA 17 ? ? H A PHE 21 ? ? 1.57 8 2 H A ASN 55 ? ? O A ILE 80 ? ? 1.47 9 2 O A ASN 55 ? ? H A ILE 80 ? ? 1.48 10 2 H A VAL 59 ? ? O A ARG 76 ? ? 1.50 11 3 O A ALA 17 ? ? H A PHE 21 ? ? 1.48 12 3 O A ASN 55 ? ? H A ILE 80 ? ? 1.49 13 3 H A ASN 55 ? ? O A ILE 80 ? ? 1.56 14 3 O A LYS 88 ? ? H A GLU 90 ? ? 1.57 15 3 H A PHE 28 ? ? O A ALA 79 ? ? 1.60 16 4 O A ALA 17 ? ? H A PHE 21 ? ? 1.47 17 4 H A ASN 55 ? ? O A ILE 80 ? ? 1.51 18 4 O A ASN 55 ? ? H A ILE 80 ? ? 1.53 19 4 H A VAL 52 ? ? O A GLN 82 ? ? 1.54 20 4 O A ALA 10 ? ? H A TRP 29 ? ? 1.59 21 5 O A ALA 17 ? ? H A PHE 21 ? ? 1.44 22 5 H A ASN 55 ? ? O A ILE 80 ? ? 1.49 23 5 H A VAL 59 ? ? O A ARG 76 ? ? 1.53 24 5 O A ASN 55 ? ? H A ILE 80 ? ? 1.53 25 5 O A ALA 17 ? ? H A GLY 20 ? ? 1.59 26 6 HG1 A THR 3 ? ? OG1 A THR 45 ? ? 1.39 27 6 H A ASN 55 ? ? O A ILE 80 ? ? 1.46 28 6 O A ASN 55 ? ? H A ILE 80 ? ? 1.48 29 6 O A GLU 23 ? ? HE22 A GLN 82 ? ? 1.49 30 6 H A VAL 30 ? ? O A LYS 77 ? ? 1.50 31 6 O A ALA 17 ? ? H A PHE 21 ? ? 1.51 32 6 O A SER 14 ? ? H A ALA 17 ? ? 1.55 33 6 H A VAL 52 ? ? O A GLN 82 ? ? 1.56 34 6 O A ALA 10 ? ? H A TRP 29 ? ? 1.59 35 7 H A VAL 52 ? ? O A GLN 82 ? ? 1.47 36 7 O A ASN 55 ? ? H A ILE 80 ? ? 1.48 37 7 H A ASN 55 ? ? O A ILE 80 ? ? 1.48 38 7 O A LYS 53 ? ? H A GLN 82 ? ? 1.52 39 8 O A ALA 17 ? ? H A PHE 21 ? ? 1.44 40 8 H A VAL 52 ? ? O A GLN 82 ? ? 1.44 41 8 H A VAL 59 ? ? O A ARG 76 ? ? 1.45 42 8 H A ASN 55 ? ? O A ILE 80 ? ? 1.46 43 8 O A LYS 63 ? ? H A LEU 66 ? ? 1.49 44 8 O A ASN 55 ? ? H A ILE 80 ? ? 1.52 45 8 O A ALA 17 ? ? H A GLY 20 ? ? 1.55 46 8 O A LYS 53 ? ? H A GLN 82 ? ? 1.60 47 9 H A ASN 55 ? ? O A ILE 80 ? ? 1.47 48 9 O A SER 14 ? ? H A ALA 17 ? ? 1.53 49 9 O A PHE 21 ? ? H A GLY 24 ? ? 1.53 50 9 O A ASN 55 ? ? H A ILE 80 ? ? 1.53 51 9 H A VAL 52 ? ? O A GLN 82 ? ? 1.53 52 9 H A VAL 59 ? ? O A ARG 76 ? ? 1.55 53 9 O A ALA 17 ? ? H A PHE 21 ? ? 1.56 54 10 H A ASN 55 ? ? O A ILE 80 ? ? 1.46 55 10 O A ALA 17 ? ? H A PHE 21 ? ? 1.48 56 10 H A VAL 52 ? ? O A GLN 82 ? ? 1.50 57 10 O A ASN 55 ? ? H A ILE 80 ? ? 1.50 58 10 O A SER 14 ? ? H A TYR 18 ? ? 1.58 59 10 O A LYS 53 ? ? H A GLN 82 ? ? 1.58 60 10 O A ASN 41 ? ? H A THR 45 ? ? 1.60 61 11 O A ALA 42 ? ? HG1 A THR 45 ? ? 1.38 62 11 H A VAL 59 ? ? O A ARG 76 ? ? 1.46 63 11 O A ALA 17 ? ? H A PHE 21 ? ? 1.47 64 11 H A VAL 52 ? ? O A GLN 82 ? ? 1.48 65 11 H A ASN 55 ? ? O A ILE 80 ? ? 1.54 66 11 O A ASN 55 ? ? H A ILE 80 ? ? 1.58 67 12 H A ASN 55 ? ? O A ILE 80 ? ? 1.44 68 12 O A LYS 53 ? ? H A GLN 82 ? ? 1.46 69 12 O A ALA 17 ? ? H A PHE 21 ? ? 1.47 70 12 O A LYS 63 ? ? H A LEU 66 ? ? 1.50 71 12 H A VAL 52 ? ? O A GLN 82 ? ? 1.52 72 12 O A ASN 55 ? ? H A ILE 80 ? ? 1.54 73 13 H A ASN 55 ? ? O A ILE 80 ? ? 1.46 74 13 O A ALA 17 ? ? H A PHE 21 ? ? 1.47 75 13 O A ASN 55 ? ? H A ILE 80 ? ? 1.51 76 13 O A SER 14 ? ? H A TYR 18 ? ? 1.54 77 13 O A LYS 53 ? ? H A GLN 82 ? ? 1.59 78 14 O A ALA 17 ? ? H A PHE 21 ? ? 1.45 79 14 H A ASN 55 ? ? O A ILE 80 ? ? 1.48 80 14 H A LEU 9 ? ? O A TRP 29 ? ? 1.51 81 14 H A VAL 30 ? ? O A LYS 77 ? ? 1.51 82 14 O A LYS 33 ? ? H A THR 35 ? ? 1.56 83 14 O A ASN 55 ? ? H A ILE 80 ? ? 1.57 84 14 O A LYS 53 ? ? H A GLN 82 ? ? 1.60 85 15 O A ALA 17 ? ? H A PHE 21 ? ? 1.45 86 15 O A ASN 55 ? ? H A ILE 80 ? ? 1.47 87 15 H A ASN 55 ? ? O A ILE 80 ? ? 1.48 88 15 O A GLU 23 ? ? HE22 A GLN 82 ? ? 1.49 89 15 O A LYS 53 ? ? H A GLN 82 ? ? 1.52 90 15 H A VAL 59 ? ? O A ARG 76 ? ? 1.54 91 15 O A LEU 66 ? ? H A ARG 68 ? ? 1.56 92 16 O A ALA 17 ? ? H A PHE 21 ? ? 1.44 93 16 O A ASN 55 ? ? H A ILE 80 ? ? 1.51 94 16 H A VAL 59 ? ? O A ARG 76 ? ? 1.51 95 16 H A VAL 52 ? ? O A GLN 82 ? ? 1.52 96 16 O A PHE 28 ? ? H A ALA 79 ? ? 1.52 97 16 O A LYS 2 ? ? H A ASP 6 ? ? 1.52 98 16 H A ASN 55 ? ? O A ILE 80 ? ? 1.55 99 16 H A PHE 28 ? ? O A ALA 79 ? ? 1.56 100 16 HH A TYR 5 ? ? O A GLU 38 ? ? 1.57 101 17 O A ALA 17 ? ? H A PHE 21 ? ? 1.44 102 17 H A ASN 55 ? ? O A ILE 80 ? ? 1.47 103 17 O A LYS 53 ? ? H A GLN 82 ? ? 1.47 104 17 H A VAL 52 ? ? O A GLN 82 ? ? 1.48 105 17 O A ASN 55 ? ? H A ILE 80 ? ? 1.52 106 17 H A VAL 59 ? ? O A ARG 76 ? ? 1.54 107 17 O A ALA 17 ? ? H A GLY 20 ? ? 1.56 108 17 OH A TYR 26 ? ? H A ILE 89 ? ? 1.57 109 18 H A VAL 52 ? ? O A GLN 82 ? ? 1.46 110 18 H A ASN 55 ? ? O A ILE 80 ? ? 1.48 111 18 H A VAL 59 ? ? O A ARG 76 ? ? 1.50 112 18 O A ASN 55 ? ? H A ILE 80 ? ? 1.55 113 19 H A ASN 55 ? ? O A ILE 80 ? ? 1.43 114 19 O A ASN 55 ? ? H A ILE 80 ? ? 1.45 115 19 O A PHE 21 ? ? H A GLY 24 ? ? 1.48 116 19 O A SER 14 ? ? H A ALA 17 ? ? 1.54 117 19 O A ALA 17 ? ? H A PHE 21 ? ? 1.55 118 19 O A LYS 53 ? ? H A GLN 82 ? ? 1.55 119 19 O A LEU 66 ? ? H A ARG 68 ? ? 1.56 120 19 H A VAL 59 ? ? O A ARG 76 ? ? 1.56 121 20 H A ASN 55 ? ? O A ILE 80 ? ? 1.47 122 20 OH A TYR 26 ? ? H A ILE 89 ? ? 1.50 123 20 O A ASN 55 ? ? H A ILE 80 ? ? 1.51 124 20 H A VAL 52 ? ? O A GLN 82 ? ? 1.54 125 20 O A PHE 28 ? ? H A ALA 79 ? ? 1.54 126 20 O A PHE 21 ? ? H A GLY 24 ? ? 1.59 127 21 O A ALA 17 ? ? H A PHE 21 ? ? 1.44 128 21 H A VAL 30 ? ? O A LYS 77 ? ? 1.46 129 21 H A VAL 52 ? ? O A GLN 82 ? ? 1.47 130 21 H A ASN 55 ? ? O A ILE 80 ? ? 1.50 131 21 O A ASN 55 ? ? H A ILE 80 ? ? 1.50 132 21 O A ALA 17 ? ? H A GLY 20 ? ? 1.56 133 22 O A LYS 53 ? ? H A GLN 82 ? ? 1.45 134 22 O A ALA 17 ? ? H A PHE 21 ? ? 1.46 135 22 O A ASN 55 ? ? H A ILE 80 ? ? 1.48 136 22 H A ASN 55 ? ? O A ILE 80 ? ? 1.50 137 22 O A LEU 66 ? ? H A ARG 68 ? ? 1.56 138 22 O A ALA 17 ? ? H A GLY 20 ? ? 1.60 139 23 O A ALA 17 ? ? H A PHE 21 ? ? 1.49 140 23 H A ASN 55 ? ? O A ILE 80 ? ? 1.49 141 23 H A VAL 59 ? ? O A ARG 76 ? ? 1.51 142 23 H A VAL 52 ? ? O A GLN 82 ? ? 1.51 143 23 O A ASN 55 ? ? H A ILE 80 ? ? 1.55 144 23 O A SER 14 ? ? H A ALA 17 ? ? 1.56 145 23 O A LEU 57 ? ? H A LYS 78 ? ? 1.58 146 23 O A LYS 53 ? ? H A GLN 82 ? ? 1.58 147 24 H A ASN 55 ? ? O A ILE 80 ? ? 1.47 148 24 O A ASN 55 ? ? H A ILE 80 ? ? 1.52 149 24 O A THR 3 ? ? H A TYR 5 ? ? 1.52 150 24 O A PHE 28 ? ? H A ALA 79 ? ? 1.53 151 24 H A VAL 52 ? ? O A GLN 82 ? ? 1.54 152 25 H A VAL 52 ? ? O A GLN 82 ? ? 1.44 153 25 O A ALA 17 ? ? H A PHE 21 ? ? 1.45 154 25 H A ASN 55 ? ? O A ILE 80 ? ? 1.46 155 25 H A VAL 30 ? ? O A LYS 77 ? ? 1.48 156 25 O A LYS 2 ? ? H A ASP 6 ? ? 1.51 157 25 O A ASN 55 ? ? H A ILE 80 ? ? 1.55 158 25 O A LEU 66 ? ? H A ARG 68 ? ? 1.57 159 26 O A VAL 59 ? ? HE A ARG 60 ? ? 1.42 160 26 H A ASN 55 ? ? O A ILE 80 ? ? 1.44 161 26 H A VAL 52 ? ? O A GLN 82 ? ? 1.49 162 26 OH A TYR 26 ? ? H A ILE 89 ? ? 1.51 163 26 O A ASN 55 ? ? H A ILE 80 ? ? 1.52 164 26 O A ALA 17 ? ? H A PHE 21 ? ? 1.54 165 26 O A LYS 53 ? ? H A GLN 82 ? ? 1.58 166 27 O A ALA 17 ? ? H A PHE 21 ? ? 1.45 167 27 O A ASN 55 ? ? H A ILE 80 ? ? 1.46 168 27 H A VAL 30 ? ? O A LYS 77 ? ? 1.47 169 27 O A LYS 2 ? ? H A ASP 6 ? ? 1.48 170 27 O A SER 14 ? ? H A TYR 18 ? ? 1.49 171 27 O A THR 3 ? ? H A TYR 5 ? ? 1.51 172 27 H A ASN 55 ? ? O A ILE 80 ? ? 1.51 173 27 H A VAL 52 ? ? O A GLN 82 ? ? 1.53 174 27 O A LYS 53 ? ? H A GLN 82 ? ? 1.55 175 27 O A LEU 66 ? ? H A ARG 68 ? ? 1.56 176 28 O A LYS 53 ? ? H A GLN 82 ? ? 1.49 177 28 O A ASN 55 ? ? H A ILE 80 ? ? 1.49 178 28 O A PHE 21 ? ? H A GLY 24 ? ? 1.50 179 28 O A TYR 26 ? ? H A VAL 81 ? ? 1.51 180 28 H A ASN 55 ? ? O A ILE 80 ? ? 1.52 181 28 O A ALA 17 ? ? H A PHE 21 ? ? 1.53 182 28 H A VAL 59 ? ? O A ARG 76 ? ? 1.55 183 28 O A SER 14 ? ? H A TYR 18 ? ? 1.59 184 29 H A VAL 59 ? ? O A ARG 76 ? ? 1.44 185 29 O A ALA 17 ? ? H A PHE 21 ? ? 1.46 186 29 H A ASN 55 ? ? O A ILE 80 ? ? 1.48 187 29 O A ASN 55 ? ? H A ILE 80 ? ? 1.54 188 29 O A LYS 88 ? ? H A GLU 90 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 3 ? ? -108.64 -104.87 2 1 TYR A 5 ? ? -52.83 -139.92 3 1 VAL A 7 ? ? -51.41 -109.11 4 1 LEU A 9 ? ? -75.42 -93.60 5 1 ALA A 22 ? ? -38.31 -38.26 6 1 LYS A 33 ? ? 179.30 -34.18 7 1 ALA A 34 ? ? -44.27 92.49 8 1 VAL A 49 ? ? -116.88 -163.94 9 1 LYS A 53 ? ? 169.68 119.11 10 1 LYS A 62 ? ? -45.14 -79.43 11 1 LYS A 64 ? ? 38.56 32.94 12 1 ARG A 65 ? ? -160.56 -49.47 13 1 LEU A 66 ? ? 53.56 104.45 14 1 ARG A 68 ? ? -51.80 -173.07 15 1 TYR A 69 ? ? -42.26 102.76 16 1 LEU A 70 ? ? -157.31 40.36 17 1 LYS A 72 ? ? 65.84 142.10 18 1 ARG A 73 ? ? -42.59 103.91 19 1 PRO A 74 ? ? -77.16 -166.48 20 1 ALA A 84 ? ? -57.34 178.79 21 1 LYS A 88 ? ? 179.68 105.55 22 2 LYS A 2 ? ? -64.76 76.71 23 2 THR A 3 ? ? -120.59 -97.41 24 2 TYR A 5 ? ? -34.04 -28.30 25 2 ASP A 6 ? ? -164.00 -51.27 26 2 LEU A 9 ? ? -79.04 -97.47 27 2 TYR A 18 ? ? -139.18 -38.62 28 2 LYS A 33 ? ? 179.73 -33.88 29 2 ALA A 34 ? ? -42.42 95.46 30 2 THR A 35 ? ? -39.39 134.27 31 2 ALA A 46 ? ? -104.23 -67.44 32 2 VAL A 49 ? ? -123.56 -158.98 33 2 LYS A 53 ? ? 169.12 119.85 34 2 LEU A 66 ? ? -41.79 100.10 35 2 TYR A 69 ? ? 50.72 113.65 36 2 LYS A 72 ? ? 56.77 111.52 37 2 ARG A 73 ? ? 44.16 77.27 38 2 PRO A 74 ? ? -77.40 -165.01 39 2 ALA A 84 ? ? -49.16 179.03 40 2 LYS A 88 ? ? 179.43 108.56 41 2 ILE A 89 ? ? -51.11 91.62 42 3 THR A 3 ? ? -108.87 -105.71 43 3 TYR A 5 ? ? -52.54 -140.46 44 3 ASP A 6 ? ? -29.87 -58.43 45 3 VAL A 7 ? ? -52.71 -109.49 46 3 LEU A 9 ? ? -92.06 -88.22 47 3 LYS A 33 ? ? 179.48 -33.65 48 3 ALA A 34 ? ? -42.36 93.61 49 3 VAL A 49 ? ? -115.29 -162.36 50 3 LYS A 53 ? ? -173.15 123.40 51 3 LYS A 63 ? ? -160.41 68.65 52 3 LYS A 64 ? ? 52.95 171.59 53 3 LEU A 70 ? ? -146.36 39.91 54 3 LYS A 72 ? ? 63.11 -176.31 55 3 PRO A 74 ? ? -77.02 -165.73 56 3 LYS A 88 ? ? 179.30 115.38 57 3 ILE A 89 ? ? -67.91 60.86 58 4 LYS A 2 ? ? -61.50 87.80 59 4 ALA A 4 ? ? 178.71 -27.24 60 4 TYR A 5 ? ? -45.97 -135.81 61 4 ASP A 6 ? ? -24.39 -58.62 62 4 ILE A 8 ? ? 24.56 51.18 63 4 LEU A 9 ? ? -44.71 -99.75 64 4 LYS A 33 ? ? 179.72 -32.19 65 4 ALA A 34 ? ? -41.09 92.82 66 4 VAL A 49 ? ? -102.87 -161.88 67 4 LYS A 53 ? ? -178.75 115.10 68 4 LYS A 63 ? ? -148.42 -90.01 69 4 LYS A 64 ? ? -42.31 -71.65 70 4 LEU A 66 ? ? 178.38 107.08 71 4 PRO A 74 ? ? -73.86 -165.28 72 4 ALA A 84 ? ? -44.19 171.87 73 4 GLN A 87 ? ? -51.04 -173.74 74 4 LYS A 88 ? ? 178.98 80.19 75 4 ILE A 89 ? ? -47.69 109.81 76 5 LYS A 2 ? ? -44.60 98.47 77 5 THR A 3 ? ? 4.45 -71.74 78 5 ALA A 4 ? ? -55.69 81.02 79 5 TYR A 5 ? ? 23.56 47.90 80 5 VAL A 7 ? ? -134.48 -126.03 81 5 LEU A 9 ? ? -132.87 -99.34 82 5 LYS A 33 ? ? 179.18 -33.85 83 5 ALA A 34 ? ? -50.30 90.63 84 5 THR A 35 ? ? -48.41 176.45 85 5 VAL A 49 ? ? -125.77 -162.00 86 5 LYS A 53 ? ? -176.15 115.08 87 5 LYS A 62 ? ? -169.48 -36.07 88 5 ARG A 65 ? ? -142.02 -46.96 89 5 LEU A 70 ? ? 40.30 94.13 90 5 LYS A 72 ? ? -113.99 79.57 91 5 PRO A 74 ? ? -73.22 -165.48 92 5 ALA A 84 ? ? -45.47 177.20 93 5 LYS A 88 ? ? 179.67 99.14 94 5 ILE A 89 ? ? -44.12 104.71 95 6 THR A 3 ? ? -133.61 -94.10 96 6 TYR A 5 ? ? -54.08 -139.45 97 6 VAL A 7 ? ? -45.64 -101.20 98 6 LEU A 9 ? ? -70.39 -98.59 99 6 PRO A 32 ? ? -65.01 72.99 100 6 LYS A 33 ? ? 179.68 -33.03 101 6 ALA A 34 ? ? -41.75 95.67 102 6 THR A 35 ? ? -38.36 128.11 103 6 VAL A 49 ? ? -122.01 -164.25 104 6 LYS A 53 ? ? 168.08 117.89 105 6 LYS A 64 ? ? 172.80 55.24 106 6 LEU A 66 ? ? 55.80 108.13 107 6 ALA A 84 ? ? -49.92 178.93 108 6 LYS A 88 ? ? 179.63 93.65 109 6 ILE A 89 ? ? -43.09 100.04 110 7 THR A 3 ? ? -104.62 -106.29 111 7 TYR A 5 ? ? -53.92 -141.03 112 7 ASP A 6 ? ? -27.80 -62.31 113 7 VAL A 7 ? ? -49.90 -103.72 114 7 LEU A 9 ? ? -54.97 -95.43 115 7 TYR A 18 ? ? -134.36 -49.67 116 7 PRO A 32 ? ? -64.20 75.90 117 7 LYS A 33 ? ? 179.47 -32.73 118 7 ALA A 34 ? ? -38.46 92.49 119 7 VAL A 49 ? ? -123.55 -164.35 120 7 LYS A 53 ? ? 178.91 141.58 121 7 LYS A 64 ? ? 50.57 74.19 122 7 ARG A 65 ? ? -136.36 -50.63 123 7 TYR A 69 ? ? -102.20 56.28 124 7 LEU A 70 ? ? -105.33 41.47 125 7 PRO A 74 ? ? -73.23 -164.80 126 7 ALA A 84 ? ? -50.09 179.26 127 7 LYS A 88 ? ? 179.51 100.18 128 7 ILE A 89 ? ? -44.28 95.83 129 8 THR A 3 ? ? -136.88 -89.45 130 8 TYR A 5 ? ? -52.15 -139.09 131 8 VAL A 7 ? ? -53.71 -103.17 132 8 LEU A 9 ? ? -72.75 -97.49 133 8 LYS A 33 ? ? 179.72 -34.54 134 8 ALA A 34 ? ? -43.75 93.10 135 8 ALA A 46 ? ? -102.66 -68.79 136 8 VAL A 49 ? ? -125.29 -162.14 137 8 LYS A 53 ? ? 168.55 120.01 138 8 LYS A 62 ? ? -139.28 -54.84 139 8 ARG A 73 ? ? -43.80 106.55 140 8 PRO A 74 ? ? -74.02 -167.39 141 8 ALA A 84 ? ? -67.65 -179.71 142 8 LYS A 88 ? ? 179.56 100.75 143 8 ILE A 89 ? ? -44.19 108.07 144 9 LYS A 2 ? ? -45.11 97.51 145 9 THR A 3 ? ? 3.86 -70.68 146 9 ALA A 4 ? ? -55.19 80.46 147 9 TYR A 5 ? ? 24.37 46.61 148 9 VAL A 7 ? ? -131.98 -125.03 149 9 LEU A 9 ? ? -111.65 -89.59 150 9 LYS A 33 ? ? 179.03 -33.81 151 9 ALA A 34 ? ? -48.43 107.50 152 9 LYS A 48 ? ? 38.23 42.57 153 9 VAL A 49 ? ? -115.39 -165.88 154 9 LYS A 53 ? ? 176.08 119.53 155 9 LYS A 62 ? ? -168.76 -49.10 156 9 LEU A 66 ? ? 61.19 135.93 157 9 ARG A 68 ? ? -42.71 166.43 158 9 LEU A 70 ? ? -162.12 41.01 159 9 PRO A 74 ? ? -73.02 -165.05 160 9 LYS A 88 ? ? 179.71 122.68 161 10 THR A 3 ? ? -120.51 -90.72 162 10 TYR A 5 ? ? -35.44 -25.78 163 10 ASP A 6 ? ? -162.16 -58.02 164 10 VAL A 7 ? ? -43.02 -73.39 165 10 ILE A 8 ? ? -110.59 67.77 166 10 LEU A 9 ? ? -54.28 -94.37 167 10 LYS A 33 ? ? 179.88 -34.90 168 10 ALA A 34 ? ? -43.98 95.44 169 10 THR A 35 ? ? -38.00 130.86 170 10 VAL A 49 ? ? -125.28 -164.88 171 10 LYS A 53 ? ? -179.18 131.66 172 10 LYS A 62 ? ? -53.62 -172.17 173 10 LYS A 64 ? ? -41.61 100.13 174 10 ARG A 65 ? ? -159.83 -57.67 175 10 LEU A 66 ? ? -41.95 96.67 176 10 PRO A 74 ? ? -77.33 -165.38 177 10 LYS A 88 ? ? 179.46 97.96 178 10 ILE A 89 ? ? -45.07 95.57 179 11 LYS A 2 ? ? -60.92 89.97 180 11 ALA A 4 ? ? 179.86 -29.00 181 11 TYR A 5 ? ? -43.31 -136.67 182 11 ASP A 6 ? ? -23.06 -62.98 183 11 VAL A 7 ? ? -57.33 -111.65 184 11 LEU A 9 ? ? -91.63 -86.01 185 11 LYS A 33 ? ? 179.57 -33.42 186 11 ALA A 34 ? ? -42.61 93.29 187 11 VAL A 49 ? ? -116.39 -162.59 188 11 LYS A 53 ? ? 168.15 117.30 189 11 LYS A 63 ? ? -43.71 166.47 190 11 LYS A 64 ? ? 174.28 89.32 191 11 ARG A 65 ? ? -153.01 -158.21 192 11 LEU A 66 ? ? 71.28 123.10 193 11 TYR A 69 ? ? -162.87 59.44 194 11 PRO A 74 ? ? -73.09 -168.55 195 11 ALA A 84 ? ? -50.85 174.11 196 11 GLN A 87 ? ? -51.27 -172.58 197 11 LYS A 88 ? ? 179.25 87.98 198 12 LYS A 2 ? ? -44.31 97.95 199 12 THR A 3 ? ? 4.29 -71.53 200 12 ALA A 4 ? ? -55.41 81.04 201 12 TYR A 5 ? ? 24.18 47.19 202 12 VAL A 7 ? ? -133.38 -124.61 203 12 LEU A 9 ? ? -143.52 -93.78 204 12 LYS A 33 ? ? 179.02 -34.34 205 12 ALA A 34 ? ? -42.74 94.47 206 12 THR A 35 ? ? -48.09 155.81 207 12 ALA A 46 ? ? -94.25 -62.05 208 12 VAL A 49 ? ? -128.28 -162.88 209 12 LYS A 53 ? ? 178.34 147.94 210 12 ARG A 68 ? ? -40.94 155.97 211 12 LEU A 70 ? ? -156.46 40.06 212 12 ARG A 73 ? ? -40.79 100.25 213 12 LYS A 88 ? ? 179.56 104.53 214 12 ILE A 89 ? ? -42.65 100.53 215 13 THR A 3 ? ? -121.12 -88.91 216 13 TYR A 5 ? ? -34.36 -26.69 217 13 ASP A 6 ? ? -160.19 -59.55 218 13 LEU A 9 ? ? -93.05 -95.71 219 13 LYS A 33 ? ? 179.87 -32.88 220 13 ALA A 34 ? ? -48.37 91.13 221 13 ALA A 46 ? ? -100.04 -67.14 222 13 VAL A 49 ? ? -122.28 -158.82 223 13 LYS A 53 ? ? 175.83 119.44 224 13 LYS A 62 ? ? -144.05 -65.64 225 13 LYS A 64 ? ? 177.64 131.24 226 13 TYR A 69 ? ? -166.25 69.33 227 13 LYS A 72 ? ? -166.07 109.52 228 13 ARG A 73 ? ? -45.33 105.38 229 13 PRO A 74 ? ? -72.60 -166.85 230 13 LYS A 88 ? ? -176.17 100.35 231 14 THR A 3 ? ? -136.26 -88.61 232 14 TYR A 5 ? ? -52.13 -138.46 233 14 ILE A 8 ? ? 11.59 86.90 234 14 LEU A 9 ? ? -68.29 -106.85 235 14 ALA A 34 ? ? -67.02 61.37 236 14 THR A 35 ? ? -38.33 148.65 237 14 ALA A 46 ? ? -90.12 -62.42 238 14 VAL A 49 ? ? -123.19 -162.70 239 14 LYS A 53 ? ? 169.25 117.86 240 14 LYS A 63 ? ? -156.11 55.14 241 14 ARG A 65 ? ? -177.84 -42.04 242 14 LEU A 66 ? ? 45.27 94.76 243 14 ARG A 68 ? ? -51.65 -169.71 244 14 TYR A 69 ? ? -38.30 108.75 245 14 LEU A 70 ? ? 34.92 41.44 246 14 PRO A 74 ? ? -73.09 -165.50 247 14 LYS A 88 ? ? 179.39 90.76 248 14 ILE A 89 ? ? -46.28 97.55 249 15 LYS A 2 ? ? -62.59 93.76 250 15 THR A 3 ? ? -137.49 -38.81 251 15 ALA A 4 ? ? -160.40 -24.50 252 15 TYR A 5 ? ? -46.85 -135.91 253 15 ASP A 6 ? ? -24.60 -63.44 254 15 VAL A 7 ? ? -56.71 -108.87 255 15 LEU A 9 ? ? -70.06 -106.02 256 15 LYS A 33 ? ? 179.77 -32.49 257 15 ALA A 34 ? ? -40.29 91.53 258 15 ALA A 46 ? ? -102.61 -69.03 259 15 VAL A 49 ? ? -113.65 -159.58 260 15 LYS A 53 ? ? 169.47 119.00 261 15 LYS A 62 ? ? -122.21 -66.94 262 15 LYS A 64 ? ? 52.86 81.39 263 15 ARG A 65 ? ? -82.65 -85.79 264 15 LEU A 66 ? ? 43.34 84.11 265 15 TYR A 69 ? ? -157.81 52.58 266 15 LYS A 72 ? ? 40.06 -165.59 267 15 PRO A 74 ? ? -73.37 -169.21 268 15 LYS A 88 ? ? 178.80 110.89 269 15 ILE A 89 ? ? -63.44 77.43 270 16 THR A 3 ? ? -32.52 -36.10 271 16 ALA A 4 ? ? -63.17 68.67 272 16 TYR A 5 ? ? 30.28 37.13 273 16 VAL A 7 ? ? -129.12 -128.02 274 16 LEU A 9 ? ? -143.01 -92.75 275 16 LYS A 33 ? ? 178.94 -33.19 276 16 ALA A 34 ? ? -53.39 108.44 277 16 THR A 35 ? ? -60.00 -170.64 278 16 VAL A 49 ? ? -112.39 -166.05 279 16 LYS A 53 ? ? 175.87 135.97 280 16 LYS A 62 ? ? -168.82 -53.71 281 16 ARG A 65 ? ? -125.93 -161.22 282 16 TYR A 69 ? ? -164.91 66.47 283 16 LYS A 72 ? ? 67.36 152.61 284 16 ARG A 73 ? ? -50.99 109.23 285 16 PRO A 74 ? ? -73.63 -166.64 286 16 ALA A 84 ? ? -43.83 173.23 287 16 GLN A 87 ? ? -50.86 179.65 288 16 LYS A 88 ? ? 179.53 96.72 289 16 ILE A 89 ? ? -64.54 77.01 290 17 LYS A 2 ? ? -43.85 98.79 291 17 THR A 3 ? ? 4.79 -71.52 292 17 ALA A 4 ? ? -56.95 79.08 293 17 TYR A 5 ? ? 25.09 49.14 294 17 VAL A 7 ? ? -137.58 -121.50 295 17 LEU A 9 ? ? -133.69 -99.74 296 17 LYS A 33 ? ? 179.22 -33.03 297 17 ALA A 34 ? ? -41.71 101.14 298 17 VAL A 49 ? ? -118.14 -164.03 299 17 LYS A 53 ? ? 179.42 143.44 300 17 LYS A 64 ? ? -41.28 96.47 301 17 ARG A 65 ? ? -107.02 -66.05 302 17 LEU A 66 ? ? 49.63 -178.15 303 17 ARG A 68 ? ? -147.48 18.97 304 17 LEU A 70 ? ? -165.65 103.05 305 17 LYS A 72 ? ? -43.75 161.03 306 17 ARG A 73 ? ? -42.48 102.05 307 17 PRO A 74 ? ? -73.09 -165.71 308 17 ALA A 84 ? ? -52.84 177.87 309 17 LYS A 88 ? ? 179.71 129.85 310 18 LYS A 2 ? ? -58.10 92.72 311 18 THR A 3 ? ? -136.97 -34.89 312 18 ALA A 4 ? ? -170.41 -26.83 313 18 TYR A 5 ? ? -47.39 -134.55 314 18 ASP A 6 ? ? -24.04 -65.13 315 18 VAL A 7 ? ? -53.91 -110.22 316 18 LEU A 9 ? ? -52.27 -94.67 317 18 LYS A 33 ? ? 179.35 -32.00 318 18 ALA A 34 ? ? -47.40 90.76 319 18 VAL A 49 ? ? -118.21 -161.46 320 18 LYS A 53 ? ? -176.35 117.65 321 18 LYS A 62 ? ? -96.57 -65.19 322 18 LYS A 64 ? ? 54.53 108.22 323 18 ARG A 65 ? ? -56.13 -160.16 324 18 LEU A 66 ? ? 54.91 106.65 325 18 ARG A 68 ? ? -61.62 -175.36 326 18 TYR A 69 ? ? 27.89 70.18 327 18 LEU A 70 ? ? 36.46 94.69 328 18 ARG A 73 ? ? -166.55 79.67 329 18 PRO A 74 ? ? -76.41 -167.00 330 18 ALA A 84 ? ? -45.17 175.81 331 18 LYS A 88 ? ? 179.63 102.29 332 18 ILE A 89 ? ? -42.18 98.20 333 19 LYS A 2 ? ? -43.67 98.25 334 19 THR A 3 ? ? 4.51 -71.56 335 19 ALA A 4 ? ? -55.58 81.44 336 19 TYR A 5 ? ? 23.52 47.54 337 19 VAL A 7 ? ? -133.42 -129.52 338 19 ILE A 8 ? ? -49.94 155.00 339 19 LEU A 9 ? ? -139.93 -96.73 340 19 SER A 14 ? ? -170.67 143.88 341 19 LYS A 33 ? ? 179.26 -33.71 342 19 ALA A 34 ? ? -42.11 98.52 343 19 LYS A 48 ? ? 71.26 50.85 344 19 LYS A 62 ? ? -99.67 -61.64 345 19 LYS A 64 ? ? 56.86 76.61 346 19 ARG A 65 ? ? -105.02 -81.45 347 19 LEU A 66 ? ? 43.65 72.30 348 19 TYR A 69 ? ? -168.56 58.32 349 19 ARG A 73 ? ? -158.10 79.46 350 19 PRO A 74 ? ? -77.89 -165.94 351 19 LYS A 88 ? ? -179.86 104.11 352 19 ILE A 89 ? ? -54.35 86.49 353 20 LYS A 2 ? ? -43.91 98.35 354 20 THR A 3 ? ? 4.56 -72.07 355 20 ALA A 4 ? ? -55.51 81.96 356 20 TYR A 5 ? ? 22.81 48.18 357 20 VAL A 7 ? ? -131.42 -125.83 358 20 ILE A 8 ? ? -49.74 99.54 359 20 LEU A 9 ? ? -57.88 -106.33 360 20 TYR A 18 ? ? -125.51 -63.24 361 20 VAL A 49 ? ? -122.55 -164.61 362 20 LYS A 53 ? ? 167.77 119.05 363 20 LYS A 62 ? ? -155.33 29.01 364 20 LYS A 64 ? ? 168.31 115.76 365 20 ARG A 65 ? ? -145.75 51.74 366 20 ARG A 68 ? ? -154.22 22.95 367 20 TYR A 69 ? ? -166.54 55.99 368 20 LEU A 70 ? ? 41.21 94.80 369 20 ARG A 73 ? ? -110.14 78.90 370 20 PRO A 74 ? ? -76.16 -165.01 371 20 ALA A 84 ? ? -55.83 179.48 372 20 LYS A 88 ? ? 179.65 122.73 373 21 LYS A 2 ? ? -47.56 100.11 374 21 THR A 3 ? ? 3.01 -68.70 375 21 ALA A 4 ? ? -56.70 73.94 376 21 TYR A 5 ? ? 31.08 35.45 377 21 ASP A 6 ? ? 85.24 39.75 378 21 VAL A 7 ? ? -134.78 -137.65 379 21 ILE A 8 ? ? -32.83 126.05 380 21 LEU A 9 ? ? -115.03 -94.54 381 21 LYS A 33 ? ? 178.67 -34.71 382 21 ALA A 34 ? ? -52.80 92.05 383 21 THR A 35 ? ? -41.98 151.02 384 21 VAL A 49 ? ? -118.13 -163.28 385 21 LYS A 53 ? ? 175.39 116.80 386 21 ARG A 60 ? ? -32.69 125.16 387 21 LYS A 64 ? ? -41.75 99.12 388 21 LYS A 72 ? ? 56.57 72.23 389 21 PRO A 74 ? ? -74.23 -164.66 390 21 ALA A 84 ? ? -47.97 173.07 391 21 LYS A 88 ? ? 179.61 115.14 392 21 ILE A 89 ? ? -44.20 94.76 393 22 THR A 3 ? ? -119.79 -87.58 394 22 TYR A 5 ? ? -34.70 -25.54 395 22 ASP A 6 ? ? -161.84 -58.76 396 22 VAL A 7 ? ? -38.81 -97.25 397 22 LEU A 9 ? ? -86.89 -94.44 398 22 LYS A 33 ? ? 179.37 -33.30 399 22 ALA A 34 ? ? -41.31 93.55 400 22 VAL A 49 ? ? -123.83 -160.22 401 22 LYS A 53 ? ? 179.96 142.78 402 22 ARG A 65 ? ? -144.74 -41.06 403 22 LEU A 66 ? ? 46.83 96.46 404 22 LEU A 70 ? ? -84.92 45.42 405 22 PRO A 74 ? ? -74.96 -163.09 406 22 LYS A 88 ? ? 179.50 101.82 407 22 ILE A 89 ? ? -53.94 101.38 408 23 LYS A 2 ? ? -59.57 87.49 409 23 THR A 3 ? ? -129.61 -56.68 410 23 TYR A 5 ? ? -56.21 -137.89 411 23 ASP A 6 ? ? -27.57 -59.78 412 23 VAL A 7 ? ? -54.40 -111.76 413 23 LEU A 9 ? ? -83.97 -105.32 414 23 LYS A 33 ? ? 179.54 -32.44 415 23 ALA A 34 ? ? -44.75 92.59 416 23 ALA A 46 ? ? -97.30 -71.71 417 23 VAL A 49 ? ? -118.65 -160.36 418 23 LYS A 53 ? ? -175.39 131.24 419 23 LYS A 63 ? ? -69.68 62.33 420 23 LYS A 64 ? ? -44.20 169.99 421 23 LEU A 66 ? ? 55.50 108.52 422 23 LYS A 72 ? ? 170.10 -173.15 423 23 PRO A 74 ? ? -72.42 -165.98 424 23 LYS A 88 ? ? 179.88 113.25 425 23 ILE A 89 ? ? -59.92 100.99 426 24 THR A 3 ? ? -35.98 -33.46 427 24 ALA A 4 ? ? -60.69 65.67 428 24 TYR A 5 ? ? 30.68 46.38 429 24 VAL A 7 ? ? -128.07 -117.79 430 24 LEU A 9 ? ? -144.61 -81.72 431 24 TYR A 18 ? ? -138.49 -41.92 432 24 LYS A 33 ? ? 178.83 -32.42 433 24 ALA A 34 ? ? -56.27 96.34 434 24 THR A 35 ? ? -46.17 159.66 435 24 VAL A 49 ? ? -120.99 -165.02 436 24 LYS A 53 ? ? 170.45 125.97 437 24 LYS A 64 ? ? 67.14 79.67 438 24 ARG A 65 ? ? -144.89 -36.44 439 24 LEU A 66 ? ? -38.90 144.22 440 24 ARG A 68 ? ? -48.26 178.73 441 24 LEU A 70 ? ? -158.43 40.81 442 24 ARG A 73 ? ? -152.09 81.92 443 24 PRO A 74 ? ? -74.35 -164.59 444 24 ALA A 84 ? ? -47.76 178.34 445 24 LYS A 88 ? ? 178.42 102.22 446 24 ILE A 89 ? ? -55.99 87.66 447 25 THR A 3 ? ? -30.13 -37.73 448 25 ALA A 4 ? ? -63.78 68.16 449 25 TYR A 5 ? ? 29.61 38.06 450 25 VAL A 7 ? ? -127.96 -120.55 451 25 LEU A 9 ? ? -119.02 -100.36 452 25 LYS A 33 ? ? 179.08 -34.05 453 25 ALA A 34 ? ? -47.65 95.44 454 25 THR A 35 ? ? -43.34 167.21 455 25 LYS A 53 ? ? -176.67 131.56 456 25 LYS A 62 ? ? -42.59 165.40 457 25 LYS A 63 ? ? -77.18 -142.58 458 25 LYS A 64 ? ? 51.33 87.04 459 25 LEU A 66 ? ? -42.00 93.85 460 25 TYR A 69 ? ? -155.66 53.17 461 25 LYS A 72 ? ? 63.13 70.95 462 25 PRO A 74 ? ? -73.73 -167.24 463 25 ALA A 84 ? ? -56.19 -179.60 464 25 LYS A 88 ? ? 179.45 115.49 465 26 LYS A 2 ? ? -44.86 98.61 466 26 THR A 3 ? ? 4.37 -70.93 467 26 ALA A 4 ? ? -56.76 79.04 468 26 TYR A 5 ? ? 25.38 48.32 469 26 VAL A 7 ? ? -137.45 -110.30 470 26 LEU A 9 ? ? -140.71 -99.17 471 26 LYS A 33 ? ? -38.46 -26.00 472 26 ALA A 34 ? ? -62.95 90.91 473 26 THR A 35 ? ? -49.49 162.66 474 26 VAL A 49 ? ? -117.88 -162.31 475 26 LYS A 53 ? ? 179.97 146.87 476 26 ARG A 60 ? ? 66.18 -166.05 477 26 LYS A 62 ? ? -120.03 -58.87 478 26 LEU A 66 ? ? 63.61 -167.57 479 26 LEU A 70 ? ? -85.93 43.99 480 26 PRO A 74 ? ? -73.14 -164.21 481 26 LYS A 88 ? ? 178.99 130.87 482 27 THR A 3 ? ? -37.33 -32.67 483 27 ALA A 4 ? ? -63.01 64.31 484 27 TYR A 5 ? ? 32.96 36.16 485 27 VAL A 7 ? ? -128.57 -113.65 486 27 LEU A 9 ? ? -152.13 -93.23 487 27 LYS A 33 ? ? 178.47 -34.27 488 27 ALA A 34 ? ? -54.36 97.03 489 27 VAL A 49 ? ? -119.32 -164.02 490 27 LYS A 53 ? ? 176.75 129.76 491 27 ARG A 60 ? ? -37.68 105.31 492 27 LYS A 62 ? ? -118.94 -162.44 493 27 LYS A 63 ? ? -72.74 -160.84 494 27 LYS A 64 ? ? 61.08 62.62 495 27 ARG A 68 ? ? -140.14 23.65 496 27 TYR A 69 ? ? -161.69 52.30 497 27 LYS A 72 ? ? 179.33 58.77 498 27 LYS A 88 ? ? 179.55 115.04 499 28 LYS A 2 ? ? -99.43 34.07 500 28 THR A 3 ? ? -35.51 -34.51 501 28 ALA A 4 ? ? -54.11 74.84 502 28 TYR A 5 ? ? 34.52 35.73 503 28 ASP A 6 ? ? 62.35 62.91 504 28 VAL A 7 ? ? -132.17 -79.57 505 28 LEU A 9 ? ? -62.51 -107.66 506 28 LYS A 33 ? ? 179.35 -32.38 507 28 ALA A 34 ? ? -49.54 101.06 508 28 ARG A 65 ? ? -158.69 20.17 509 28 LEU A 66 ? ? -58.87 78.33 510 28 TYR A 69 ? ? 19.62 77.22 511 28 LEU A 70 ? ? -140.42 40.39 512 28 PRO A 74 ? ? -73.58 -164.55 513 28 LYS A 88 ? ? -170.73 125.54 514 28 ILE A 89 ? ? -68.43 98.55 515 29 LYS A 2 ? ? -43.45 98.97 516 29 THR A 3 ? ? 4.52 -70.97 517 29 ALA A 4 ? ? -55.72 80.02 518 29 TYR A 5 ? ? 24.62 45.59 519 29 VAL A 7 ? ? -135.96 -73.88 520 29 LEU A 9 ? ? -96.41 -107.19 521 29 LYS A 33 ? ? 179.24 -33.75 522 29 ALA A 34 ? ? -41.75 98.41 523 29 LYS A 53 ? ? 171.88 120.34 524 29 ARG A 60 ? ? -173.53 146.28 525 29 LYS A 63 ? ? -46.87 -73.77 526 29 ARG A 65 ? ? -138.98 -59.49 527 29 LEU A 66 ? ? 42.70 91.55 528 29 LEU A 70 ? ? -86.81 44.08 529 29 LYS A 72 ? ? 59.22 -176.27 530 29 PRO A 74 ? ? -70.80 -169.18 531 29 LYS A 88 ? ? 178.68 115.72 532 29 ILE A 89 ? ? -68.26 63.52 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 60 ? ? 0.314 'SIDE CHAIN' 2 1 ARG A 65 ? ? 0.236 'SIDE CHAIN' 3 1 ARG A 68 ? ? 0.204 'SIDE CHAIN' 4 1 ARG A 76 ? ? 0.311 'SIDE CHAIN' 5 2 ARG A 60 ? ? 0.317 'SIDE CHAIN' 6 2 ARG A 65 ? ? 0.295 'SIDE CHAIN' 7 2 ARG A 68 ? ? 0.215 'SIDE CHAIN' 8 2 ARG A 73 ? ? 0.315 'SIDE CHAIN' 9 2 ARG A 76 ? ? 0.244 'SIDE CHAIN' 10 3 ARG A 60 ? ? 0.314 'SIDE CHAIN' 11 3 ARG A 65 ? ? 0.184 'SIDE CHAIN' 12 3 ARG A 68 ? ? 0.253 'SIDE CHAIN' 13 3 ARG A 73 ? ? 0.283 'SIDE CHAIN' 14 3 ARG A 76 ? ? 0.154 'SIDE CHAIN' 15 4 ARG A 60 ? ? 0.184 'SIDE CHAIN' 16 4 ARG A 65 ? ? 0.258 'SIDE CHAIN' 17 4 ARG A 68 ? ? 0.092 'SIDE CHAIN' 18 4 ARG A 73 ? ? 0.289 'SIDE CHAIN' 19 4 ARG A 76 ? ? 0.317 'SIDE CHAIN' 20 5 ARG A 60 ? ? 0.210 'SIDE CHAIN' 21 5 ARG A 65 ? ? 0.231 'SIDE CHAIN' 22 5 ARG A 68 ? ? 0.274 'SIDE CHAIN' 23 5 ARG A 73 ? ? 0.084 'SIDE CHAIN' 24 5 ARG A 76 ? ? 0.261 'SIDE CHAIN' 25 6 ARG A 60 ? ? 0.287 'SIDE CHAIN' 26 6 ARG A 65 ? ? 0.198 'SIDE CHAIN' 27 6 ARG A 68 ? ? 0.159 'SIDE CHAIN' 28 6 ARG A 73 ? ? 0.316 'SIDE CHAIN' 29 6 ARG A 76 ? ? 0.284 'SIDE CHAIN' 30 7 ARG A 60 ? ? 0.224 'SIDE CHAIN' 31 7 ARG A 65 ? ? 0.257 'SIDE CHAIN' 32 7 ARG A 68 ? ? 0.282 'SIDE CHAIN' 33 7 ARG A 73 ? ? 0.202 'SIDE CHAIN' 34 7 ARG A 76 ? ? 0.280 'SIDE CHAIN' 35 8 ARG A 60 ? ? 0.231 'SIDE CHAIN' 36 8 ARG A 65 ? ? 0.260 'SIDE CHAIN' 37 8 ARG A 68 ? ? 0.299 'SIDE CHAIN' 38 8 ARG A 73 ? ? 0.315 'SIDE CHAIN' 39 8 ARG A 76 ? ? 0.289 'SIDE CHAIN' 40 9 ARG A 60 ? ? 0.165 'SIDE CHAIN' 41 9 ARG A 65 ? ? 0.318 'SIDE CHAIN' 42 9 ARG A 68 ? ? 0.097 'SIDE CHAIN' 43 9 ARG A 73 ? ? 0.307 'SIDE CHAIN' 44 9 ARG A 76 ? ? 0.290 'SIDE CHAIN' 45 10 ARG A 60 ? ? 0.242 'SIDE CHAIN' 46 10 ARG A 65 ? ? 0.225 'SIDE CHAIN' 47 10 ARG A 68 ? ? 0.167 'SIDE CHAIN' 48 10 ARG A 73 ? ? 0.305 'SIDE CHAIN' 49 10 ARG A 76 ? ? 0.243 'SIDE CHAIN' 50 11 ARG A 60 ? ? 0.280 'SIDE CHAIN' 51 11 ARG A 65 ? ? 0.298 'SIDE CHAIN' 52 11 ARG A 68 ? ? 0.316 'SIDE CHAIN' 53 11 ARG A 73 ? ? 0.082 'SIDE CHAIN' 54 11 ARG A 76 ? ? 0.315 'SIDE CHAIN' 55 12 ARG A 60 ? ? 0.200 'SIDE CHAIN' 56 12 ARG A 65 ? ? 0.317 'SIDE CHAIN' 57 12 ARG A 68 ? ? 0.318 'SIDE CHAIN' 58 12 ARG A 76 ? ? 0.296 'SIDE CHAIN' 59 13 ARG A 60 ? ? 0.204 'SIDE CHAIN' 60 13 ARG A 65 ? ? 0.317 'SIDE CHAIN' 61 13 ARG A 68 ? ? 0.208 'SIDE CHAIN' 62 13 ARG A 73 ? ? 0.180 'SIDE CHAIN' 63 13 ARG A 76 ? ? 0.182 'SIDE CHAIN' 64 14 ARG A 60 ? ? 0.302 'SIDE CHAIN' 65 14 ARG A 65 ? ? 0.303 'SIDE CHAIN' 66 14 ARG A 68 ? ? 0.316 'SIDE CHAIN' 67 14 ARG A 73 ? ? 0.132 'SIDE CHAIN' 68 14 ARG A 76 ? ? 0.254 'SIDE CHAIN' 69 15 ARG A 60 ? ? 0.317 'SIDE CHAIN' 70 15 ARG A 65 ? ? 0.309 'SIDE CHAIN' 71 15 ARG A 68 ? ? 0.296 'SIDE CHAIN' 72 15 ARG A 73 ? ? 0.299 'SIDE CHAIN' 73 15 ARG A 76 ? ? 0.267 'SIDE CHAIN' 74 16 ARG A 60 ? ? 0.109 'SIDE CHAIN' 75 16 ARG A 65 ? ? 0.226 'SIDE CHAIN' 76 16 ARG A 68 ? ? 0.309 'SIDE CHAIN' 77 16 ARG A 73 ? ? 0.275 'SIDE CHAIN' 78 16 ARG A 76 ? ? 0.308 'SIDE CHAIN' 79 17 ARG A 60 ? ? 0.155 'SIDE CHAIN' 80 17 ARG A 65 ? ? 0.293 'SIDE CHAIN' 81 17 ARG A 68 ? ? 0.211 'SIDE CHAIN' 82 17 ARG A 73 ? ? 0.174 'SIDE CHAIN' 83 17 ARG A 76 ? ? 0.257 'SIDE CHAIN' 84 18 ARG A 60 ? ? 0.297 'SIDE CHAIN' 85 18 ARG A 65 ? ? 0.128 'SIDE CHAIN' 86 18 ARG A 68 ? ? 0.306 'SIDE CHAIN' 87 18 ARG A 73 ? ? 0.238 'SIDE CHAIN' 88 18 ARG A 76 ? ? 0.231 'SIDE CHAIN' 89 19 ARG A 60 ? ? 0.317 'SIDE CHAIN' 90 19 ARG A 65 ? ? 0.311 'SIDE CHAIN' 91 19 ARG A 68 ? ? 0.142 'SIDE CHAIN' 92 19 ARG A 73 ? ? 0.272 'SIDE CHAIN' 93 19 ARG A 76 ? ? 0.176 'SIDE CHAIN' 94 20 ARG A 60 ? ? 0.160 'SIDE CHAIN' 95 20 ARG A 65 ? ? 0.318 'SIDE CHAIN' 96 20 ARG A 73 ? ? 0.190 'SIDE CHAIN' 97 20 ARG A 76 ? ? 0.209 'SIDE CHAIN' 98 21 ARG A 60 ? ? 0.293 'SIDE CHAIN' 99 21 ARG A 65 ? ? 0.199 'SIDE CHAIN' 100 21 ARG A 68 ? ? 0.288 'SIDE CHAIN' 101 21 ARG A 73 ? ? 0.316 'SIDE CHAIN' 102 21 ARG A 76 ? ? 0.262 'SIDE CHAIN' 103 22 ARG A 60 ? ? 0.168 'SIDE CHAIN' 104 22 ARG A 65 ? ? 0.150 'SIDE CHAIN' 105 22 ARG A 68 ? ? 0.202 'SIDE CHAIN' 106 22 ARG A 73 ? ? 0.291 'SIDE CHAIN' 107 22 ARG A 76 ? ? 0.285 'SIDE CHAIN' 108 23 ARG A 60 ? ? 0.278 'SIDE CHAIN' 109 23 ARG A 65 ? ? 0.304 'SIDE CHAIN' 110 23 ARG A 68 ? ? 0.264 'SIDE CHAIN' 111 23 ARG A 73 ? ? 0.308 'SIDE CHAIN' 112 23 ARG A 76 ? ? 0.311 'SIDE CHAIN' 113 24 ARG A 60 ? ? 0.196 'SIDE CHAIN' 114 24 ARG A 65 ? ? 0.229 'SIDE CHAIN' 115 24 ARG A 68 ? ? 0.222 'SIDE CHAIN' 116 24 ARG A 73 ? ? 0.225 'SIDE CHAIN' 117 24 ARG A 76 ? ? 0.256 'SIDE CHAIN' 118 25 ARG A 60 ? ? 0.305 'SIDE CHAIN' 119 25 ARG A 65 ? ? 0.294 'SIDE CHAIN' 120 25 ARG A 68 ? ? 0.317 'SIDE CHAIN' 121 25 ARG A 73 ? ? 0.198 'SIDE CHAIN' 122 25 ARG A 76 ? ? 0.313 'SIDE CHAIN' 123 26 ARG A 60 ? ? 0.244 'SIDE CHAIN' 124 26 ARG A 65 ? ? 0.242 'SIDE CHAIN' 125 26 ARG A 68 ? ? 0.308 'SIDE CHAIN' 126 26 ARG A 73 ? ? 0.167 'SIDE CHAIN' 127 26 ARG A 76 ? ? 0.295 'SIDE CHAIN' 128 27 ARG A 60 ? ? 0.209 'SIDE CHAIN' 129 27 ARG A 65 ? ? 0.234 'SIDE CHAIN' 130 27 ARG A 68 ? ? 0.282 'SIDE CHAIN' 131 27 ARG A 76 ? ? 0.304 'SIDE CHAIN' 132 28 ARG A 60 ? ? 0.279 'SIDE CHAIN' 133 28 ARG A 65 ? ? 0.164 'SIDE CHAIN' 134 28 ARG A 68 ? ? 0.316 'SIDE CHAIN' 135 28 ARG A 73 ? ? 0.196 'SIDE CHAIN' 136 28 ARG A 76 ? ? 0.315 'SIDE CHAIN' 137 29 ARG A 65 ? ? 0.116 'SIDE CHAIN' 138 29 ARG A 68 ? ? 0.267 'SIDE CHAIN' 139 29 ARG A 73 ? ? 0.264 'SIDE CHAIN' 140 29 ARG A 76 ? ? 0.085 'SIDE CHAIN' #