data_1N8L # _entry.id 1N8L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1N8L RCSB RCSB017654 WWPDB D_1000017654 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2007-10-30 _pdbx_database_PDB_obs_spr.pdb_id 2PNG _pdbx_database_PDB_obs_spr.replace_pdb_id 1N8L _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.entry_id 1N8L _pdbx_database_status.recvd_initial_deposition_date 2002-11-21 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Reed, M.A.C.' 1 'Schweizer, M.' 2 'Szafranska, A.E.' 3 'Arthur, C.' 4 'Nicholson, T.P.' 5 'Cox, R.J.' 6 'Crosby, J.' 7 'Crump, M.P.' 8 'Simpson, T.J.' 9 # _citation.id primary _citation.title 'The type I rat fatty acid synthase ACP shows structural homology and analogous biochemical properties to type II ACPs.' _citation.journal_abbrev Org.Biomol.Chem. _citation.journal_volume 1 _citation.page_first 463 _citation.page_last 471 _citation.year 2003 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1477-0520 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12926246 _citation.pdbx_database_id_DOI 10.1039/b208941f # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Reed, M.A.' 1 primary 'Schweizer, M.' 2 primary 'Szafranska, A.E.' 3 primary 'Arthur, C.' 4 primary 'Nicholson, T.P.' 5 primary 'Cox, R.J.' 6 primary 'Crosby, J.' 7 primary 'Crump, M.P.' 8 primary 'Simpson, T.J.' 9 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Fatty acid synthase' _entity.formula_weight 9700.080 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.3.1.85 _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 2114-2202, Acyl Carrier Protein' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GDGEAQRDLVKAVAHILGIRDLAGINLDSSLADLGLDSLMGVEVRQILEREHDLVLPIREVRQLTLRKLQEMSSKAGSDT ELAAPKSKN ; _entity_poly.pdbx_seq_one_letter_code_can ;GDGEAQRDLVKAVAHILGIRDLAGINLDSSLADLGLDSLMGVEVRQILEREHDLVLPIREVRQLTLRKLQEMSSKAGSDT ELAAPKSKN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASP n 1 3 GLY n 1 4 GLU n 1 5 ALA n 1 6 GLN n 1 7 ARG n 1 8 ASP n 1 9 LEU n 1 10 VAL n 1 11 LYS n 1 12 ALA n 1 13 VAL n 1 14 ALA n 1 15 HIS n 1 16 ILE n 1 17 LEU n 1 18 GLY n 1 19 ILE n 1 20 ARG n 1 21 ASP n 1 22 LEU n 1 23 ALA n 1 24 GLY n 1 25 ILE n 1 26 ASN n 1 27 LEU n 1 28 ASP n 1 29 SER n 1 30 SER n 1 31 LEU n 1 32 ALA n 1 33 ASP n 1 34 LEU n 1 35 GLY n 1 36 LEU n 1 37 ASP n 1 38 SER n 1 39 LEU n 1 40 MET n 1 41 GLY n 1 42 VAL n 1 43 GLU n 1 44 VAL n 1 45 ARG n 1 46 GLN n 1 47 ILE n 1 48 LEU n 1 49 GLU n 1 50 ARG n 1 51 GLU n 1 52 HIS n 1 53 ASP n 1 54 LEU n 1 55 VAL n 1 56 LEU n 1 57 PRO n 1 58 ILE n 1 59 ARG n 1 60 GLU n 1 61 VAL n 1 62 ARG n 1 63 GLN n 1 64 LEU n 1 65 THR n 1 66 LEU n 1 67 ARG n 1 68 LYS n 1 69 LEU n 1 70 GLN n 1 71 GLU n 1 72 MET n 1 73 SER n 1 74 SER n 1 75 LYS n 1 76 ALA n 1 77 GLY n 1 78 SER n 1 79 ASP n 1 80 THR n 1 81 GLU n 1 82 LEU n 1 83 ALA n 1 84 ALA n 1 85 PRO n 1 86 LYS n 1 87 SER n 1 88 LYS n 1 89 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name bacteria _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FAS_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GDGEAQRDLVKAVAHILGIRDLAGINLDSSLADLGLDSLMGVEVRQILEREHDLVLPIREVRQLTLRKLQEMSSKAGSDT ELAAPKSKN ; _struct_ref.pdbx_align_begin 2114 _struct_ref.pdbx_db_accession P12785 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1N8L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P12785 _struct_ref_seq.db_align_beg 2114 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 2202 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 89 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_15N-separated_TOCSY 3 1 1 HNHA 4 1 1 '2D NOESY' 5 1 1 '2D TOCSY' 6 1 2 '2D NOESY' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units 1 298 '1 atm' 5.5 '20mM Sodium Acetate' ? 2 303 '1 atm' 5.5 '20mM Sodium Acetate' ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1-2mM ACP, 20mM Sodium Deuteroacetate, 1mM NaN3, 1mM DTT, pH 5.5' _pdbx_nmr_sample_details.solvent_system H2O/D2O # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 600 2 ? Varian UNITYPLUS 600 # _pdbx_nmr_refine.entry_id 1N8L _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The structure is based on 684 NOE restraints and 21 dihedral angle restraints. The residues 77 to 89 were not included in the refinement. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1N8L _pdbx_nmr_details.text 'This structure was determined using 15N labelled protein. Refined coordinates from 13C/15N analysis will soon replace this model' # _pdbx_nmr_ensemble.entry_id 1N8L _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1N8L _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe SGI processing 'Frank Delaglio' 1 X-PLOR 3.81 refinement 'Axel T Brunger' 2 # _exptl.entry_id 1N8L _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1N8L _struct.title 'The NMR solution structure of the Type I rat fatty acid synthase ACP domain.' _struct.pdbx_descriptor 'Fatty acid synthase (E.C.2.3.1.85)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1N8L _struct_keywords.pdbx_keywords 'Transferase/lipid binding protein' _struct_keywords.text '4 helix bundle, Fatty acid biosynthesis, Multifunctional enzyme, Transferase-lipid binding protein complex' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 8 ? VAL A 13 ? ASP A 8 VAL A 13 1 ? 6 HELX_P HELX_P2 2 VAL A 42 ? GLU A 51 ? VAL A 42 GLU A 51 1 ? 10 HELX_P HELX_P3 3 PRO A 57 ? GLN A 63 ? PRO A 57 GLN A 63 1 ? 7 HELX_P HELX_P4 4 LEU A 66 ? MET A 72 ? LEU A 66 MET A 72 5 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1N8L _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1N8L _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLY 77 77 ? ? ? A . n A 1 78 SER 78 78 ? ? ? A . n A 1 79 ASP 79 79 ? ? ? A . n A 1 80 THR 80 80 ? ? ? A . n A 1 81 GLU 81 81 ? ? ? A . n A 1 82 LEU 82 82 ? ? ? A . n A 1 83 ALA 83 83 ? ? ? A . n A 1 84 ALA 84 84 ? ? ? A . n A 1 85 PRO 85 85 ? ? ? A . n A 1 86 LYS 86 86 ? ? ? A . n A 1 87 SER 87 87 ? ? ? A . n A 1 88 LYS 88 88 ? ? ? A . n A 1 89 ASN 89 89 ? ? ? A . n # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-06-10 2 'Structure model' 1 1 2007-10-30 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 14 ? ? -98.52 32.45 2 1 ILE A 19 ? ? -66.02 -175.31 3 1 LEU A 22 ? ? -178.42 -68.40 4 1 ALA A 23 ? ? -177.29 38.62 5 1 ILE A 25 ? ? 102.11 174.27 6 1 ASN A 26 ? ? -68.84 75.61 7 1 SER A 30 ? ? 179.66 -62.07 8 1 LEU A 31 ? ? -135.86 -45.64 9 1 LEU A 34 ? ? -168.87 -35.67 10 1 ASP A 37 ? ? 70.14 -70.07 11 1 SER A 38 ? ? -156.02 27.35 12 1 VAL A 42 ? ? -151.27 -53.41 13 1 GLU A 51 ? ? -134.71 -46.49 14 1 LEU A 54 ? ? 74.15 142.78 15 1 THR A 65 ? ? -172.41 -74.73 16 1 LYS A 75 ? ? -178.20 -63.03 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 77 ? A GLY 77 2 1 Y 1 A SER 78 ? A SER 78 3 1 Y 1 A ASP 79 ? A ASP 79 4 1 Y 1 A THR 80 ? A THR 80 5 1 Y 1 A GLU 81 ? A GLU 81 6 1 Y 1 A LEU 82 ? A LEU 82 7 1 Y 1 A ALA 83 ? A ALA 83 8 1 Y 1 A ALA 84 ? A ALA 84 9 1 Y 1 A PRO 85 ? A PRO 85 10 1 Y 1 A LYS 86 ? A LYS 86 11 1 Y 1 A SER 87 ? A SER 87 12 1 Y 1 A LYS 88 ? A LYS 88 13 1 Y 1 A ASN 89 ? A ASN 89 #