data_1NBL # _entry.id 1NBL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1NBL pdb_00001nbl 10.2210/pdb1nbl/pdb RCSB RCSB017744 ? ? WWPDB D_1000017744 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NBL _pdbx_database_status.recvd_initial_deposition_date 2002-12-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Milbradt, A.G.' 1 'Kerek, F.' 2 'Moroder, L.' 3 'Renner, C.' 4 # _citation.id primary _citation.title 'Structural Characterization of Hellethionins from Helleborus purpurascens' _citation.journal_abbrev Biochemistry _citation.journal_volume 42 _citation.page_first 2404 _citation.page_last 2411 _citation.year 2003 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12600207 _citation.pdbx_database_id_DOI 10.1021/bi020628h # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Milbradt, A.G.' 1 ? primary 'Kerek, F.' 2 ? primary 'Moroder, L.' 3 ? primary 'Renner, C.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Hellethionin D' _entity.formula_weight 4915.618 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KSCCRNTLARNCYNACRFTGGSQPTCGILCDCIHVTTTTCPSSHPS _entity_poly.pdbx_seq_one_letter_code_can KSCCRNTLARNCYNACRFTGGSQPTCGILCDCIHVTTTTCPSSHPS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 SER n 1 3 CYS n 1 4 CYS n 1 5 ARG n 1 6 ASN n 1 7 THR n 1 8 LEU n 1 9 ALA n 1 10 ARG n 1 11 ASN n 1 12 CYS n 1 13 TYR n 1 14 ASN n 1 15 ALA n 1 16 CYS n 1 17 ARG n 1 18 PHE n 1 19 THR n 1 20 GLY n 1 21 GLY n 1 22 SER n 1 23 GLN n 1 24 PRO n 1 25 THR n 1 26 CYS n 1 27 GLY n 1 28 ILE n 1 29 LEU n 1 30 CYS n 1 31 ASP n 1 32 CYS n 1 33 ILE n 1 34 HIS n 1 35 VAL n 1 36 THR n 1 37 THR n 1 38 THR n 1 39 THR n 1 40 CYS n 1 41 PRO n 1 42 SER n 1 43 SER n 1 44 HIS n 1 45 PRO n 1 46 SER n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Helleborus purpurascens' _entity_src_nat.pdbx_ncbi_taxonomy_id 171899 _entity_src_nat.genus Helleborus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name PDB _struct_ref.db_code 1NBL _struct_ref.pdbx_db_accession 1NBL _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NBL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 46 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 1NBL _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 46 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 46 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '2D TOCSY' 3 1 1 DQF-COSY 4 1 2 '2D NOESY' 5 1 2 '2D TOCSY' 6 1 2 DQF-COSY 7 1 3 '2D NOESY' 8 1 3 '2D TOCSY' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 293 1 2.5 'pH 2.5' bar K 2 283 1 2.5 'pH 2.5' bar K 3 303 1 2.5 'pH 2.5' bar K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '4mM Hellethionin D; water pH 2.5; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O, 10% D2O pH 2.5' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 750 2 ? Bruker DRX 500 3 ? Bruker AMX 400 4 ? Bruker DRX 600 # _pdbx_nmr_refine.entry_id 1NBL _pdbx_nmr_refine.method ;distance geometry simulated annealing molecular dynamics ; _pdbx_nmr_refine.details 'Structure is based on 577 NOE-derived constraints and 17 distance constraints from hydrogen bonds' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1NBL _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_ensemble.entry_id 1NBL _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.0 collection bruker 1 XwinNMR 3.0 processing bruker 2 Sparky 3.98 'data analysis' Goddard 3 DGII ? 'structure solution' Accelrys 4 Discover 2.98 'structure solution' Accelrys 5 Discover 2.98 refinement Accelrys 6 # _exptl.entry_id 1NBL _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1NBL _struct.title 'NMR Structure of Hellethionin D' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NBL _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'Gamma Thionins Helleborus, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 6 ? THR A 19 ? ASN A 6 THR A 19 1 ? 14 HELX_P HELX_P2 2 SER A 22 ? CYS A 30 ? SER A 22 CYS A 30 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 40 SG ? ? A CYS 3 A CYS 40 1_555 ? ? ? ? ? ? ? 2.046 ? ? disulf2 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 4 A CYS 32 1_555 ? ? ? ? ? ? ? 2.046 ? ? disulf3 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 12 A CYS 30 1_555 ? ? ? ? ? ? ? 2.052 ? ? disulf4 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 16 A CYS 26 1_555 ? ? ? ? ? ? ? 2.041 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1NBL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1NBL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 SER 46 46 46 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-03-11 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE THERE WAS NO SUITABLE SEQUENCE DATABASE REFERENCE AT THE TIME OF PROCESSING. ; # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A SER 46 ? ? OXT A SER 46 ? ? 1.364 1.229 0.135 0.019 N 2 2 C A SER 46 ? ? OXT A SER 46 ? ? 1.362 1.229 0.133 0.019 N 3 3 C A SER 46 ? ? OXT A SER 46 ? ? 1.364 1.229 0.135 0.019 N 4 4 C A SER 46 ? ? OXT A SER 46 ? ? 1.363 1.229 0.134 0.019 N 5 5 C A SER 46 ? ? OXT A SER 46 ? ? 1.363 1.229 0.134 0.019 N 6 6 C A SER 46 ? ? OXT A SER 46 ? ? 1.365 1.229 0.136 0.019 N 7 7 C A SER 46 ? ? OXT A SER 46 ? ? 1.363 1.229 0.134 0.019 N 8 8 C A SER 46 ? ? OXT A SER 46 ? ? 1.363 1.229 0.134 0.019 N 9 9 C A SER 46 ? ? OXT A SER 46 ? ? 1.364 1.229 0.135 0.019 N 10 10 C A SER 46 ? ? OXT A SER 46 ? ? 1.363 1.229 0.134 0.019 N 11 11 C A SER 46 ? ? OXT A SER 46 ? ? 1.363 1.229 0.134 0.019 N 12 12 C A SER 46 ? ? OXT A SER 46 ? ? 1.364 1.229 0.135 0.019 N 13 13 C A SER 46 ? ? OXT A SER 46 ? ? 1.365 1.229 0.136 0.019 N 14 14 C A SER 46 ? ? OXT A SER 46 ? ? 1.364 1.229 0.135 0.019 N 15 15 C A SER 46 ? ? OXT A SER 46 ? ? 1.366 1.229 0.137 0.019 N 16 16 C A SER 46 ? ? OXT A SER 46 ? ? 1.364 1.229 0.135 0.019 N 17 17 C A SER 46 ? ? OXT A SER 46 ? ? 1.364 1.229 0.135 0.019 N 18 18 C A SER 46 ? ? OXT A SER 46 ? ? 1.364 1.229 0.135 0.019 N 19 19 C A SER 46 ? ? OXT A SER 46 ? ? 1.366 1.229 0.137 0.019 N 20 20 C A SER 46 ? ? OXT A SER 46 ? ? 1.363 1.229 0.134 0.019 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 6 CA A VAL 35 ? ? CB A VAL 35 ? ? CG2 A VAL 35 ? ? 120.00 110.90 9.10 1.50 N 2 13 CA A CYS 32 ? ? CB A CYS 32 ? ? SG A CYS 32 ? ? 121.39 114.20 7.19 1.10 N 3 15 CA A CYS 32 ? ? CB A CYS 32 ? ? SG A CYS 32 ? ? 121.32 114.20 7.12 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 37 ? ? -65.25 -177.24 2 2 THR A 36 ? ? -111.43 55.15 3 2 THR A 37 ? ? -63.35 -174.37 4 3 ILE A 33 ? ? -101.61 -156.19 5 3 THR A 36 ? ? -109.11 50.72 6 5 THR A 19 ? ? -65.10 -178.93 7 5 SER A 22 ? ? -62.04 -140.00 8 5 ILE A 33 ? ? -123.21 -162.39 9 7 ILE A 28 ? ? -92.00 -61.43 10 8 SER A 22 ? ? -59.64 170.29 11 8 ILE A 28 ? ? -94.24 -60.71 12 8 THR A 36 ? ? -109.92 50.53 13 9 SER A 22 ? ? -68.11 -134.69 14 9 ILE A 33 ? ? -127.17 -163.91 15 9 THR A 37 ? ? -66.53 -179.97 16 10 THR A 19 ? ? -64.03 0.70 17 10 ILE A 33 ? ? -118.44 -159.51 18 10 THR A 37 ? ? -67.21 -179.53 19 11 ILE A 28 ? ? -91.70 -61.01 20 11 ILE A 33 ? ? -118.27 -160.46 21 12 THR A 37 ? ? -65.97 -178.67 22 13 THR A 19 ? ? -63.16 1.28 23 13 THR A 36 ? ? -117.70 50.10 24 13 THR A 37 ? ? -65.89 -179.16 25 14 THR A 36 ? ? -111.80 50.14 26 15 THR A 19 ? ? -63.50 0.51 27 15 THR A 37 ? ? -66.67 -177.73 28 16 SER A 22 ? ? -58.86 171.43 29 16 THR A 36 ? ? -108.55 50.81 30 17 THR A 19 ? ? -63.99 2.38 31 17 ILE A 28 ? ? -91.59 -61.98 32 17 ILE A 33 ? ? -114.73 -159.08 33 18 THR A 39 ? ? -125.53 -153.03 34 19 ILE A 33 ? ? -128.64 -164.10 35 19 THR A 37 ? ? -66.06 -176.23 36 20 THR A 19 ? ? -64.08 -179.04 37 20 ILE A 33 ? ? -113.80 -158.15 38 20 THR A 37 ? ? 59.06 152.96 39 20 THR A 39 ? ? -175.39 -179.60 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 VAL A 35 ? ? THR A 36 ? ? 148.22 2 2 VAL A 35 ? ? THR A 36 ? ? 145.28 3 2 THR A 37 ? ? THR A 38 ? ? 140.95 4 3 VAL A 35 ? ? THR A 36 ? ? 145.65 5 4 VAL A 35 ? ? THR A 36 ? ? 145.43 6 5 VAL A 35 ? ? THR A 36 ? ? 145.82 7 6 VAL A 35 ? ? THR A 36 ? ? 147.25 8 7 VAL A 35 ? ? THR A 36 ? ? 146.31 9 8 VAL A 35 ? ? THR A 36 ? ? 146.12 10 9 VAL A 35 ? ? THR A 36 ? ? 147.10 11 9 THR A 37 ? ? THR A 38 ? ? 148.69 12 10 VAL A 35 ? ? THR A 36 ? ? 148.40 13 10 THR A 37 ? ? THR A 38 ? ? 145.50 14 11 VAL A 35 ? ? THR A 36 ? ? 145.79 15 12 VAL A 35 ? ? THR A 36 ? ? 148.76 16 12 THR A 37 ? ? THR A 38 ? ? 144.26 17 13 VAL A 35 ? ? THR A 36 ? ? 147.36 18 13 THR A 37 ? ? THR A 38 ? ? 146.85 19 14 VAL A 35 ? ? THR A 36 ? ? 146.76 20 15 VAL A 35 ? ? THR A 36 ? ? 147.25 21 16 VAL A 35 ? ? THR A 36 ? ? 145.41 22 17 VAL A 35 ? ? THR A 36 ? ? 145.74 23 18 VAL A 35 ? ? THR A 36 ? ? 147.00 24 19 VAL A 35 ? ? THR A 36 ? ? 147.75 25 19 THR A 37 ? ? THR A 38 ? ? 148.01 26 20 THR A 37 ? ? THR A 38 ? ? 132.05 #