data_1NCG # _entry.id 1NCG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.318 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1NCG WWPDB D_1000175229 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NCG _pdbx_database_status.recvd_initial_deposition_date 1995-03-23 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shapiro, L.' 1 'Fannon, A.M.' 2 'Kwong, P.D.' 3 'Thompson, A.' 4 'Lehmann, M.S.' 5 'Grubel, G.' 6 'Legrand, J.-F.' 7 'Als-Nielsen, J.' 8 'Colman, D.R.' 9 'Hendrickson, W.A.' 10 # _citation.id primary _citation.title 'Structural basis of cell-cell adhesion by cadherins.' _citation.journal_abbrev Nature _citation.journal_volume 374 _citation.page_first 327 _citation.page_last 337 _citation.year 1995 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 7885471 _citation.pdbx_database_id_DOI 10.1038/374327a0 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shapiro, L.' 1 ? primary 'Fannon, A.M.' 2 ? primary 'Kwong, P.D.' 3 ? primary 'Thompson, A.' 4 ? primary 'Lehmann, M.S.' 5 ? primary 'Grubel, G.' 6 ? primary 'Legrand, J.F.' 7 ? primary 'Als-Nielsen, J.' 8 ? primary 'Colman, D.R.' 9 ? primary 'Hendrickson, W.A.' 10 ? # _cell.entry_id 1NCG _cell.length_a 77.600 _cell.length_b 77.600 _cell.length_c 74.900 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1NCG _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man N-CADHERIN 12244.817 1 ? 'PCR MUTATION D27G, CLONING ARTIFACT GIVES TWO EXTRA RESIDUES (GLY-SER) AT N-TERMINUS (INS(G-2,S-1))' ? ? 2 non-polymer syn 'YTTERBIUM (III) ION' 173.040 1 ? ? ? ? 3 water nat water 18.015 202 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSDWVIPPINLPENSRGPFPQELVRIRSGRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRA HAVDINGNQVENPIDIVINVIDMNDNRPEF ; _entity_poly.pdbx_seq_one_letter_code_can ;GSDWVIPPINLPENSRGPFPQELVRIRSGRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRA HAVDINGNQVENPIDIVINVIDMNDNRPEF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ASP n 1 4 TRP n 1 5 VAL n 1 6 ILE n 1 7 PRO n 1 8 PRO n 1 9 ILE n 1 10 ASN n 1 11 LEU n 1 12 PRO n 1 13 GLU n 1 14 ASN n 1 15 SER n 1 16 ARG n 1 17 GLY n 1 18 PRO n 1 19 PHE n 1 20 PRO n 1 21 GLN n 1 22 GLU n 1 23 LEU n 1 24 VAL n 1 25 ARG n 1 26 ILE n 1 27 ARG n 1 28 SER n 1 29 GLY n 1 30 ARG n 1 31 ASP n 1 32 LYS n 1 33 ASN n 1 34 LEU n 1 35 SER n 1 36 LEU n 1 37 ARG n 1 38 TYR n 1 39 SER n 1 40 VAL n 1 41 THR n 1 42 GLY n 1 43 PRO n 1 44 GLY n 1 45 ALA n 1 46 ASP n 1 47 GLN n 1 48 PRO n 1 49 PRO n 1 50 THR n 1 51 GLY n 1 52 ILE n 1 53 PHE n 1 54 ILE n 1 55 ILE n 1 56 ASN n 1 57 PRO n 1 58 ILE n 1 59 SER n 1 60 GLY n 1 61 GLN n 1 62 LEU n 1 63 SER n 1 64 VAL n 1 65 THR n 1 66 LYS n 1 67 PRO n 1 68 LEU n 1 69 ASP n 1 70 ARG n 1 71 GLU n 1 72 LEU n 1 73 ILE n 1 74 ALA n 1 75 ARG n 1 76 PHE n 1 77 HIS n 1 78 LEU n 1 79 ARG n 1 80 ALA n 1 81 HIS n 1 82 ALA n 1 83 VAL n 1 84 ASP n 1 85 ILE n 1 86 ASN n 1 87 GLY n 1 88 ASN n 1 89 GLN n 1 90 VAL n 1 91 GLU n 1 92 ASN n 1 93 PRO n 1 94 ILE n 1 95 ASP n 1 96 ILE n 1 97 VAL n 1 98 ILE n 1 99 ASN n 1 100 VAL n 1 101 ILE n 1 102 ASP n 1 103 MET n 1 104 ASN n 1 105 ASP n 1 106 ASN n 1 107 ARG n 1 108 PRO n 1 109 GLU n 1 110 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PGEX-2T _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX-2T _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CADH2_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P15116 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MCRIAGGRGTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLPKDVHEGQPLLNVKFSNCNRKRKVQYESSEPADFK VDEDGTVYAVRSFPLTAEQAKFLIYAQDKETQEKWQVAVNLSREPTLTEEPMKEPHEIEEIVFPRQLAKHSGALQRQKRD WVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAV DINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRILSQAPSTPSPNM FTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDVIV ANLTVTDKDQPHTPAWNAAYRISGGDPTGRFAILTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQS TATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTLTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVLD RESPYVQNNIYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQEAETCETPEPNSINIAALDYDIDPNAGPFAFD LPLSPVTIKRNWTINRLNGDFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGL GTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPDTVEPDA IKPVGIRRLDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGG DQDYDYLNDWGPRFKKLADMYGGGDD ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NCG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 110 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P15116 _struct_ref_seq.db_align_beg 160 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 267 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 108 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1NCG _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 29 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P15116 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 186 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 27 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 YB non-polymer . 'YTTERBIUM (III) ION' ? 'Yb 3' 173.040 # _exptl.entry_id 1NCG _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.66 _exptl_crystal.density_percent_sol 53.68 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type FUJI _diffrn_detector.pdbx_collection_date 1994-08 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1NCG _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high ? _reflns.number_obs 18803 _reflns.number_all ? _reflns.percent_possible_obs 93.4 _reflns.pdbx_Rmerge_I_obs 0.045 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1NCG _refine.ls_number_reflns_obs 17546 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 5.0 _refine.ls_d_res_high 2.1 _refine.ls_percent_reflns_obs 92.8 _refine.ls_R_factor_obs 0.217 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.217 _refine.ls_R_factor_R_free 0.201 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 26.2 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 766 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 202 _refine_hist.number_atoms_total 969 _refine_hist.d_res_high 2.1 _refine_hist.d_res_low 5.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.015 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 2.10 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1NCG _struct.title 'STRUCTURAL BASIS OF CELL-CELL ADHESION BY CADHERINS' _struct.pdbx_descriptor N-CADHERIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NCG _struct_keywords.pdbx_keywords 'CELL ADHESION PROTEIN' _struct_keywords.text 'CADHERIN, CELL ADHESION PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ;THE ASYMMETRIC UNIT CONTAINS A SINGLE MOLECULE. A CADHERIN STRAND DIMER IS FORMED WITH THE (Y, X, -Z) SYMMETRY MATE. AN ADHESION DIMER IS FORMED WITH THE (1-Y, 1-X, 1/2-Z) SYMMETRY MATE. NOTE THAT THESE TRANSFORMATIONS ARE IN THE NON-ORTHOGONAL HEXAGONAL LATTICE. ; _struct_biol.pdbx_parent_biol_id ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 29 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 33 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 27 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 31 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A GLU 13 OE1 ? ? ? 1_555 B YB . YB ? ? A GLU 11 A YB 500 1_555 ? ? ? ? ? ? ? 2.298 ? metalc2 metalc ? ? A GLU 13 OE2 ? ? ? 1_555 B YB . YB ? ? A GLU 11 A YB 500 1_555 ? ? ? ? ? ? ? 2.013 ? metalc3 metalc ? ? A GLU 71 OE1 ? ? ? 1_555 B YB . YB ? ? A GLU 69 A YB 500 1_555 ? ? ? ? ? ? ? 2.304 ? metalc4 metalc ? ? B YB . YB ? ? ? 1_555 C HOH . O ? ? A YB 500 A HOH 562 1_555 ? ? ? ? ? ? ? 2.001 ? metalc5 metalc ? ? B YB . YB ? ? ? 1_555 C HOH . O ? ? A YB 500 A HOH 525 1_555 ? ? ? ? ? ? ? 2.269 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 17 A . ? GLY 15 A PRO 18 A ? PRO 16 A 1 -0.57 2 PHE 19 A . ? PHE 17 A PRO 20 A ? PRO 18 A 1 0.44 3 PRO 48 A . ? PRO 46 A PRO 49 A ? PRO 47 A 1 -0.46 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 9 ? PRO A 12 ? ILE A 7 PRO A 10 A 2 ILE A 94 ? ILE A 101 ? ILE A 92 ILE A 99 A 3 ARG A 75 ? VAL A 83 ? ARG A 73 VAL A 81 A 4 ARG A 37 ? THR A 41 ? ARG A 35 THR A 39 B 1 PHE A 53 ? ILE A 55 ? PHE A 51 ILE A 53 B 2 GLN A 61 ? VAL A 64 ? GLN A 59 VAL A 62 B 3 GLN A 21 ? ARG A 25 ? GLN A 19 ARG A 23 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 9 ? O ILE A 7 N ASN A 99 ? N ASN A 97 A 2 3 O ILE A 94 ? O ILE A 92 N ALA A 80 ? N ALA A 78 A 3 4 O ARG A 79 ? O ARG A 77 N THR A 41 ? N THR A 39 B 1 2 O ILE A 54 ? O ILE A 52 N SER A 63 ? N SER A 61 B 2 3 O LEU A 62 ? O LEU A 60 N VAL A 24 ? N VAL A 22 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details YB Unknown ? ? ? ? 1 ? AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE YB A 500' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 YB 1 YB B . ? YB A 500 . ? 1_555 ? 2 AC1 4 GLU A 13 ? GLU A 11 . ? 1_555 ? 3 AC1 4 GLU A 71 ? GLU A 69 . ? 1_555 ? 4 AC1 4 HOH C . ? HOH A 525 . ? 1_555 ? 5 AC1 4 HOH C . ? HOH A 562 . ? 1_555 ? # _database_PDB_matrix.entry_id 1NCG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1NCG _atom_sites.fract_transf_matrix[1][1] 0.012887 _atom_sites.fract_transf_matrix[1][2] 0.007440 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014880 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013351 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_sites_footnote.id _atom_sites_footnote.text 1 'CIS PROLINE - PRO 16' 2 'CIS PROLINE - PRO 18' 3 'CIS PROLINE - PRO 47' # loop_ _atom_type.symbol C N O YB # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 SER 2 0 ? ? ? A . n A 1 3 ASP 3 1 1 ASP ASP A . n A 1 4 TRP 4 2 2 TRP TRP A . n A 1 5 VAL 5 3 3 VAL VAL A . n A 1 6 ILE 6 4 4 ILE ILE A . n A 1 7 PRO 7 5 5 PRO PRO A . n A 1 8 PRO 8 6 6 PRO PRO A . n A 1 9 ILE 9 7 7 ILE ILE A . n A 1 10 ASN 10 8 8 ASN ASN A . n A 1 11 LEU 11 9 9 LEU LEU A . n A 1 12 PRO 12 10 10 PRO PRO A . n A 1 13 GLU 13 11 11 GLU GLU A . n A 1 14 ASN 14 12 12 ASN ASN A . n A 1 15 SER 15 13 13 SER SER A . n A 1 16 ARG 16 14 14 ARG ARG A . n A 1 17 GLY 17 15 15 GLY GLY A . n A 1 18 PRO 18 16 16 PRO PRO A . n A 1 19 PHE 19 17 17 PHE PHE A . n A 1 20 PRO 20 18 18 PRO PRO A . n A 1 21 GLN 21 19 19 GLN GLN A . n A 1 22 GLU 22 20 20 GLU GLU A . n A 1 23 LEU 23 21 21 LEU LEU A . n A 1 24 VAL 24 22 22 VAL VAL A . n A 1 25 ARG 25 23 23 ARG ARG A . n A 1 26 ILE 26 24 24 ILE ILE A . n A 1 27 ARG 27 25 25 ARG ARG A . n A 1 28 SER 28 26 26 SER SER A . n A 1 29 GLY 29 27 27 GLY GLY A . n A 1 30 ARG 30 28 28 ARG ARG A . n A 1 31 ASP 31 29 29 ASP ASP A . n A 1 32 LYS 32 30 30 LYS LYS A . n A 1 33 ASN 33 31 31 ASN ASN A . n A 1 34 LEU 34 32 32 LEU LEU A . n A 1 35 SER 35 33 33 SER SER A . n A 1 36 LEU 36 34 34 LEU LEU A . n A 1 37 ARG 37 35 35 ARG ARG A . n A 1 38 TYR 38 36 36 TYR TYR A . n A 1 39 SER 39 37 37 SER SER A . n A 1 40 VAL 40 38 38 VAL VAL A . n A 1 41 THR 41 39 39 THR THR A . n A 1 42 GLY 42 40 40 GLY GLY A . n A 1 43 PRO 43 41 41 PRO PRO A . n A 1 44 GLY 44 42 42 GLY GLY A . n A 1 45 ALA 45 43 43 ALA ALA A . n A 1 46 ASP 46 44 44 ASP ASP A . n A 1 47 GLN 47 45 45 GLN GLN A . n A 1 48 PRO 48 46 46 PRO PRO A . n A 1 49 PRO 49 47 47 PRO PRO A . n A 1 50 THR 50 48 48 THR THR A . n A 1 51 GLY 51 49 49 GLY GLY A . n A 1 52 ILE 52 50 50 ILE ILE A . n A 1 53 PHE 53 51 51 PHE PHE A . n A 1 54 ILE 54 52 52 ILE ILE A . n A 1 55 ILE 55 53 53 ILE ILE A . n A 1 56 ASN 56 54 54 ASN ASN A . n A 1 57 PRO 57 55 55 PRO PRO A . n A 1 58 ILE 58 56 56 ILE ILE A . n A 1 59 SER 59 57 57 SER SER A . n A 1 60 GLY 60 58 58 GLY GLY A . n A 1 61 GLN 61 59 59 GLN GLN A . n A 1 62 LEU 62 60 60 LEU LEU A . n A 1 63 SER 63 61 61 SER SER A . n A 1 64 VAL 64 62 62 VAL VAL A . n A 1 65 THR 65 63 63 THR THR A . n A 1 66 LYS 66 64 64 LYS LYS A . n A 1 67 PRO 67 65 65 PRO PRO A . n A 1 68 LEU 68 66 66 LEU LEU A . n A 1 69 ASP 69 67 67 ASP ASP A . n A 1 70 ARG 70 68 68 ARG ARG A . n A 1 71 GLU 71 69 69 GLU GLU A . n A 1 72 LEU 72 70 70 LEU LEU A . n A 1 73 ILE 73 71 71 ILE ILE A . n A 1 74 ALA 74 72 72 ALA ALA A . n A 1 75 ARG 75 73 73 ARG ARG A . n A 1 76 PHE 76 74 74 PHE PHE A . n A 1 77 HIS 77 75 75 HIS HIS A . n A 1 78 LEU 78 76 76 LEU LEU A . n A 1 79 ARG 79 77 77 ARG ARG A . n A 1 80 ALA 80 78 78 ALA ALA A . n A 1 81 HIS 81 79 79 HIS HIS A . n A 1 82 ALA 82 80 80 ALA ALA A . n A 1 83 VAL 83 81 81 VAL VAL A . n A 1 84 ASP 84 82 82 ASP ASP A . n A 1 85 ILE 85 83 83 ILE ILE A . n A 1 86 ASN 86 84 84 ASN ASN A . n A 1 87 GLY 87 85 85 GLY GLY A . n A 1 88 ASN 88 86 86 ASN ASN A . n A 1 89 GLN 89 87 87 GLN GLN A . n A 1 90 VAL 90 88 88 VAL VAL A . n A 1 91 GLU 91 89 89 GLU GLU A . n A 1 92 ASN 92 90 90 ASN ASN A . n A 1 93 PRO 93 91 91 PRO PRO A . n A 1 94 ILE 94 92 92 ILE ILE A . n A 1 95 ASP 95 93 93 ASP ASP A . n A 1 96 ILE 96 94 94 ILE ILE A . n A 1 97 VAL 97 95 95 VAL VAL A . n A 1 98 ILE 98 96 96 ILE ILE A . n A 1 99 ASN 99 97 97 ASN ASN A . n A 1 100 VAL 100 98 98 VAL VAL A . n A 1 101 ILE 101 99 99 ILE ILE A . n A 1 102 ASP 102 100 ? ? ? A . n A 1 103 MET 103 101 ? ? ? A . n A 1 104 ASN 104 102 ? ? ? A . n A 1 105 ASP 105 103 ? ? ? A . n A 1 106 ASN 106 104 ? ? ? A . n A 1 107 ARG 107 105 ? ? ? A . n A 1 108 PRO 108 106 ? ? ? A . n A 1 109 GLU 109 107 ? ? ? A . n A 1 110 PHE 110 108 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 YB 1 500 500 YB YB A . C 3 HOH 1 501 1 HOH HOH A . C 3 HOH 2 502 2 HOH HOH A . C 3 HOH 3 503 3 HOH HOH A . C 3 HOH 4 504 4 HOH HOH A . C 3 HOH 5 505 5 HOH HOH A . C 3 HOH 6 506 6 HOH HOH A . C 3 HOH 7 507 7 HOH HOH A . C 3 HOH 8 508 8 HOH HOH A . C 3 HOH 9 509 9 HOH HOH A . C 3 HOH 10 510 10 HOH HOH A . C 3 HOH 11 511 11 HOH HOH A . C 3 HOH 12 512 12 HOH HOH A . C 3 HOH 13 513 13 HOH HOH A . C 3 HOH 14 514 14 HOH HOH A . C 3 HOH 15 515 15 HOH HOH A . C 3 HOH 16 516 16 HOH HOH A . C 3 HOH 17 517 17 HOH HOH A . C 3 HOH 18 518 18 HOH HOH A . C 3 HOH 19 519 19 HOH HOH A . C 3 HOH 20 520 20 HOH HOH A . C 3 HOH 21 521 21 HOH HOH A . C 3 HOH 22 522 22 HOH HOH A . C 3 HOH 23 523 23 HOH HOH A . C 3 HOH 24 524 24 HOH HOH A . C 3 HOH 25 525 25 HOH HOH A . C 3 HOH 26 526 26 HOH HOH A . C 3 HOH 27 527 27 HOH HOH A . C 3 HOH 28 528 28 HOH HOH A . C 3 HOH 29 529 29 HOH HOH A . C 3 HOH 30 530 30 HOH HOH A . C 3 HOH 31 531 31 HOH HOH A . C 3 HOH 32 532 32 HOH HOH A . C 3 HOH 33 533 33 HOH HOH A . C 3 HOH 34 534 34 HOH HOH A . C 3 HOH 35 535 35 HOH HOH A . C 3 HOH 36 536 36 HOH HOH A . C 3 HOH 37 537 37 HOH HOH A . C 3 HOH 38 538 38 HOH HOH A . C 3 HOH 39 539 39 HOH HOH A . C 3 HOH 40 540 40 HOH HOH A . C 3 HOH 41 541 41 HOH HOH A . C 3 HOH 42 542 42 HOH HOH A . C 3 HOH 43 543 43 HOH HOH A . C 3 HOH 44 544 44 HOH HOH A . C 3 HOH 45 545 45 HOH HOH A . C 3 HOH 46 546 46 HOH HOH A . C 3 HOH 47 547 47 HOH HOH A . C 3 HOH 48 548 48 HOH HOH A . C 3 HOH 49 549 49 HOH HOH A . C 3 HOH 50 550 50 HOH HOH A . C 3 HOH 51 551 51 HOH HOH A . C 3 HOH 52 552 52 HOH HOH A . C 3 HOH 53 553 53 HOH HOH A . C 3 HOH 54 554 54 HOH HOH A . C 3 HOH 55 555 55 HOH HOH A . C 3 HOH 56 556 56 HOH HOH A . C 3 HOH 57 557 57 HOH HOH A . C 3 HOH 58 558 58 HOH HOH A . C 3 HOH 59 559 59 HOH HOH A . C 3 HOH 60 560 60 HOH HOH A . C 3 HOH 61 561 61 HOH HOH A . C 3 HOH 62 562 62 HOH HOH A . C 3 HOH 63 563 63 HOH HOH A . C 3 HOH 64 564 64 HOH HOH A . C 3 HOH 65 565 65 HOH HOH A . C 3 HOH 66 566 66 HOH HOH A . C 3 HOH 67 567 67 HOH HOH A . C 3 HOH 68 568 68 HOH HOH A . C 3 HOH 69 569 69 HOH HOH A . C 3 HOH 70 570 70 HOH HOH A . C 3 HOH 71 571 71 HOH HOH A . C 3 HOH 72 572 72 HOH HOH A . C 3 HOH 73 573 73 HOH HOH A . C 3 HOH 74 574 74 HOH HOH A . C 3 HOH 75 575 75 HOH HOH A . C 3 HOH 76 576 76 HOH HOH A . C 3 HOH 77 577 77 HOH HOH A . C 3 HOH 78 578 78 HOH HOH A . C 3 HOH 79 579 79 HOH HOH A . C 3 HOH 80 580 80 HOH HOH A . C 3 HOH 81 581 81 HOH HOH A . C 3 HOH 82 582 82 HOH HOH A . C 3 HOH 83 583 83 HOH HOH A . C 3 HOH 84 584 84 HOH HOH A . C 3 HOH 85 585 85 HOH HOH A . C 3 HOH 86 586 86 HOH HOH A . C 3 HOH 87 587 87 HOH HOH A . C 3 HOH 88 588 88 HOH HOH A . C 3 HOH 89 589 89 HOH HOH A . C 3 HOH 90 590 90 HOH HOH A . C 3 HOH 91 591 91 HOH HOH A . C 3 HOH 92 592 92 HOH HOH A . C 3 HOH 93 593 93 HOH HOH A . C 3 HOH 94 594 94 HOH HOH A . C 3 HOH 95 595 95 HOH HOH A . C 3 HOH 96 596 96 HOH HOH A . C 3 HOH 97 597 97 HOH HOH A . C 3 HOH 98 598 98 HOH HOH A . C 3 HOH 99 599 99 HOH HOH A . C 3 HOH 100 600 100 HOH HOH A . C 3 HOH 101 601 101 HOH HOH A . C 3 HOH 102 602 102 HOH HOH A . C 3 HOH 103 603 103 HOH HOH A . C 3 HOH 104 604 104 HOH HOH A . C 3 HOH 105 605 105 HOH HOH A . C 3 HOH 106 606 106 HOH HOH A . C 3 HOH 107 607 107 HOH HOH A . C 3 HOH 108 608 108 HOH HOH A . C 3 HOH 109 609 109 HOH HOH A . C 3 HOH 110 610 110 HOH HOH A . C 3 HOH 111 611 111 HOH HOH A . C 3 HOH 112 612 112 HOH HOH A . C 3 HOH 113 613 113 HOH HOH A . C 3 HOH 114 614 114 HOH HOH A . C 3 HOH 115 615 115 HOH HOH A . C 3 HOH 116 616 116 HOH HOH A . C 3 HOH 117 617 117 HOH HOH A . C 3 HOH 118 618 118 HOH HOH A . C 3 HOH 119 619 119 HOH HOH A . C 3 HOH 120 620 120 HOH HOH A . C 3 HOH 121 621 121 HOH HOH A . C 3 HOH 122 622 122 HOH HOH A . C 3 HOH 123 623 123 HOH HOH A . C 3 HOH 124 624 124 HOH HOH A . C 3 HOH 125 625 125 HOH HOH A . C 3 HOH 126 626 126 HOH HOH A . C 3 HOH 127 627 127 HOH HOH A . C 3 HOH 128 628 128 HOH HOH A . C 3 HOH 129 629 129 HOH HOH A . C 3 HOH 130 630 130 HOH HOH A . C 3 HOH 131 631 131 HOH HOH A . C 3 HOH 132 632 132 HOH HOH A . C 3 HOH 133 633 133 HOH HOH A . C 3 HOH 134 634 134 HOH HOH A . C 3 HOH 135 635 135 HOH HOH A . C 3 HOH 136 636 136 HOH HOH A . C 3 HOH 137 637 137 HOH HOH A . C 3 HOH 138 638 138 HOH HOH A . C 3 HOH 139 639 139 HOH HOH A . C 3 HOH 140 640 140 HOH HOH A . C 3 HOH 141 641 141 HOH HOH A . C 3 HOH 142 642 142 HOH HOH A . C 3 HOH 143 643 143 HOH HOH A . C 3 HOH 144 644 144 HOH HOH A . C 3 HOH 145 645 145 HOH HOH A . C 3 HOH 146 646 146 HOH HOH A . C 3 HOH 147 647 147 HOH HOH A . C 3 HOH 148 648 148 HOH HOH A . C 3 HOH 149 649 149 HOH HOH A . C 3 HOH 150 650 150 HOH HOH A . C 3 HOH 151 651 151 HOH HOH A . C 3 HOH 152 652 152 HOH HOH A . C 3 HOH 153 653 153 HOH HOH A . C 3 HOH 154 654 154 HOH HOH A . C 3 HOH 155 655 155 HOH HOH A . C 3 HOH 156 656 156 HOH HOH A . C 3 HOH 157 657 157 HOH HOH A . C 3 HOH 158 658 158 HOH HOH A . C 3 HOH 159 659 159 HOH HOH A . C 3 HOH 160 660 160 HOH HOH A . C 3 HOH 161 661 161 HOH HOH A . C 3 HOH 162 662 162 HOH HOH A . C 3 HOH 163 663 163 HOH HOH A . C 3 HOH 164 664 164 HOH HOH A . C 3 HOH 165 665 165 HOH HOH A . C 3 HOH 166 666 166 HOH HOH A . C 3 HOH 167 667 167 HOH HOH A . C 3 HOH 168 668 168 HOH HOH A . C 3 HOH 169 669 169 HOH HOH A . C 3 HOH 170 670 170 HOH HOH A . C 3 HOH 171 671 171 HOH HOH A . C 3 HOH 172 672 172 HOH HOH A . C 3 HOH 173 673 173 HOH HOH A . C 3 HOH 174 674 174 HOH HOH A . C 3 HOH 175 675 175 HOH HOH A . C 3 HOH 176 676 176 HOH HOH A . C 3 HOH 177 677 177 HOH HOH A . C 3 HOH 178 678 178 HOH HOH A . C 3 HOH 179 679 179 HOH HOH A . C 3 HOH 180 680 180 HOH HOH A . C 3 HOH 181 681 181 HOH HOH A . C 3 HOH 182 682 182 HOH HOH A . C 3 HOH 183 683 183 HOH HOH A . C 3 HOH 184 684 184 HOH HOH A . C 3 HOH 185 685 185 HOH HOH A . C 3 HOH 186 686 186 HOH HOH A . C 3 HOH 187 687 187 HOH HOH A . C 3 HOH 188 688 188 HOH HOH A . C 3 HOH 189 689 189 HOH HOH A . C 3 HOH 190 690 190 HOH HOH A . C 3 HOH 191 691 191 HOH HOH A . C 3 HOH 192 692 192 HOH HOH A . C 3 HOH 193 693 193 HOH HOH A . C 3 HOH 194 694 194 HOH HOH A . C 3 HOH 195 695 195 HOH HOH A . C 3 HOH 196 696 196 HOH HOH A . C 3 HOH 197 697 197 HOH HOH A . C 3 HOH 198 698 198 HOH HOH A . C 3 HOH 199 699 199 HOH HOH A . C 3 HOH 200 700 200 HOH HOH A . C 3 HOH 201 701 201 HOH HOH A . C 3 HOH 202 702 202 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 13 ? A GLU 11 ? 1_555 YB ? B YB . ? A YB 500 ? 1_555 OE2 ? A GLU 13 ? A GLU 11 ? 1_555 58.5 ? 2 OE1 ? A GLU 13 ? A GLU 11 ? 1_555 YB ? B YB . ? A YB 500 ? 1_555 OE1 ? A GLU 71 ? A GLU 69 ? 1_555 70.5 ? 3 OE2 ? A GLU 13 ? A GLU 11 ? 1_555 YB ? B YB . ? A YB 500 ? 1_555 OE1 ? A GLU 71 ? A GLU 69 ? 1_555 120.5 ? 4 OE1 ? A GLU 13 ? A GLU 11 ? 1_555 YB ? B YB . ? A YB 500 ? 1_555 O ? C HOH . ? A HOH 562 ? 1_555 86.2 ? 5 OE2 ? A GLU 13 ? A GLU 11 ? 1_555 YB ? B YB . ? A YB 500 ? 1_555 O ? C HOH . ? A HOH 562 ? 1_555 79.7 ? 6 OE1 ? A GLU 71 ? A GLU 69 ? 1_555 YB ? B YB . ? A YB 500 ? 1_555 O ? C HOH . ? A HOH 562 ? 1_555 67.9 ? 7 OE1 ? A GLU 13 ? A GLU 11 ? 1_555 YB ? B YB . ? A YB 500 ? 1_555 O ? C HOH . ? A HOH 525 ? 1_555 77.4 ? 8 OE2 ? A GLU 13 ? A GLU 11 ? 1_555 YB ? B YB . ? A YB 500 ? 1_555 O ? C HOH . ? A HOH 525 ? 1_555 113.0 ? 9 OE1 ? A GLU 71 ? A GLU 69 ? 1_555 YB ? B YB . ? A YB 500 ? 1_555 O ? C HOH . ? A HOH 525 ? 1_555 80.7 ? 10 O ? C HOH . ? A HOH 562 ? 1_555 YB ? B YB . ? A YB 500 ? 1_555 O ? C HOH . ? A HOH 525 ? 1_555 148.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-07-10 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' Advisory 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_conn_angle 3 4 'Structure model' pdbx_validate_close_contact 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 DENZO 'data reduction' . ? 3 X-PLOR phasing . ? 4 # _pdbx_entry_details.entry_id 1NCG _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ;THE MODEL INCLUDES ONE YTTERBIUM ION (YB 3+) BOUND AT THE PUTATIVE CALCIUM BINDING SITE. ; _pdbx_entry_details.sequence_details 'RESIDUE NUMBERING IS FOR THE MATURE PROTEIN.' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 69 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 YB _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 YB _pdbx_validate_close_contact.auth_seq_id_2 500 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.67 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 697 ? ? 1_555 O A HOH 697 ? ? 11_555 0.80 2 1 O A HOH 673 ? ? 1_555 O A HOH 673 ? ? 10_665 1.46 3 1 O A HOH 675 ? ? 1_555 O A HOH 675 ? ? 10_665 1.48 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 73 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 73 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 73 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.27 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.03 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 16 ? ? -49.09 157.54 2 1 LEU A 21 ? ? -102.36 -65.26 3 1 LEU A 32 ? ? -174.52 112.90 4 1 ALA A 43 ? ? -121.41 -77.37 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 1 ? CB ? A ASP 3 CB 2 1 Y 1 A ASP 1 ? CG ? A ASP 3 CG 3 1 Y 1 A ASP 1 ? OD1 ? A ASP 3 OD1 4 1 Y 1 A ASP 1 ? OD2 ? A ASP 3 OD2 5 1 Y 1 A ARG 35 ? CD ? A ARG 37 CD 6 1 Y 1 A ARG 35 ? NE ? A ARG 37 NE 7 1 Y 1 A ARG 35 ? CZ ? A ARG 37 CZ 8 1 Y 1 A ARG 35 ? NH1 ? A ARG 37 NH1 9 1 Y 1 A ARG 35 ? NH2 ? A ARG 37 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A SER 0 ? A SER 2 3 1 Y 1 A ASP 100 ? A ASP 102 4 1 Y 1 A MET 101 ? A MET 103 5 1 Y 1 A ASN 102 ? A ASN 104 6 1 Y 1 A ASP 103 ? A ASP 105 7 1 Y 1 A ASN 104 ? A ASN 106 8 1 Y 1 A ARG 105 ? A ARG 107 9 1 Y 1 A PRO 106 ? A PRO 108 10 1 Y 1 A GLU 107 ? A GLU 109 11 1 Y 1 A PHE 108 ? A PHE 110 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'YTTERBIUM (III) ION' YB 3 water HOH #