data_1NEQ # _entry.id 1NEQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1NEQ pdb_00001neq 10.2210/pdb1neq/pdb WWPDB D_1000175260 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1NER _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NEQ _pdbx_database_status.recvd_initial_deposition_date 1995-08-24 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Clore, G.M.' 1 'Strzelecka, T.E.' 2 'Gronenborn, A.M.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'The solution structure of the Mu Ner protein reveals a helix-turn-helix DNA recognition motif.' Structure 3 1087 1095 1995 STRUE6 UK 0969-2126 2005 ? 8590003 '10.1016/S0969-2126(01)00244-1' 1 ;Determination of the Secondary Structure of the DNA Binding Protein Ner from Phage Mu Using 1H Homonuclear and 15N-1H Heteronuclear NMR Spectroscopy ; Biochemistry 28 5081 ? 1989 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Strzelecka, T.E.' 1 ? primary 'Clore, G.M.' 2 ? primary 'Gronenborn, A.M.' 3 ? 1 'Gronenborn, A.M.' 4 ? 1 'Wingfield, P.T.' 5 ? 1 'Clore, G.M.' 6 ? # _cell.entry_id 1NEQ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1NEQ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'DNA-BINDING PROTEIN NER' _entity.formula_weight 8388.538 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CSNEKARDWHRADVIAGLKKRKLSLSALSRQFGYAPTTLANALERHWPKGEQIIANALETKPEVIWPSRYQAGE _entity_poly.pdbx_seq_one_letter_code_can CSNEKARDWHRADVIAGLKKRKLSLSALSRQFGYAPTTLANALERHWPKGEQIIANALETKPEVIWPSRYQAGE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 SER n 1 3 ASN n 1 4 GLU n 1 5 LYS n 1 6 ALA n 1 7 ARG n 1 8 ASP n 1 9 TRP n 1 10 HIS n 1 11 ARG n 1 12 ALA n 1 13 ASP n 1 14 VAL n 1 15 ILE n 1 16 ALA n 1 17 GLY n 1 18 LEU n 1 19 LYS n 1 20 LYS n 1 21 ARG n 1 22 LYS n 1 23 LEU n 1 24 SER n 1 25 LEU n 1 26 SER n 1 27 ALA n 1 28 LEU n 1 29 SER n 1 30 ARG n 1 31 GLN n 1 32 PHE n 1 33 GLY n 1 34 TYR n 1 35 ALA n 1 36 PRO n 1 37 THR n 1 38 THR n 1 39 LEU n 1 40 ALA n 1 41 ASN n 1 42 ALA n 1 43 LEU n 1 44 GLU n 1 45 ARG n 1 46 HIS n 1 47 TRP n 1 48 PRO n 1 49 LYS n 1 50 GLY n 1 51 GLU n 1 52 GLN n 1 53 ILE n 1 54 ILE n 1 55 ALA n 1 56 ASN n 1 57 ALA n 1 58 LEU n 1 59 GLU n 1 60 THR n 1 61 LYS n 1 62 PRO n 1 63 GLU n 1 64 VAL n 1 65 ILE n 1 66 TRP n 1 67 PRO n 1 68 SER n 1 69 ARG n 1 70 TYR n 1 71 GLN n 1 72 ALA n 1 73 GLY n 1 74 GLU n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Enterobacteria phage Mu' _entity_src_nat.pdbx_ncbi_taxonomy_id 10677 _entity_src_nat.genus 'Mu-like viruses' _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NER_BPMU _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P06020 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code CSNEKARDWHRADVIAGLKKRKLSLSALSRQFGYAPTTLANALERHWPKGEQIIANALETKPEVIWPSRYQAGE _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NEQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 74 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06020 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 74 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 74 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_refine.entry_id 1NEQ _pdbx_nmr_refine.method ? _pdbx_nmr_refine.details ;THE 3D STRUCTURE OF THE MU NER PROTEIN BY MULTI-DIMENSIONAL HETERONUCLEAR NMR IS BASED ON 1546 EXPERIMENTAL RESTRAINTS COMPRISING THE FOLLOWING: 944 INTERPROTON DISTANCE RESTRAINTS [251 SEQUENTIAL; 202 SHORT RANGE (1<|I-J|<=5; 157 LONG RANGE (|I-J|>5); AND 334 INTRARESIDUE]; 40 DISTANCE RESTRAINTS FOR 20 BACKBONE HYDROGEN BONDS; 89 TORSION ANGLE RESTRAINTS 56 PHI, 27 CH1 AND 6 CHI2); 46 3 BOND HN-HA COUPLING CONSTANTS; 140 SECONDARY 13C SHIFTS (72 CA AND 68 CB); 287 1H CHEMICAL SHIFTS (74 HA, 39 METHYL AND 174 OTHER, WITH NO EXCHANGEABLE PROTON SHIFTS). THE STRUCTURE WAS DETERMINED BY SIMULATED ANNEALING [NILGES, CLORE AND GRONENBORN (1988) FEBS LETT. 229, 317 - 324] USING THE PROGRAM X-PLOR (BRUNGER) MODIFIED TO INCORPORATE COUPLING CONSTANT [GARRETT ET AL. AND CLORE (1994) J. MAGN. RESON. B104, 99 - 103], CARBON CHEMICAL SHIFT [KUSZEWSKI, QIN, GRONENBORN AND CLORE (1995) J. MAGN. RESON. B106, 92 - 96] AND PROTON CHEMICAL SHIFT [KUSZEWSKI, GRONENBORN AND CLORE (1995) J. MAGN. RESON. B107, 293 - 297] RESTRAINTS. THIS ENTRY CONTAINS THE RESTRAINED REGULARIZED MEAN STRUCTURE OBTAINED BY AVERAGING THE COORDINATES OF THE 30 SIMULATED ANNEALING STRUCTURES BEST FITTED TO EACH OTHER (RESIDUES 8 - 66). THE N- AND C-TERMINI ARE DISORDERED, AND THE NUMBER IN THE LAST COLUMN (THE B- FACTOR COLUMN) GIVES THE AVERAGE RMS TO THE MEAN COORDINATE POSITIONS. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1NEQ _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1NEQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1NEQ _struct.title 'SOLUTION STRUCTURE OF THE MU NER PROTEIN BY MULTIDIMENSIONAL NMR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NEQ _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'DNA-BINDING PROTEIN, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 11 ? LYS A 19 ? ARG A 11 LYS A 19 1 ? 9 HELX_P HELX_P2 2 LEU A 25 ? PHE A 32 ? LEU A 25 PHE A 32 1 ? 8 HELX_P HELX_P3 3 PRO A 36 ? LEU A 43 ? PRO A 36 LEU A 43 1 ? 8 HELX_P HELX_P4 4 PRO A 48 ? LEU A 58 ? PRO A 48 LEU A 58 1 ? 11 HELX_P HELX_P5 5 PRO A 62 ? ILE A 65 ? PRO A 62 ILE A 65 1 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1NEQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1NEQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 TRP 66 66 66 TRP TRP A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLU 74 74 74 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-12-07 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_keywords # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_keywords.text' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 HG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 CYS _pdbx_validate_close_contact.auth_seq_id_1 1 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 2 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.28 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 4 ? ? 28.32 -82.78 2 1 LYS A 5 ? ? -95.98 53.21 3 1 ALA A 6 ? ? -35.18 -85.26 4 1 HIS A 10 ? ? -44.82 155.70 5 1 ARG A 21 ? ? -103.10 -84.37 6 1 LYS A 22 ? ? -161.23 63.18 7 1 ALA A 35 ? ? -46.13 158.17 8 1 TRP A 47 ? ? -166.85 73.02 9 1 THR A 60 ? ? -110.81 -169.79 10 1 GLN A 71 ? ? -151.52 2.41 11 1 ALA A 72 ? ? -66.76 14.44 #