data_1NHY # _entry.id 1NHY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1NHY pdb_00001nhy 10.2210/pdb1nhy/pdb RCSB RCSB017885 ? ? WWPDB D_1000017885 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3LJR 'human GST T2-2' unspecified PDB 1FW1 'human GST Z1-1' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NHY _pdbx_database_status.recvd_initial_deposition_date 2002-12-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jeppesen, M.G.' 1 'Ortiz, P.' 2 'Kinzy, T.G.' 3 'Andersen, G.R.' 4 'Nyborg, J.' 5 # _citation.id primary _citation.title 'The Crystal Structure of the Glutathione S-Transferase-like Domain of Elongation Factor 1B{gamma} from Saccharomyces cerevisiae.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 278 _citation.page_first 47190 _citation.page_last 47198 _citation.year 2003 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12972429 _citation.pdbx_database_id_DOI 10.1074/jbc.M306630200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jeppesen, M.G.' 1 ? primary 'Ortiz, P.' 2 ? primary 'Shepard, W.' 3 ? primary 'Kinzy, T.G.' 4 ? primary 'Nyborg, J.' 5 ? primary 'Andersen, G.R.' 6 ? # _cell.entry_id 1NHY _cell.length_a 164.520 _cell.length_b 164.520 _cell.length_c 164.520 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 48 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1NHY _symmetry.space_group_name_H-M 'I 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 214 _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Elongation factor 1-gamma 1' 24950.051 1 ? ? 'residue 1-219, N-terminal domain' ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'EF-1-gamma 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)SQGTLYANFRIRTWVPRGLVKALKLDVKVVTPDAAAEQFARDFPLKKVPAFVGPKGYKLTEA(MSE)AINYYLVK LSQDDK(MSE)KTQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVPLKGGAPYNKKSVDSA(MSE)DAVDKIVDIFE NRLKNYTYLATENISLADLVAASIFTRYFESLFGTEWRAQHPAIVRWFNTVRASPFLKDEYKDFKFADKPLSPPQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MSQGTLYANFRIRTWVPRGLVKALKLDVKVVTPDAAAEQFARDFPLKKVPAFVGPKGYKLTEAMAINYYLVKLSQDDKMK TQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVPLKGGAPYNKKSVDSAMDAVDKIVDIFENRLKNYTYLATENISL ADLVAASIFTRYFESLFGTEWRAQHPAIVRWFNTVRASPFLKDEYKDFKFADKPLSPPQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 SER n 1 3 GLN n 1 4 GLY n 1 5 THR n 1 6 LEU n 1 7 TYR n 1 8 ALA n 1 9 ASN n 1 10 PHE n 1 11 ARG n 1 12 ILE n 1 13 ARG n 1 14 THR n 1 15 TRP n 1 16 VAL n 1 17 PRO n 1 18 ARG n 1 19 GLY n 1 20 LEU n 1 21 VAL n 1 22 LYS n 1 23 ALA n 1 24 LEU n 1 25 LYS n 1 26 LEU n 1 27 ASP n 1 28 VAL n 1 29 LYS n 1 30 VAL n 1 31 VAL n 1 32 THR n 1 33 PRO n 1 34 ASP n 1 35 ALA n 1 36 ALA n 1 37 ALA n 1 38 GLU n 1 39 GLN n 1 40 PHE n 1 41 ALA n 1 42 ARG n 1 43 ASP n 1 44 PHE n 1 45 PRO n 1 46 LEU n 1 47 LYS n 1 48 LYS n 1 49 VAL n 1 50 PRO n 1 51 ALA n 1 52 PHE n 1 53 VAL n 1 54 GLY n 1 55 PRO n 1 56 LYS n 1 57 GLY n 1 58 TYR n 1 59 LYS n 1 60 LEU n 1 61 THR n 1 62 GLU n 1 63 ALA n 1 64 MSE n 1 65 ALA n 1 66 ILE n 1 67 ASN n 1 68 TYR n 1 69 TYR n 1 70 LEU n 1 71 VAL n 1 72 LYS n 1 73 LEU n 1 74 SER n 1 75 GLN n 1 76 ASP n 1 77 ASP n 1 78 LYS n 1 79 MSE n 1 80 LYS n 1 81 THR n 1 82 GLN n 1 83 LEU n 1 84 LEU n 1 85 GLY n 1 86 ALA n 1 87 ASP n 1 88 ASP n 1 89 ASP n 1 90 LEU n 1 91 ASN n 1 92 ALA n 1 93 GLN n 1 94 ALA n 1 95 GLN n 1 96 ILE n 1 97 ILE n 1 98 ARG n 1 99 TRP n 1 100 GLN n 1 101 SER n 1 102 LEU n 1 103 ALA n 1 104 ASN n 1 105 SER n 1 106 ASP n 1 107 LEU n 1 108 CYS n 1 109 ILE n 1 110 GLN n 1 111 ILE n 1 112 ALA n 1 113 ASN n 1 114 THR n 1 115 ILE n 1 116 VAL n 1 117 PRO n 1 118 LEU n 1 119 LYS n 1 120 GLY n 1 121 GLY n 1 122 ALA n 1 123 PRO n 1 124 TYR n 1 125 ASN n 1 126 LYS n 1 127 LYS n 1 128 SER n 1 129 VAL n 1 130 ASP n 1 131 SER n 1 132 ALA n 1 133 MSE n 1 134 ASP n 1 135 ALA n 1 136 VAL n 1 137 ASP n 1 138 LYS n 1 139 ILE n 1 140 VAL n 1 141 ASP n 1 142 ILE n 1 143 PHE n 1 144 GLU n 1 145 ASN n 1 146 ARG n 1 147 LEU n 1 148 LYS n 1 149 ASN n 1 150 TYR n 1 151 THR n 1 152 TYR n 1 153 LEU n 1 154 ALA n 1 155 THR n 1 156 GLU n 1 157 ASN n 1 158 ILE n 1 159 SER n 1 160 LEU n 1 161 ALA n 1 162 ASP n 1 163 LEU n 1 164 VAL n 1 165 ALA n 1 166 ALA n 1 167 SER n 1 168 ILE n 1 169 PHE n 1 170 THR n 1 171 ARG n 1 172 TYR n 1 173 PHE n 1 174 GLU n 1 175 SER n 1 176 LEU n 1 177 PHE n 1 178 GLY n 1 179 THR n 1 180 GLU n 1 181 TRP n 1 182 ARG n 1 183 ALA n 1 184 GLN n 1 185 HIS n 1 186 PRO n 1 187 ALA n 1 188 ILE n 1 189 VAL n 1 190 ARG n 1 191 TRP n 1 192 PHE n 1 193 ASN n 1 194 THR n 1 195 VAL n 1 196 ARG n 1 197 ALA n 1 198 SER n 1 199 PRO n 1 200 PHE n 1 201 LEU n 1 202 LYS n 1 203 ASP n 1 204 GLU n 1 205 TYR n 1 206 LYS n 1 207 ASP n 1 208 PHE n 1 209 LYS n 1 210 PHE n 1 211 ALA n 1 212 ASP n 1 213 LYS n 1 214 PRO n 1 215 LEU n 1 216 SER n 1 217 PRO n 1 218 PRO n 1 219 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene TEF3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11d _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EF1G1_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSQGTLYANFRIRTWVPRGLVKALKLDVKVVTPDAAAEQFARDFPLKKVPAFVGPKGYKLTEAMAINYYLVKLSQDDKMK TQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVPLKGGAPYNKKSVDSAMDAVDKIVDIFENRLKNYTYLATENISL ADLVAASIFTRYFESLFGTEWRAQHPAIVRWFNTVRASPFLKDEYKDFKFADKPLSPPQ ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P29547 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NHY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 219 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P29547 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 219 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 219 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1NHY MSE A 1 ? UNP P29547 MET 1 'engineered mutation' 1 1 1 1NHY MSE A 64 ? UNP P29547 MET 64 'engineered mutation' 64 2 1 1NHY MSE A 79 ? UNP P29547 MET 79 'engineered mutation' 79 3 1 1NHY MSE A 133 ? UNP P29547 MET 133 'engineered mutation' 133 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1NHY _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.78 _exptl_crystal.density_percent_sol 67.21 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 279 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details 'Ammonium sulfate, EDTA, DTT, sodium azide, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 279K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type ADSC _diffrn_detector.pdbx_collection_date 2001-04-24 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9792 # _reflns.entry_id 1NHY _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 3.0 _reflns.d_resolution_low 28.0 _reflns.number_all ? _reflns.number_obs 14125 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.053 _reflns.pdbx_Rsym_value 0.049 _reflns.pdbx_netI_over_sigmaI 50.1 _reflns.B_iso_Wilson_estimate 93.74 _reflns.pdbx_redundancy 10.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 3.01 _reflns_shell.d_res_low 3.17 _reflns_shell.percent_possible_all 99.6 _reflns_shell.Rmerge_I_obs 0.362 _reflns_shell.pdbx_Rsym_value 0.33 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 0.109 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1NHY _refine.ls_d_res_high 3.0 _refine.ls_d_res_low 20.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 13747 _refine.ls_number_reflns_obs 12773 _refine.ls_number_reflns_R_free 974 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_all 0.2346 _refine.ls_R_factor_obs 0.2349 _refine.ls_R_factor_R_work 0.2346 _refine.ls_R_factor_R_free 0.2349 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model None _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details Random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1748 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1753 _refine_hist.d_res_high 3.0 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.d_res_high 3.00 _refine_ls_shell.d_res_low 3.05 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.R_factor_R_work 0.43 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.42 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 29 _refine_ls_shell.number_reflns_obs 405 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1NHY _struct.title 'Crystal Structure of the GST-like Domain of Elongation Factor 1-gamma from Saccharomyces cerevisiae.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NHY _struct_keywords.pdbx_keywords TRANSLATION _struct_keywords.text 'Protein synthesis, GST-like, TRANSLATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 11 ? LYS A 25 ? ARG A 11 LYS A 25 1 ? 15 HELX_P HELX_P2 2 THR A 32 ? ALA A 35 ? THR A 32 ALA A 35 5 ? 4 HELX_P HELX_P3 3 ALA A 36 ? PHE A 44 ? ALA A 36 PHE A 44 1 ? 9 HELX_P HELX_P4 4 PRO A 55 ? GLY A 57 ? PRO A 55 GLY A 57 5 ? 3 HELX_P HELX_P5 5 GLU A 62 ? SER A 74 ? GLU A 62 SER A 74 1 ? 13 HELX_P HELX_P6 6 ASP A 76 ? LEU A 84 ? ASP A 76 LEU A 84 1 ? 9 HELX_P HELX_P7 7 ASP A 89 ? SER A 105 ? ASP A 89 SER A 105 1 ? 17 HELX_P HELX_P8 8 CYS A 108 ? ASN A 113 ? CYS A 108 ASN A 113 5 ? 6 HELX_P HELX_P9 9 THR A 114 ? LYS A 119 ? THR A 114 LYS A 119 1 ? 6 HELX_P HELX_P10 10 ASN A 125 ? LYS A 148 ? ASN A 125 LYS A 148 1 ? 24 HELX_P HELX_P11 11 SER A 159 ? LEU A 176 ? SER A 159 LEU A 176 1 ? 18 HELX_P HELX_P12 12 GLY A 178 ? HIS A 185 ? GLY A 178 HIS A 185 1 ? 8 HELX_P HELX_P13 13 HIS A 185 ? SER A 198 ? HIS A 185 SER A 198 1 ? 14 HELX_P HELX_P14 14 LEU A 201 ? TYR A 205 ? LEU A 201 TYR A 205 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 1 C ? ? ? 1_555 A SER 2 N ? ? A MSE 1 A SER 2 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? A ALA 63 C ? ? ? 1_555 A MSE 64 N ? ? A ALA 63 A MSE 64 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale3 covale both ? A MSE 64 C ? ? ? 1_555 A ALA 65 N ? ? A MSE 64 A ALA 65 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale4 covale both ? A LYS 78 C ? ? ? 1_555 A MSE 79 N ? ? A LYS 78 A MSE 79 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale5 covale both ? A MSE 79 C ? ? ? 1_555 A LYS 80 N ? ? A MSE 79 A LYS 80 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale6 covale both ? A ALA 132 C ? ? ? 1_555 A MSE 133 N ? ? A ALA 132 A MSE 133 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale7 covale both ? A MSE 133 C ? ? ? 1_555 A ASP 134 N ? ? A MSE 133 A ASP 134 1_555 ? ? ? ? ? ? ? 1.327 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 49 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 49 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 50 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 50 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.24 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 29 ? VAL A 31 ? LYS A 29 VAL A 31 A 2 THR A 5 ? TYR A 7 ? THR A 5 TYR A 7 A 3 ALA A 51 ? VAL A 53 ? ALA A 51 VAL A 53 A 4 LYS A 59 ? THR A 61 ? LYS A 59 THR A 61 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 29 ? O LYS A 29 N LEU A 6 ? N LEU A 6 A 2 3 N THR A 5 ? N THR A 5 O VAL A 53 ? O VAL A 53 A 3 4 N PHE A 52 ? N PHE A 52 O LEU A 60 ? O LEU A 60 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SO4 _struct_site.pdbx_auth_seq_id 220 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A 220' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ARG A 11 ? ARG A 11 . ? 1_555 ? 2 AC1 3 ILE A 12 ? ILE A 12 . ? 1_555 ? 3 AC1 3 ARG A 171 ? ARG A 171 . ? 1_555 ? # _database_PDB_matrix.entry_id 1NHY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1NHY _atom_sites.fract_transf_matrix[1][1] 0.006078 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006078 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006078 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 PRO 50 50 50 PRO CPR A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 MSE 64 64 64 MSE MSE A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 MSE 79 79 79 MSE MSE A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 TRP 99 99 99 TRP TRP A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 CYS 108 108 108 CYS CYS A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 MSE 133 133 133 MSE MSE A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 ASN 157 157 157 ASN ASN A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 SER 159 159 159 SER SER A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 PHE 169 169 169 PHE PHE A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 ARG 171 171 171 ARG ARG A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 PHE 177 177 177 PHE PHE A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 TRP 181 181 181 TRP TRP A . n A 1 182 ARG 182 182 182 ARG ARG A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 HIS 185 185 185 HIS HIS A . n A 1 186 PRO 186 186 186 PRO PRO A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 TRP 191 191 191 TRP TRP A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 ARG 196 196 196 ARG ARG A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 PHE 200 200 200 PHE PHE A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 LYS 202 202 202 LYS LYS A . n A 1 203 ASP 203 203 203 ASP ASP A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 TYR 205 205 205 TYR TYR A . n A 1 206 LYS 206 206 206 LYS LYS A . n A 1 207 ASP 207 207 207 ASP ASP A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 PHE 210 210 210 PHE PHE A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 LYS 213 213 213 LYS LYS A . n A 1 214 PRO 214 214 214 PRO PRO A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 PRO 217 217 217 PRO PRO A . n A 1 218 PRO 218 218 218 PRO PRO A . n A 1 219 GLN 219 219 219 GLN GLN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id SO4 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 220 _pdbx_nonpoly_scheme.auth_seq_num 220 _pdbx_nonpoly_scheme.pdb_mon_id SO4 _pdbx_nonpoly_scheme.auth_mon_id SO4 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 64 A MSE 64 ? MET SELENOMETHIONINE 3 A MSE 79 A MSE 79 ? MET SELENOMETHIONINE 4 A MSE 133 A MSE 133 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-01-14 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_conn 3 4 'Structure model' struct_ref_seq_dif 4 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOSFLM 'data reduction' . ? 1 SCALA 'data scaling' . ? 2 SHELXD phasing . ? 3 CNS refinement . ? 4 CCP4 'data scaling' '(SCALA)' ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 9 ? ? -88.55 -157.98 2 1 PHE A 10 ? ? -111.94 77.09 3 1 ASP A 27 ? ? -83.14 43.45 4 1 ALA A 36 ? ? -171.84 75.91 5 1 LYS A 47 ? ? 35.39 47.60 6 1 GLU A 62 ? ? 73.96 117.67 7 1 ASP A 89 ? ? -117.97 67.07 8 1 SER A 105 ? ? -118.57 -89.33 9 1 ASP A 106 ? ? -29.63 -47.92 10 1 THR A 114 ? ? -143.15 -76.48 11 1 LYS A 119 ? ? -60.17 7.91 12 1 PRO A 123 ? ? -37.62 121.47 13 1 SER A 128 ? ? -66.05 -70.22 14 1 THR A 170 ? ? -32.72 -78.67 15 1 LYS A 206 ? ? -47.53 -93.94 16 1 PHE A 210 ? ? -69.01 87.77 17 1 PRO A 214 ? ? -54.71 105.13 18 1 LEU A 215 ? ? -36.59 128.80 19 1 PRO A 217 ? ? -41.34 170.71 20 1 PRO A 218 ? ? -48.10 161.49 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'SULFATE ION' _pdbx_entity_nonpoly.comp_id SO4 #