data_1NJ7 # _entry.id 1NJ7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1NJ7 RCSB RCSB017915 WWPDB D_1000017915 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2004-05-11 _pdbx_database_PDB_obs_spr.pdb_id 1T50 _pdbx_database_PDB_obs_spr.replace_pdb_id 1NJ7 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.entry_id 1NJ7 _pdbx_database_status.recvd_initial_deposition_date 2002-12-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr OBS _pdbx_database_status.status_code_cs ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ravindranath, G.' 1 'Xu, Y.' 2 'Schein, C.H.' 3 'Rajaratnam, K.' 4 'Painter, S.D.' 5 'Nagle, G.T.' 6 'Braun, W.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'NMR Solution Structure of Attractin, a Pheromone from the Mollusk Aplysia Attractin' 'To be published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'Aplysia Attractin: Biophysical Characterization and modeling of a Water-Borne Pheromone' BIOPHYS.J. 81 463 472 2001 BIOJAU US 0006-3495 0030 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ravindranath, G.' 1 primary 'Xu, Y.' 2 primary 'Schein, C.H.' 3 primary 'Rajaratnam, K.' 4 primary 'Painter, S.D.' 5 primary 'Nagle, G.T.' 6 primary 'Braun, W.' 7 1 'Schein, C.H.' 8 1 'Nagle, G.T.' 9 1 'Page, J.S.' 10 1 'Sweedler, J.V.' 11 1 'Xu, Y.' 12 1 'Painter, S.D.' 13 1 'Braun, W.' 14 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Attractin _entity.formula_weight 6359.892 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DQNCDIGNITSQCQMQHKNCEDANGCDTIIEECKTSMVERCQNQEFESAAGSTTLGPQ _entity_poly.pdbx_seq_one_letter_code_can DQNCDIGNITSQCQMQHKNCEDANGCDTIIEECKTSMVERCQNQEFESAAGSTTLGPQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 GLN n 1 3 ASN n 1 4 CYS n 1 5 ASP n 1 6 ILE n 1 7 GLY n 1 8 ASN n 1 9 ILE n 1 10 THR n 1 11 SER n 1 12 GLN n 1 13 CYS n 1 14 GLN n 1 15 MET n 1 16 GLN n 1 17 HIS n 1 18 LYS n 1 19 ASN n 1 20 CYS n 1 21 GLU n 1 22 ASP n 1 23 ALA n 1 24 ASN n 1 25 GLY n 1 26 CYS n 1 27 ASP n 1 28 THR n 1 29 ILE n 1 30 ILE n 1 31 GLU n 1 32 GLU n 1 33 CYS n 1 34 LYS n 1 35 THR n 1 36 SER n 1 37 MET n 1 38 VAL n 1 39 GLU n 1 40 ARG n 1 41 CYS n 1 42 GLN n 1 43 ASN n 1 44 GLN n 1 45 GLU n 1 46 PHE n 1 47 GLU n 1 48 SER n 1 49 ALA n 1 50 ALA n 1 51 GLY n 1 52 SER n 1 53 THR n 1 54 THR n 1 55 LEU n 1 56 GLY n 1 57 PRO n 1 58 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'California sea hare' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'APLYSIA CALIFORNICA' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line SF9 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Baculovirus _entity_src_gen.pdbx_host_org_vector 'pFastBac 1' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'APLYSIA CALIFORNICA' _entity_src_nat.pdbx_ncbi_taxonomy_id ? _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name gb _struct_ref.db_code AAD00569 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DQNCDIGNITSQCQMQHKNCEDANGCDTIIEECKTSMVERCQNQEFESAAGSTTLGPQ _struct_ref.pdbx_align_begin 19 _struct_ref.pdbx_db_accession 4099289 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NJ7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 58 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 4099289 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 58 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 TOCSY 1 3 1 DQF-COSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.00 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength '1 MM' _pdbx_nmr_exptl_sample_conditions.pressure_units ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model UNITYPLUS _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1NJ7 _pdbx_nmr_refine.method 'SELF-CORRECTING DG/ VTF' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1NJ7 _pdbx_nmr_details.text 'HOMONUCLEAR 1H NMR SPECTROSCOPY' # _pdbx_nmr_ensemble.entry_id 1NJ7 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'VTF VALUES' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1NJ7 _pdbx_nmr_representative.conformer_id 4 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' NOAH/DIAMOND/FANTOM ? 'Braun, W.' 1 refinement NOAH/DIAMOND/FANTOM ? 'Braun, W.' 2 # _exptl.entry_id 1NJ7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 760 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 760 _refine_hist.d_res_high . _refine_hist.d_res_low . _refine_hist.pdbx_refine_id . # _struct.entry_id 1NJ7 _struct.title 'NMR SOLUTION STRUCTURE OF APLYSIA ATTRACTIN' _struct.pdbx_descriptor ATTRACTIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NJ7 _struct_keywords.pdbx_keywords ATTRACTIN _struct_keywords.text 'MOLLUSK, PHEROMONE, APLYSIA ATTRACTIN, ATTRACTIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 9 ? HIS A 17 ? ILE A 9 HIS A 17 1 ? 9 HELX_P HELX_P2 2 ILE A 29 ? GLU A 39 ? ILE A 29 GLU A 39 1 ? 11 HELX_P HELX_P3 3 CYS A 41 ? PHE A 46 ? CYS A 41 PHE A 46 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 4 A CYS 41 1_555 ? ? ? ? ? ? ? 2.101 ? disulf2 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 13 A CYS 33 1_555 ? ? ? ? ? ? ? 2.006 ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 20 A CYS 26 1_555 ? ? ? ? ? ? ? 2.026 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1NJ7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1NJ7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 GLN 58 58 58 GLN GLN A . n # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-05-13 2 'Structure model' 1 1 2004-05-11 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 2 ? ? -156.54 84.04 2 1 HIS A 17 ? ? -156.89 43.86 3 1 CYS A 20 ? ? -150.62 -45.06 4 1 GLU A 21 ? ? 71.61 35.61 5 1 PHE A 46 ? ? 30.66 79.19 6 1 SER A 48 ? ? -165.38 52.77 7 1 ALA A 50 ? ? -162.76 -56.20 8 1 SER A 52 ? ? 81.01 -59.83 9 1 THR A 53 ? ? -140.35 24.22 10 2 CYS A 4 ? ? -151.09 -83.44 11 2 ASP A 5 ? ? -164.62 91.33 12 2 HIS A 17 ? ? -151.04 74.96 13 2 GLU A 21 ? ? 73.76 44.24 14 2 THR A 28 ? ? -96.63 -63.30 15 2 PHE A 46 ? ? 29.87 76.34 16 2 THR A 53 ? ? 51.69 -176.25 17 2 THR A 54 ? ? 34.74 46.78 18 3 CYS A 4 ? ? -176.26 -46.45 19 3 ASP A 5 ? ? -157.95 -47.30 20 3 ILE A 6 ? ? -29.66 -52.35 21 3 HIS A 17 ? ? -151.45 64.62 22 3 LYS A 18 ? ? -172.94 63.52 23 3 ASN A 24 ? ? -162.59 38.05 24 3 CYS A 26 ? ? -90.98 45.21 25 3 THR A 28 ? ? -107.54 -61.45 26 3 LYS A 34 ? ? -91.51 -70.00 27 3 SER A 48 ? ? -68.14 85.95 28 3 ALA A 50 ? ? -156.75 45.28 29 3 SER A 52 ? ? -158.45 49.59 30 3 THR A 54 ? ? 70.16 145.73 31 4 GLN A 2 ? ? 66.43 151.75 32 4 ASN A 3 ? ? -92.37 46.08 33 4 CYS A 4 ? ? 61.79 155.79 34 4 CYS A 20 ? ? 67.34 117.89 35 4 THR A 28 ? ? -159.49 -61.55 36 4 LYS A 34 ? ? -80.48 -70.13 37 4 SER A 48 ? ? 69.95 -59.53 38 4 ALA A 49 ? ? -159.26 -48.54 39 4 ALA A 50 ? ? -134.52 -54.68 40 5 ASN A 3 ? ? -167.70 -52.87 41 5 ASP A 5 ? ? -67.00 94.20 42 5 CYS A 26 ? ? -106.04 47.84 43 5 THR A 28 ? ? -140.14 -61.42 44 5 LYS A 34 ? ? -80.98 -77.76 45 5 PHE A 46 ? ? -103.21 63.82 46 5 SER A 48 ? ? 58.22 -79.32 47 6 ASN A 3 ? ? -167.44 -169.94 48 6 CYS A 4 ? ? -39.88 138.52 49 6 HIS A 17 ? ? -154.82 57.98 50 6 LYS A 18 ? ? -156.29 83.31 51 6 CYS A 20 ? ? -174.90 -44.57 52 6 ALA A 23 ? ? -91.33 55.83 53 6 ASN A 24 ? ? -174.81 -51.15 54 6 LYS A 34 ? ? -68.67 -77.32 55 6 SER A 48 ? ? -151.93 -59.45 56 6 ALA A 50 ? ? -155.79 -68.40 57 6 THR A 53 ? ? -90.70 54.20 58 7 ASN A 3 ? ? -170.53 -47.89 59 7 HIS A 17 ? ? -162.81 80.89 60 7 LYS A 18 ? ? -164.40 -55.74 61 7 ASN A 19 ? ? 82.12 -58.15 62 7 ASN A 24 ? ? -172.60 41.60 63 7 SER A 36 ? ? -33.10 -71.56 64 7 ALA A 49 ? ? -157.75 -56.13 65 7 THR A 53 ? ? 68.25 -77.83 66 8 HIS A 17 ? ? -158.60 75.28 67 8 LYS A 18 ? ? -156.98 -63.50 68 8 ASN A 19 ? ? 59.92 168.21 69 8 CYS A 20 ? ? 78.57 -51.82 70 8 GLU A 21 ? ? 77.93 40.17 71 8 THR A 28 ? ? -154.50 -59.38 72 8 PHE A 46 ? ? 47.23 76.26 73 8 SER A 48 ? ? 66.01 -169.75 74 8 ALA A 50 ? ? -145.86 -61.09 75 8 THR A 53 ? ? -117.71 65.57 76 8 THR A 54 ? ? 67.43 156.98 77 9 ASN A 3 ? ? -162.01 80.35 78 9 CYS A 4 ? ? 67.91 164.80 79 9 GLN A 14 ? ? -46.94 -73.16 80 9 HIS A 17 ? ? -166.45 62.76 81 9 ASP A 27 ? ? 38.19 47.48 82 9 THR A 28 ? ? -90.12 -70.70 83 9 LYS A 34 ? ? -71.39 -70.62 84 9 PHE A 46 ? ? 30.44 80.43 85 9 SER A 48 ? ? -166.05 53.28 86 10 CYS A 4 ? ? -158.82 -81.88 87 10 ASP A 5 ? ? 174.69 111.01 88 10 HIS A 17 ? ? -152.40 63.15 89 10 LYS A 18 ? ? -162.27 -63.75 90 10 ASN A 19 ? ? 57.69 177.98 91 10 CYS A 20 ? ? 81.61 -44.98 92 10 ASN A 24 ? ? -176.35 -50.12 93 10 THR A 28 ? ? -152.38 -66.18 94 11 ASN A 3 ? ? -172.30 -43.34 95 11 ASP A 5 ? ? -157.11 -65.30 96 11 ILE A 6 ? ? 30.75 56.57 97 11 HIS A 17 ? ? -153.61 56.24 98 11 CYS A 20 ? ? 84.23 -35.16 99 11 GLU A 21 ? ? 82.72 55.51 100 11 LYS A 34 ? ? -73.22 -75.66 101 11 SER A 36 ? ? -36.65 -72.83 102 11 PHE A 46 ? ? 37.62 45.97 103 11 THR A 53 ? ? -63.69 99.95 104 12 ASN A 3 ? ? -166.09 -43.48 105 12 ASP A 5 ? ? -174.35 -49.65 106 12 ILE A 6 ? ? 37.61 47.19 107 12 LYS A 18 ? ? -162.07 -55.39 108 12 CYS A 20 ? ? -162.14 102.07 109 12 ASN A 24 ? ? -176.05 -58.65 110 12 ASP A 27 ? ? -53.85 108.16 111 12 THR A 28 ? ? -151.80 -57.18 112 12 LYS A 34 ? ? -70.81 -70.12 113 12 GLU A 47 ? ? -28.35 115.33 114 12 SER A 48 ? ? -158.84 44.29 115 12 SER A 52 ? ? -140.67 -49.09 116 12 THR A 54 ? ? 64.40 -75.96 117 13 CYS A 4 ? ? 64.26 172.39 118 13 HIS A 17 ? ? -157.75 79.47 119 13 LYS A 18 ? ? -174.50 95.46 120 13 ASN A 24 ? ? 36.97 44.55 121 13 THR A 28 ? ? -123.90 -58.59 122 13 LYS A 34 ? ? -70.65 -73.42 123 13 SER A 48 ? ? -163.02 67.04 124 13 THR A 54 ? ? 39.10 47.52 125 14 GLN A 2 ? ? 54.42 79.56 126 14 ILE A 6 ? ? 38.97 -158.13 127 14 LYS A 18 ? ? -156.97 82.47 128 14 CYS A 20 ? ? 80.72 -48.82 129 14 GLU A 21 ? ? 77.01 39.70 130 14 ASP A 27 ? ? 42.67 77.65 131 14 THR A 28 ? ? -130.58 -62.65 132 14 THR A 53 ? ? 64.64 159.09 133 15 ASN A 3 ? ? -172.61 -49.98 134 15 ASP A 5 ? ? -93.70 34.08 135 15 HIS A 17 ? ? -155.07 36.53 136 15 CYS A 20 ? ? 84.64 -39.70 137 15 ASN A 24 ? ? -140.83 -54.95 138 15 THR A 28 ? ? -153.42 -66.55 139 15 LYS A 34 ? ? -78.32 -76.33 140 15 SER A 52 ? ? -58.64 107.52 141 15 THR A 54 ? ? 56.44 73.25 142 16 GLN A 2 ? ? -141.86 51.24 143 16 ASN A 3 ? ? -166.66 -51.73 144 16 CYS A 4 ? ? -146.74 -75.38 145 16 ASP A 5 ? ? 175.60 -42.07 146 16 ILE A 6 ? ? 38.23 83.08 147 16 HIS A 17 ? ? -165.21 36.65 148 16 SER A 36 ? ? -37.47 -71.27 149 16 PHE A 46 ? ? 32.76 54.63 150 16 SER A 52 ? ? 63.15 161.42 151 16 THR A 54 ? ? 67.39 162.52 152 17 GLN A 2 ? ? 57.09 82.46 153 17 ASN A 3 ? ? -153.42 -52.63 154 17 HIS A 17 ? ? -151.49 67.90 155 17 LYS A 18 ? ? -164.50 -53.92 156 17 ASN A 19 ? ? 85.09 -55.67 157 17 THR A 28 ? ? -150.43 -58.20 158 17 PHE A 46 ? ? -87.60 38.22 159 17 SER A 48 ? ? -154.27 -54.99 160 17 ALA A 49 ? ? -69.00 78.41 161 17 SER A 52 ? ? -102.45 48.56 162 17 THR A 53 ? ? 44.70 -101.58 163 17 THR A 54 ? ? 33.92 56.28 164 18 GLN A 2 ? ? 56.08 77.73 165 18 CYS A 4 ? ? 47.18 -157.12 166 18 ILE A 6 ? ? 38.80 82.23 167 18 LYS A 18 ? ? -165.66 92.72 168 18 CYS A 20 ? ? 63.45 127.27 169 18 THR A 28 ? ? -132.15 -67.03 170 18 LYS A 34 ? ? -80.11 -72.77 171 18 ALA A 49 ? ? -145.80 27.44 172 18 LEU A 55 ? ? -166.65 -51.46 173 19 GLN A 2 ? ? -152.76 -46.46 174 19 CYS A 4 ? ? 63.42 -91.94 175 19 ASP A 5 ? ? 174.68 -45.50 176 19 ILE A 6 ? ? 59.52 17.24 177 19 LYS A 18 ? ? -173.43 -52.82 178 19 CYS A 20 ? ? -156.18 -52.98 179 19 ASP A 27 ? ? 45.08 72.87 180 19 THR A 28 ? ? -125.76 -58.66 181 19 LYS A 34 ? ? -65.87 -72.91 182 19 GLN A 44 ? ? -92.88 -61.89 183 19 THR A 53 ? ? 39.59 55.13 184 20 GLN A 2 ? ? -162.75 -49.57 185 20 ASN A 3 ? ? -141.85 -43.48 186 20 CYS A 4 ? ? -141.18 -101.26 187 20 ASP A 5 ? ? -176.14 58.93 188 20 HIS A 17 ? ? -150.45 45.83 189 20 CYS A 20 ? ? 82.55 -37.64 190 20 GLU A 21 ? ? 73.87 45.20 191 20 ASN A 24 ? ? 36.56 42.05 192 20 THR A 28 ? ? -129.31 -67.60 193 20 PHE A 46 ? ? 29.44 60.75 194 20 SER A 48 ? ? 57.35 92.80 195 20 SER A 52 ? ? -162.86 -59.23 196 20 THR A 54 ? ? 75.14 -66.86 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 2 LYS A 18 ? ? ASN A 19 ? ? 147.64 2 3 ASP A 5 ? ? ILE A 6 ? ? -98.61 3 11 CYS A 20 ? ? GLU A 21 ? ? 149.65 4 11 GLY A 56 ? ? PRO A 57 ? ? 141.12 5 11 PRO A 57 ? ? GLN A 58 ? ? -128.19 #