data_1NJH # _entry.id 1NJH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1NJH RCSB RCSB017920 WWPDB D_1000017920 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC1392 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NJH _pdbx_database_status.recvd_initial_deposition_date 2002-12-31 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kim, Y.' 1 'Korolev, O.' 2 'Joachimiak, A.' 3 'Midwest Center for Structural Genomics (MCSG)' 4 # _citation.id primary _citation.title 'Crystal Structure of Bacillus subtilis YojF protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kim, Y.' 1 primary 'Korolev, O.' 2 primary 'Joachimiak, A.' 3 # _cell.entry_id 1NJH _cell.length_a 78.703 _cell.length_b 78.703 _cell.length_c 31.074 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1NJH _symmetry.space_group_name_H-M 'P 3 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 150 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'protein yojF' 13472.826 1 ? ? ? ? 2 non-polymer syn 'ISOPROPYL ALCOHOL' 60.095 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 89 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNA(MSE)KAIIKEDVQASLERYADRPVYIHLETTTGSYSAHLNEKN(MSE)TVVAYIRNAKVTYHQAKIKGNGPYRVGL KTEEGWIYAEGLTEYTVDEENRLL(MSE)AGHLPGGKLAISLQISEKPFTV ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMKAIIKEDVQASLERYADRPVYIHLETTTGSYSAHLNEKNMTVVAYIRNAKVTYHQAKIKGNGPYRVGLKTEEGWIY AEGLTEYTVDEENRLLMAGHLPGGKLAISLQISEKPFTV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC1392 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MSE n 1 5 LYS n 1 6 ALA n 1 7 ILE n 1 8 ILE n 1 9 LYS n 1 10 GLU n 1 11 ASP n 1 12 VAL n 1 13 GLN n 1 14 ALA n 1 15 SER n 1 16 LEU n 1 17 GLU n 1 18 ARG n 1 19 TYR n 1 20 ALA n 1 21 ASP n 1 22 ARG n 1 23 PRO n 1 24 VAL n 1 25 TYR n 1 26 ILE n 1 27 HIS n 1 28 LEU n 1 29 GLU n 1 30 THR n 1 31 THR n 1 32 THR n 1 33 GLY n 1 34 SER n 1 35 TYR n 1 36 SER n 1 37 ALA n 1 38 HIS n 1 39 LEU n 1 40 ASN n 1 41 GLU n 1 42 LYS n 1 43 ASN n 1 44 MSE n 1 45 THR n 1 46 VAL n 1 47 VAL n 1 48 ALA n 1 49 TYR n 1 50 ILE n 1 51 ARG n 1 52 ASN n 1 53 ALA n 1 54 LYS n 1 55 VAL n 1 56 THR n 1 57 TYR n 1 58 HIS n 1 59 GLN n 1 60 ALA n 1 61 LYS n 1 62 ILE n 1 63 LYS n 1 64 GLY n 1 65 ASN n 1 66 GLY n 1 67 PRO n 1 68 TYR n 1 69 ARG n 1 70 VAL n 1 71 GLY n 1 72 LEU n 1 73 LYS n 1 74 THR n 1 75 GLU n 1 76 GLU n 1 77 GLY n 1 78 TRP n 1 79 ILE n 1 80 TYR n 1 81 ALA n 1 82 GLU n 1 83 GLY n 1 84 LEU n 1 85 THR n 1 86 GLU n 1 87 TYR n 1 88 THR n 1 89 VAL n 1 90 ASP n 1 91 GLU n 1 92 GLU n 1 93 ASN n 1 94 ARG n 1 95 LEU n 1 96 LEU n 1 97 MSE n 1 98 ALA n 1 99 GLY n 1 100 HIS n 1 101 LEU n 1 102 PRO n 1 103 GLY n 1 104 GLY n 1 105 LYS n 1 106 LEU n 1 107 ALA n 1 108 ILE n 1 109 SER n 1 110 LEU n 1 111 GLN n 1 112 ILE n 1 113 SER n 1 114 GLU n 1 115 LYS n 1 116 PRO n 1 117 PHE n 1 118 THR n 1 119 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene YojF _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O31858_BACSU _struct_ref.pdbx_db_accession O31858 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKAIIKEDVQASLERYADRPVYIHLETTTGSYSAHLNEKNMTVVAYIRNAKVTYHQAKIKGNGPYRVGLKTEEGWIYAEG LTEYTVDEENRLLMAGHLPGGKLAISLQISEKPFTV ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NJH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 119 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O31858 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 116 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 116 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1NJH SER A 1 ? UNP O31858 ? ? 'CLONING ARTIFACT' -2 1 1 1NJH ASN A 2 ? UNP O31858 ? ? 'CLONING ARTIFACT' -1 2 1 1NJH ALA A 3 ? UNP O31858 ? ? 'CLONING ARTIFACT' 0 3 1 1NJH MSE A 4 ? UNP O31858 MET 1 'MODIFIED RESIDUE' 1 4 1 1NJH MSE A 44 ? UNP O31858 MET 41 'MODIFIED RESIDUE' 41 5 1 1NJH MSE A 97 ? UNP O31858 MET 94 'MODIFIED RESIDUE' 94 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IPA non-polymer . 'ISOPROPYL ALCOHOL' 2-PROPANOL 'C3 H8 O' 60.095 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1NJH _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 2 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.06 _exptl_crystal.density_percent_sol 40.33 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pdbx_details 'Isopropanol, Sodium citrate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 100 ? 1 2 100 ? 1 1,2 ? ? 1 # loop_ _diffrn_detector.diffrn_id _diffrn_detector.detector _diffrn_detector.type _diffrn_detector.pdbx_collection_date _diffrn_detector.details 1 CCD SBC-2 2002-08-18 mirror 2 CCD SBC-2 2002-09-01 mirror # loop_ _diffrn_radiation.diffrn_id _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.monochromator _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_scattering_type 1 1 M 'double crystal monochromator' 'SINGLE WAVELENGTH' x-ray 2 1 M 'double crystal monochromator' MAD x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97921 1.0 2 0.97915 1.0 3 0.97926 1.0 4 0.94644 1.0 # loop_ _diffrn_source.diffrn_id _diffrn_source.source _diffrn_source.type _diffrn_source.pdbx_synchrotron_site _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_wavelength_list 1 SYNCHROTRON 'APS BEAMLINE 19-ID' APS 19-ID ? 0.97921 2 SYNCHROTRON 'APS BEAMLINE 19-ID' APS 19-ID ? '0.97915, 0.97926, 0.94644' # _reflns.entry_id 1NJH _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 28.27 _reflns.d_resolution_high 1.7 _reflns.number_obs 12326 _reflns.number_all 12326 _reflns.percent_possible_obs 99.2 _reflns.pdbx_Rmerge_I_obs 0.042 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 9.4 _reflns.B_iso_Wilson_estimate 22.6 _reflns.pdbx_redundancy 6.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1,2 # _reflns_shell.d_res_high 1.7 _reflns_shell.d_res_low 1.76 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.513 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.4 _reflns_shell.pdbx_redundancy 5.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1220 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1,2 # _refine.entry_id 1NJH _refine.ls_number_reflns_obs 22615 _refine.ls_number_reflns_all 22615 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 28.28 _refine.ls_d_res_high 1.70 _refine.ls_percent_reflns_obs 95.4 _refine.ls_R_factor_obs 0.223 _refine.ls_R_factor_all 0.223 _refine.ls_R_factor_R_work 0.22 _refine.ls_R_factor_R_free 0.253 _refine.ls_R_factor_R_free_error 0.007 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.3 _refine.ls_number_reflns_R_free 1215 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 31.7 _refine.aniso_B[1][1] -0.22 _refine.aniso_B[2][2] -0.22 _refine.aniso_B[3][3] 0.44 _refine.aniso_B[1][2] -0.73 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.402038 _refine.solvent_model_param_bsol 62.6261 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ;The number of reflections for refinement is greater than the number of reflections for data collection, because in CNS (hlml taget) refinement, the Friedel's pair was treated as two seperated reflections. ; _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1NJH _refine_analyze.Luzzati_coordinate_error_obs 0.21 _refine_analyze.Luzzati_sigma_a_obs 0.16 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.26 _refine_analyze.Luzzati_sigma_a_free 0.19 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 851 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 89 _refine_hist.number_atoms_total 950 _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 28.28 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 25.6 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.88 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 2.40 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 3.76 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 3.31 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 5.13 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.70 _refine_ls_shell.d_res_low 1.77 _refine_ls_shell.number_reflns_R_work 1655 _refine_ls_shell.R_factor_R_work 0.281 _refine_ls_shell.percent_reflns_obs 88.8 _refine_ls_shell.R_factor_R_free 0.359 _refine_ls_shell.R_factor_R_free_error 0.018 _refine_ls_shell.percent_reflns_R_free 9.5 _refine_ls_shell.number_reflns_R_free 221 _refine_ls_shell.number_reflns_obs 2264 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 3 ISP.PARAM ISP.TOP 'X-RAY DIFFRACTION' 4 GOL.PARAM GOL.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1NJH _struct.title 'Crystal Structure of Bacillus subtilis YojF protein' _struct.pdbx_descriptor 'protein yojF' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NJH _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text 'YojF, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ILE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 8 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 19 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ILE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 5 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 16 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ALA 3 C ? ? ? 1_555 A MSE 4 N ? ? A ALA 0 A MSE 1 1_555 ? ? ? ? ? ? ? 1.330 ? covale2 covale ? ? A MSE 4 C ? ? ? 1_555 A LYS 5 N ? ? A MSE 1 A LYS 2 1_555 ? ? ? ? ? ? ? 1.326 ? covale3 covale ? ? A MSE 44 C ? ? ? 1_555 A THR 45 N ? ? A MSE 41 A THR 42 1_555 ? ? ? ? ? ? ? 1.329 ? covale4 covale ? ? A LEU 96 C ? ? ? 1_555 A MSE 97 N ? ? A LEU 93 A MSE 94 1_555 ? ? ? ? ? ? ? 1.328 ? covale5 covale ? ? A MSE 97 C ? ? ? 1_555 A ALA 98 N ? ? A MSE 94 A ALA 95 1_555 ? ? ? ? ? ? ? 1.327 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 66 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 63 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 67 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 64 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.35 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 5 ? ALA A 6 ? LYS A 2 ALA A 3 A 2 GLU A 86 ? VAL A 89 ? GLU A 83 VAL A 86 A 3 LEU A 95 ? LEU A 101 ? LEU A 92 LEU A 98 A 4 LEU A 106 ? SER A 113 ? LEU A 103 SER A 110 A 5 VAL A 24 ? THR A 32 ? VAL A 21 THR A 29 A 6 THR A 45 ? VAL A 55 ? THR A 42 VAL A 52 B 1 TYR A 57 ? LYS A 63 ? TYR A 54 LYS A 60 B 2 TYR A 68 ? THR A 74 ? TYR A 65 THR A 71 B 3 TRP A 78 ? LEU A 84 ? TRP A 75 LEU A 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 5 ? N LYS A 2 O TYR A 87 ? O TYR A 84 A 2 3 N GLU A 86 ? N GLU A 83 O ALA A 98 ? O ALA A 95 A 3 4 N LEU A 101 ? N LEU A 98 O LEU A 106 ? O LEU A 103 A 4 5 O SER A 113 ? O SER A 110 N TYR A 25 ? N TYR A 22 A 5 6 N THR A 30 ? N THR A 27 O VAL A 47 ? O VAL A 44 B 1 2 N LYS A 63 ? N LYS A 60 O ARG A 69 ? O ARG A 66 B 2 3 N TYR A 68 ? N TYR A 65 O LEU A 84 ? O LEU A 81 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE IPA A 117' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL A 118' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 LYS A 9 ? LYS A 6 . ? 1_555 ? 2 AC1 3 GLY A 64 ? GLY A 61 . ? 1_555 ? 3 AC1 3 GOL C . ? GOL A 118 . ? 1_555 ? 4 AC2 4 GLY A 64 ? GLY A 61 . ? 1_555 ? 5 AC2 4 ASN A 65 ? ASN A 62 . ? 1_555 ? 6 AC2 4 ARG A 69 ? ARG A 66 . ? 1_555 ? 7 AC2 4 IPA B . ? IPA A 117 . ? 1_555 ? # _database_PDB_matrix.entry_id 1NJH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1NJH _atom_sites.fract_transf_matrix[1][1] 0.012706 _atom_sites.fract_transf_matrix[1][2] 0.007336 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014672 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.032181 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 -1 ASN ASN A . n A 1 3 ALA 3 0 0 ALA ALA A . n A 1 4 MSE 4 1 1 MSE MSE A . n A 1 5 LYS 5 2 2 LYS LYS A . n A 1 6 ALA 6 3 3 ALA ALA A . n A 1 7 ILE 7 4 4 ILE ILE A . n A 1 8 ILE 8 5 5 ILE ILE A . n A 1 9 LYS 9 6 6 LYS LYS A . n A 1 10 GLU 10 7 7 GLU GLU A . n A 1 11 ASP 11 8 8 ASP ASP A . n A 1 12 VAL 12 9 9 VAL VAL A . n A 1 13 GLN 13 10 10 GLN GLN A . n A 1 14 ALA 14 11 11 ALA ALA A . n A 1 15 SER 15 12 12 SER SER A . n A 1 16 LEU 16 13 13 LEU LEU A . n A 1 17 GLU 17 14 14 GLU GLU A . n A 1 18 ARG 18 15 15 ARG ARG A . n A 1 19 TYR 19 16 16 TYR TYR A . n A 1 20 ALA 20 17 17 ALA ALA A . n A 1 21 ASP 21 18 18 ASP ASP A . n A 1 22 ARG 22 19 19 ARG ARG A . n A 1 23 PRO 23 20 20 PRO PRO A . n A 1 24 VAL 24 21 21 VAL VAL A . n A 1 25 TYR 25 22 22 TYR TYR A . n A 1 26 ILE 26 23 23 ILE ILE A . n A 1 27 HIS 27 24 24 HIS HIS A . n A 1 28 LEU 28 25 25 LEU LEU A . n A 1 29 GLU 29 26 26 GLU GLU A . n A 1 30 THR 30 27 27 THR THR A . n A 1 31 THR 31 28 28 THR THR A . n A 1 32 THR 32 29 29 THR THR A . n A 1 33 GLY 33 30 30 GLY GLY A . n A 1 34 SER 34 31 ? ? ? A . n A 1 35 TYR 35 32 ? ? ? A . n A 1 36 SER 36 33 ? ? ? A . n A 1 37 ALA 37 34 ? ? ? A . n A 1 38 HIS 38 35 ? ? ? A . n A 1 39 LEU 39 36 ? ? ? A . n A 1 40 ASN 40 37 ? ? ? A . n A 1 41 GLU 41 38 ? ? ? A . n A 1 42 LYS 42 39 ? ? ? A . n A 1 43 ASN 43 40 ? ? ? A . n A 1 44 MSE 44 41 41 MSE MSE A . n A 1 45 THR 45 42 42 THR THR A . n A 1 46 VAL 46 43 43 VAL VAL A . n A 1 47 VAL 47 44 44 VAL VAL A . n A 1 48 ALA 48 45 45 ALA ALA A . n A 1 49 TYR 49 46 46 TYR TYR A . n A 1 50 ILE 50 47 47 ILE ILE A . n A 1 51 ARG 51 48 48 ARG ARG A . n A 1 52 ASN 52 49 49 ASN ASN A . n A 1 53 ALA 53 50 50 ALA ALA A . n A 1 54 LYS 54 51 51 LYS LYS A . n A 1 55 VAL 55 52 52 VAL VAL A . n A 1 56 THR 56 53 53 THR THR A . n A 1 57 TYR 57 54 54 TYR TYR A . n A 1 58 HIS 58 55 55 HIS HIS A . n A 1 59 GLN 59 56 56 GLN GLN A . n A 1 60 ALA 60 57 57 ALA ALA A . n A 1 61 LYS 61 58 58 LYS LYS A . n A 1 62 ILE 62 59 59 ILE ILE A . n A 1 63 LYS 63 60 60 LYS LYS A . n A 1 64 GLY 64 61 61 GLY GLY A . n A 1 65 ASN 65 62 62 ASN ASN A . n A 1 66 GLY 66 63 63 GLY GLY A . n A 1 67 PRO 67 64 64 PRO PRO A . n A 1 68 TYR 68 65 65 TYR TYR A . n A 1 69 ARG 69 66 66 ARG ARG A . n A 1 70 VAL 70 67 67 VAL VAL A . n A 1 71 GLY 71 68 68 GLY GLY A . n A 1 72 LEU 72 69 69 LEU LEU A . n A 1 73 LYS 73 70 70 LYS LYS A . n A 1 74 THR 74 71 71 THR THR A . n A 1 75 GLU 75 72 72 GLU GLU A . n A 1 76 GLU 76 73 73 GLU GLU A . n A 1 77 GLY 77 74 74 GLY GLY A . n A 1 78 TRP 78 75 75 TRP TRP A . n A 1 79 ILE 79 76 76 ILE ILE A . n A 1 80 TYR 80 77 77 TYR TYR A . n A 1 81 ALA 81 78 78 ALA ALA A . n A 1 82 GLU 82 79 79 GLU GLU A . n A 1 83 GLY 83 80 80 GLY GLY A . n A 1 84 LEU 84 81 81 LEU LEU A . n A 1 85 THR 85 82 82 THR THR A . n A 1 86 GLU 86 83 83 GLU GLU A . n A 1 87 TYR 87 84 84 TYR TYR A . n A 1 88 THR 88 85 85 THR THR A . n A 1 89 VAL 89 86 86 VAL VAL A . n A 1 90 ASP 90 87 87 ASP ASP A . n A 1 91 GLU 91 88 88 GLU GLU A . n A 1 92 GLU 92 89 89 GLU GLU A . n A 1 93 ASN 93 90 90 ASN ASN A . n A 1 94 ARG 94 91 91 ARG ARG A . n A 1 95 LEU 95 92 92 LEU LEU A . n A 1 96 LEU 96 93 93 LEU LEU A . n A 1 97 MSE 97 94 94 MSE MSE A . n A 1 98 ALA 98 95 95 ALA ALA A . n A 1 99 GLY 99 96 96 GLY GLY A . n A 1 100 HIS 100 97 97 HIS HIS A . n A 1 101 LEU 101 98 98 LEU LEU A . n A 1 102 PRO 102 99 99 PRO PRO A . n A 1 103 GLY 103 100 100 GLY GLY A . n A 1 104 GLY 104 101 101 GLY GLY A . n A 1 105 LYS 105 102 102 LYS LYS A . n A 1 106 LEU 106 103 103 LEU LEU A . n A 1 107 ALA 107 104 104 ALA ALA A . n A 1 108 ILE 108 105 105 ILE ILE A . n A 1 109 SER 109 106 106 SER SER A . n A 1 110 LEU 110 107 107 LEU LEU A . n A 1 111 GLN 111 108 108 GLN GLN A . n A 1 112 ILE 112 109 109 ILE ILE A . n A 1 113 SER 113 110 110 SER SER A . n A 1 114 GLU 114 111 111 GLU GLU A . n A 1 115 LYS 115 112 112 LYS LYS A . n A 1 116 PRO 116 113 113 PRO PRO A . n A 1 117 PHE 117 114 114 PHE PHE A . n A 1 118 THR 118 115 115 THR THR A . n A 1 119 VAL 119 116 116 VAL VAL A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 4 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 44 A MSE 41 ? MET SELENOMETHIONINE 3 A MSE 97 A MSE 94 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PQS dimeric 2 2 software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2 A,B,C,D 2 3 A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_556 -x,-x+y,-z+1 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 31.0740000000 3 'crystal symmetry operation' 1_554 x,y,z-1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 -31.0740000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 202 ? D HOH . 2 1 A HOH 207 ? D HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-07-01 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.0 ? 1 d*TREK 'data reduction' . ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 SOLVE phasing . ? 5 RESOLVE phasing . ? 6 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 206 ? ? 1_555 O A HOH 206 ? ? 4_556 1.08 2 1 O A HOH 189 ? ? 1_555 O A HOH 189 ? ? 2_665 1.60 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id THR _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 115 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -124.26 _pdbx_validate_torsion.psi -98.78 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A SER 31 ? A SER 34 3 1 Y 1 A TYR 32 ? A TYR 35 4 1 Y 1 A SER 33 ? A SER 36 5 1 Y 1 A ALA 34 ? A ALA 37 6 1 Y 1 A HIS 35 ? A HIS 38 7 1 Y 1 A LEU 36 ? A LEU 39 8 1 Y 1 A ASN 37 ? A ASN 40 9 1 Y 1 A GLU 38 ? A GLU 41 10 1 Y 1 A LYS 39 ? A LYS 42 11 1 Y 1 A ASN 40 ? A ASN 43 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ISOPROPYL ALCOHOL' IPA 3 GLYCEROL GOL 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IPA 1 117 1 IPA ISP A . C 3 GOL 1 118 2 GOL GOL A . D 4 HOH 1 119 1 HOH HOH A . D 4 HOH 2 120 2 HOH HOH A . D 4 HOH 3 121 3 HOH HOH A . D 4 HOH 4 122 4 HOH HOH A . D 4 HOH 5 123 5 HOH HOH A . D 4 HOH 6 124 6 HOH HOH A . D 4 HOH 7 125 7 HOH HOH A . D 4 HOH 8 126 8 HOH HOH A . D 4 HOH 9 127 9 HOH HOH A . D 4 HOH 10 128 10 HOH HOH A . D 4 HOH 11 129 11 HOH HOH A . D 4 HOH 12 130 12 HOH HOH A . D 4 HOH 13 131 13 HOH HOH A . D 4 HOH 14 132 14 HOH HOH A . D 4 HOH 15 133 15 HOH HOH A . D 4 HOH 16 134 16 HOH HOH A . D 4 HOH 17 135 17 HOH HOH A . D 4 HOH 18 136 18 HOH HOH A . D 4 HOH 19 137 19 HOH HOH A . D 4 HOH 20 138 20 HOH HOH A . D 4 HOH 21 139 21 HOH HOH A . D 4 HOH 22 140 22 HOH HOH A . D 4 HOH 23 141 23 HOH HOH A . D 4 HOH 24 142 24 HOH HOH A . D 4 HOH 25 143 25 HOH HOH A . D 4 HOH 26 144 26 HOH HOH A . D 4 HOH 27 145 27 HOH HOH A . D 4 HOH 28 146 28 HOH HOH A . D 4 HOH 29 147 29 HOH HOH A . D 4 HOH 30 148 30 HOH HOH A . D 4 HOH 31 149 31 HOH HOH A . D 4 HOH 32 150 32 HOH HOH A . D 4 HOH 33 151 33 HOH HOH A . D 4 HOH 34 152 34 HOH HOH A . D 4 HOH 35 153 35 HOH HOH A . D 4 HOH 36 154 36 HOH HOH A . D 4 HOH 37 155 37 HOH HOH A . D 4 HOH 38 156 38 HOH HOH A . D 4 HOH 39 157 39 HOH HOH A . D 4 HOH 40 158 40 HOH HOH A . D 4 HOH 41 159 41 HOH HOH A . D 4 HOH 42 160 42 HOH HOH A . D 4 HOH 43 161 43 HOH HOH A . D 4 HOH 44 162 44 HOH HOH A . D 4 HOH 45 163 45 HOH HOH A . D 4 HOH 46 164 46 HOH HOH A . D 4 HOH 47 165 47 HOH HOH A . D 4 HOH 48 166 48 HOH HOH A . D 4 HOH 49 167 49 HOH HOH A . D 4 HOH 50 168 50 HOH HOH A . D 4 HOH 51 169 51 HOH HOH A . D 4 HOH 52 170 52 HOH HOH A . D 4 HOH 53 171 53 HOH HOH A . D 4 HOH 54 172 54 HOH HOH A . D 4 HOH 55 173 55 HOH HOH A . D 4 HOH 56 174 56 HOH HOH A . D 4 HOH 57 175 57 HOH HOH A . D 4 HOH 58 176 58 HOH HOH A . D 4 HOH 59 177 59 HOH HOH A . D 4 HOH 60 178 60 HOH HOH A . D 4 HOH 61 179 61 HOH HOH A . D 4 HOH 62 180 62 HOH HOH A . D 4 HOH 63 181 63 HOH HOH A . D 4 HOH 64 182 64 HOH HOH A . D 4 HOH 65 183 65 HOH HOH A . D 4 HOH 66 184 66 HOH HOH A . D 4 HOH 67 185 67 HOH HOH A . D 4 HOH 68 186 68 HOH HOH A . D 4 HOH 69 187 69 HOH HOH A . D 4 HOH 70 188 70 HOH HOH A . D 4 HOH 71 189 71 HOH HOH A . D 4 HOH 72 190 72 HOH HOH A . D 4 HOH 73 191 73 HOH HOH A . D 4 HOH 74 192 74 HOH HOH A . D 4 HOH 75 193 75 HOH HOH A . D 4 HOH 76 194 76 HOH HOH A . D 4 HOH 77 195 77 HOH HOH A . D 4 HOH 78 196 78 HOH HOH A . D 4 HOH 79 197 79 HOH HOH A . D 4 HOH 80 198 80 HOH HOH A . D 4 HOH 81 199 81 HOH HOH A . D 4 HOH 82 200 82 HOH HOH A . D 4 HOH 83 201 83 HOH HOH A . D 4 HOH 84 202 84 HOH HOH A . D 4 HOH 85 203 85 HOH HOH A . D 4 HOH 86 204 86 HOH HOH A . D 4 HOH 87 205 87 HOH HOH A . D 4 HOH 88 206 88 HOH HOH A . D 4 HOH 89 207 89 HOH HOH A . #