data_1NLP # _entry.id 1NLP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1NLP pdb_00001nlp 10.2210/pdb1nlp/pdb WWPDB D_1000175328 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NLP _pdbx_database_status.recvd_initial_deposition_date 1996-08-04 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Feng, S.' 1 'Kapoor, T.M.' 2 'Shirai, F.' 3 'Combs, A.P.' 4 'Schreiber, S.L.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Molecular basis for the binding of SH3 ligands with non-peptide elements identified by combinatorial synthesis.' Chem.Biol. 3 661 670 1996 CBOLE2 UK 1074-5521 2050 ? 8807900 '10.1016/S1074-5521(96)90134-9' 1 'Protein Structure-Based Combinatorial Chemistry: Discovery of Non-Peptide Binding Elements to Src SH3 Domain' J.Am.Chem.Soc. 118 287 ? 1996 JACSAT US 0002-7863 0004 ? ? ? 2 'Specific Interactions Outside the Proline-Rich Core of Two Classes of Src Homology 3 Ligands' Proc.Natl.Acad.Sci.USA 92 12408 ? 1995 PNASA6 US 0027-8424 0040 ? ? ? 3 'Structural Basis for the Binding of Proline-Rich Peptides to SH3 Domains' 'Cell(Cambridge,Mass.)' 76 933 ? 1994 CELLB5 US 0092-8674 0998 ? ? ? 4 'Two Binding Orientations for Peptides to the Src SH3 Domain: Development of a General Model for SH3-Ligand Interactions' Science 266 1241 ? 1994 SCIEAS US 0036-8075 0038 ? ? ? 5 'Solution Structure of the SH3 Domain of Src and Identification of its Ligand-Binding Site' Science 258 1665 ? 1992 SCIEAS US 0036-8075 0038 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Feng, S.' 1 ? primary 'Kapoor, T.M.' 2 ? primary 'Shirai, F.' 3 ? primary 'Combs, A.P.' 4 ? primary 'Schreiber, S.L.' 5 ? 1 'Combs, A.P.' 6 ? 1 'Kapoor, T.M.' 7 ? 1 'Feng, S.' 8 ? 1 'Chen, J.K.' 9 ? 1 'Daude-Snow, L.F.' 10 ? 1 'Schreiber, S.L.' 11 ? 2 'Feng, S.' 12 ? 2 'Kasahara, C.' 13 ? 2 'Rickles, R.J.' 14 ? 2 'Schreiber, S.L.' 15 ? 3 'Yu, H.' 16 ? 3 'Chen, J.K.' 17 ? 3 'Feng, S.' 18 ? 3 'Dalgarno, D.C.' 19 ? 3 'Brauer, A.W.' 20 ? 3 'Schreiber, S.L.' 21 ? 4 'Feng, S.' 22 ? 4 'Chen, J.K.' 23 ? 4 'Yu, H.' 24 ? 4 'Simon, J.A.' 25 ? 4 'Schreiber, S.L.' 26 ? 5 'Yu, H.' 27 ? 5 'Rosen, M.K.' 28 ? 5 'Shin, T.B.' 29 ? 5 'Seidel-Dugan, C.' 30 ? 5 'Brugge, J.S.' 31 ? 5 'Schreiber, S.L.' 32 ? # _cell.entry_id 1NLP _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1NLP _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man C-SRC 7104.749 1 2.7.1.112 ? 'SH3 DOMAIN' ? 2 polymer man 'NL2 (MN8-MN1-PLPPLP)' 1052.353 1 ? ? ? 'LIGAND NL2 CONTAINS NON-PEPTIDE ELEMENTS' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GSHMGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS GSHMGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS C ? 2 'polypeptide(L)' no yes '(ACE)(MN8)(MN1)PLPPLP(NH2)' XXXPLPPLPX N ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLY n 1 6 GLY n 1 7 VAL n 1 8 THR n 1 9 THR n 1 10 PHE n 1 11 VAL n 1 12 ALA n 1 13 LEU n 1 14 TYR n 1 15 ASP n 1 16 TYR n 1 17 GLU n 1 18 SER n 1 19 ARG n 1 20 THR n 1 21 GLU n 1 22 THR n 1 23 ASP n 1 24 LEU n 1 25 SER n 1 26 PHE n 1 27 LYS n 1 28 LYS n 1 29 GLY n 1 30 GLU n 1 31 ARG n 1 32 LEU n 1 33 GLN n 1 34 ILE n 1 35 VAL n 1 36 ASN n 1 37 ASN n 1 38 THR n 1 39 GLU n 1 40 GLY n 1 41 ASP n 1 42 TRP n 1 43 TRP n 1 44 LEU n 1 45 ALA n 1 46 HIS n 1 47 SER n 1 48 LEU n 1 49 THR n 1 50 THR n 1 51 GLY n 1 52 GLN n 1 53 THR n 1 54 GLY n 1 55 TYR n 1 56 ILE n 1 57 PRO n 1 58 SER n 1 59 ASN n 1 60 TYR n 1 61 VAL n 1 62 ALA n 1 63 PRO n 1 64 SER n 2 1 ACE n 2 2 MN8 n 2 3 MN1 n 2 4 PRO n 2 5 LEU n 2 6 PRO n 2 7 PRO n 2 8 LEU n 2 9 PRO n 2 10 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name chicken _entity_src_gen.gene_src_genus Gallus _entity_src_gen.pdbx_gene_src_gene CHICKEN _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name GST-FUSION _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene CHICKEN _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX-2T _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_db_isoform 1 UNP SRC_AVISR 1 P00525 1 ;MGSSKSKPKDPSQRRCSLEPPDSTHHGGFPASQTPNKTAAPDTHRTPSRSFGTVATEPKLFGGFNTSDTVTSPQRAGALA GGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESER LLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHR LTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHE KLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVC KVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMGNGEVLDRVERGYR MPCPPECPESLHDLMCQCWRRDPEERPTFEYLQAQLLPACVLEVAE ; ? 2 PDB 1NLP 2 1NLP ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1NLP C 1 ? 64 ? P00525 77 ? 140 ? 1 64 2 2 1NLP N 1 ? 10 ? 1NLP 72 ? 81 ? 72 81 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1NLP SER C 2 ? UNP P00525 ALA 78 conflict 2 1 1 1NLP HIS C 3 ? UNP P00525 LEU 79 conflict 3 2 1 1NLP MET C 4 ? UNP P00525 ALA 80 conflict 4 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN1 non-polymer . 4-CARBOXYPIPERIDINE ? 'C6 H11 N O2' 129.157 MN8 non-polymer . '2-(4-CARCOXY-5-ISOPROPYLTHIAZOLYL)BENZOPIPERIDINE' ? 'C16 H18 N2 O2 S' 302.391 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1NLP _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'MINIMIZED AVERAGE' # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version 3.1 _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1NLP _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1NLP _struct.title 'STRUCTURE OF SIGNAL TRANSDUCTION PROTEIN, NMR, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NLP _struct_keywords.pdbx_keywords 'COMPLEX (TRANSFERASE/PEPTIDE)' _struct_keywords.text 'SRC, SH3 DOMAIN, LIGANDS, NON-PEPTIDE ELEMENTS, COMPLEX (TRANSFERASE-PEPTIDE), COMPLEX (TRANSFERASE-PEPTIDE) complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 58 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 60 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id C _struct_conf.beg_auth_seq_id 58 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id C _struct_conf.end_auth_seq_id 60 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? B ACE 1 C ? ? ? 1_555 B MN8 2 N11 ? ? N ACE 72 N MN8 73 1_555 ? ? ? ? ? ? ? 1.313 ? ? covale2 covale one ? B MN8 2 C1 ? ? ? 1_555 B MN1 3 N1 ? ? N MN8 73 N MN1 74 1_555 ? ? ? ? ? ? ? 1.318 ? ? covale3 covale both ? B MN1 3 C ? ? ? 1_555 B PRO 4 N ? ? N MN1 74 N PRO 75 1_555 ? ? ? ? ? ? ? 1.310 ? ? covale4 covale both ? B PRO 9 C ? ? ? 1_555 B NH2 10 N ? ? N PRO 80 N NH2 81 1_555 ? ? ? ? ? ? ? 1.305 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 52 ? PRO A 57 ? GLN C 52 PRO C 57 A 2 TRP A 42 ? SER A 47 ? TRP C 42 SER C 47 A 3 LEU A 32 ? ASN A 36 ? LEU C 32 ASN C 36 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 52 ? O GLN C 52 N SER A 47 ? N SER C 47 A 2 3 O LEU A 44 ? O LEU C 44 N ASN A 36 ? N ASN C 36 # _database_PDB_matrix.entry_id 1NLP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1NLP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? C . n A 1 2 SER 2 2 ? ? ? C . n A 1 3 HIS 3 3 ? ? ? C . n A 1 4 MET 4 4 ? ? ? C . n A 1 5 GLY 5 5 ? ? ? C . n A 1 6 GLY 6 6 ? ? ? C . n A 1 7 VAL 7 7 ? ? ? C . n A 1 8 THR 8 8 ? ? ? C . n A 1 9 THR 9 9 9 THR THR C . n A 1 10 PHE 10 10 10 PHE PHE C . n A 1 11 VAL 11 11 11 VAL VAL C . n A 1 12 ALA 12 12 12 ALA ALA C . n A 1 13 LEU 13 13 13 LEU LEU C . n A 1 14 TYR 14 14 14 TYR TYR C . n A 1 15 ASP 15 15 15 ASP ASP C . n A 1 16 TYR 16 16 16 TYR TYR C . n A 1 17 GLU 17 17 17 GLU GLU C . n A 1 18 SER 18 18 18 SER SER C . n A 1 19 ARG 19 19 19 ARG ARG C . n A 1 20 THR 20 20 20 THR THR C . n A 1 21 GLU 21 21 21 GLU GLU C . n A 1 22 THR 22 22 22 THR THR C . n A 1 23 ASP 23 23 23 ASP ASP C . n A 1 24 LEU 24 24 24 LEU LEU C . n A 1 25 SER 25 25 25 SER SER C . n A 1 26 PHE 26 26 26 PHE PHE C . n A 1 27 LYS 27 27 27 LYS LYS C . n A 1 28 LYS 28 28 28 LYS LYS C . n A 1 29 GLY 29 29 29 GLY GLY C . n A 1 30 GLU 30 30 30 GLU GLU C . n A 1 31 ARG 31 31 31 ARG ARG C . n A 1 32 LEU 32 32 32 LEU LEU C . n A 1 33 GLN 33 33 33 GLN GLN C . n A 1 34 ILE 34 34 34 ILE ILE C . n A 1 35 VAL 35 35 35 VAL VAL C . n A 1 36 ASN 36 36 36 ASN ASN C . n A 1 37 ASN 37 37 37 ASN ASN C . n A 1 38 THR 38 38 38 THR THR C . n A 1 39 GLU 39 39 39 GLU GLU C . n A 1 40 GLY 40 40 40 GLY GLY C . n A 1 41 ASP 41 41 41 ASP ASP C . n A 1 42 TRP 42 42 42 TRP TRP C . n A 1 43 TRP 43 43 43 TRP TRP C . n A 1 44 LEU 44 44 44 LEU LEU C . n A 1 45 ALA 45 45 45 ALA ALA C . n A 1 46 HIS 46 46 46 HIS HIS C . n A 1 47 SER 47 47 47 SER SER C . n A 1 48 LEU 48 48 48 LEU LEU C . n A 1 49 THR 49 49 49 THR THR C . n A 1 50 THR 50 50 50 THR THR C . n A 1 51 GLY 51 51 51 GLY GLY C . n A 1 52 GLN 52 52 52 GLN GLN C . n A 1 53 THR 53 53 53 THR THR C . n A 1 54 GLY 54 54 54 GLY GLY C . n A 1 55 TYR 55 55 55 TYR TYR C . n A 1 56 ILE 56 56 56 ILE ILE C . n A 1 57 PRO 57 57 57 PRO PRO C . n A 1 58 SER 58 58 58 SER SER C . n A 1 59 ASN 59 59 59 ASN ASN C . n A 1 60 TYR 60 60 60 TYR TYR C . n A 1 61 VAL 61 61 61 VAL VAL C . n A 1 62 ALA 62 62 62 ALA ALA C . n A 1 63 PRO 63 63 63 PRO PRO C . n A 1 64 SER 64 64 64 SER SER C . n B 2 1 ACE 1 72 72 ACE ACE N . n B 2 2 MN8 2 73 73 MN8 MN8 N . n B 2 3 MN1 3 74 74 MN1 MN1 N . n B 2 4 PRO 4 75 75 PRO PRO N . n B 2 5 LEU 5 76 76 LEU LEU N . n B 2 6 PRO 6 77 77 PRO PRO N . n B 2 7 PRO 7 78 78 PRO PRO N . n B 2 8 LEU 8 79 79 LEU LEU N . n B 2 9 PRO 9 80 80 PRO PRO N . n B 2 10 NH2 10 81 81 NH2 NH2 N . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-01-27 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 15 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU C 13 ? ? -38.76 -31.34 2 1 VAL C 35 ? ? -113.38 -74.78 3 1 TYR C 55 ? ? -50.15 174.75 4 1 LEU N 79 ? ? -43.00 150.85 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 C GLY 1 ? A GLY 1 2 1 Y 1 C SER 2 ? A SER 2 3 1 Y 1 C HIS 3 ? A HIS 3 4 1 Y 1 C MET 4 ? A MET 4 5 1 Y 1 C GLY 5 ? A GLY 5 6 1 Y 1 C GLY 6 ? A GLY 6 7 1 Y 1 C VAL 7 ? A VAL 7 8 1 Y 1 C THR 8 ? A THR 8 #