data_1NM7 # _entry.id 1NM7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1NM7 pdb_00001nm7 10.2210/pdb1nm7/pdb RCSB RCSB017999 ? ? WWPDB D_1000017999 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-03-04 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NM7 _pdbx_database_status.recvd_initial_deposition_date 2003-01-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1N5Z _pdbx_database_related.details '1N5Z contains complex structure of PEX13P SH3 domain with a peptide of PEX14P' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pires, J.R.' 1 'Hong, X.' 2 'Brockmann, C.' 3 'Volkmer-Engert, R.' 4 'Schneider-Mergener, J.' 5 'Oschkinat, H.' 6 'Erdmann, R.' 7 # _citation.id primary _citation.title 'The ScPex13p SH3 Domain Exposes Two Distinct Binding Sites for Pex5p and Pex14p' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 326 _citation.page_first 1427 _citation.page_last 1435 _citation.year 2003 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12595255 _citation.pdbx_database_id_DOI '10.1016/S0022-2836(03)00039-1' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pires, J.R.' 1 ? primary 'Hong, X.' 2 ? primary 'Brockmann, C.' 3 ? primary 'Volkmer-Engert, R.' 4 ? primary 'Schneider-Mergener, J.' 5 ? primary 'Oschkinat, H.' 6 ? primary 'Erdmann, R.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Peroxisomal Membrane Protein PAS20' _entity.formula_weight 8086.208 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Pex13p SH3 domain' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSHHHHHHFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIEII _entity_poly.pdbx_seq_one_letter_code_can GSHHHHHHFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIEII _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 PHE n 1 10 ALA n 1 11 ARG n 1 12 ALA n 1 13 LEU n 1 14 TYR n 1 15 ASP n 1 16 PHE n 1 17 VAL n 1 18 PRO n 1 19 GLU n 1 20 ASN n 1 21 PRO n 1 22 GLU n 1 23 MET n 1 24 GLU n 1 25 VAL n 1 26 ALA n 1 27 LEU n 1 28 LYS n 1 29 LYS n 1 30 GLY n 1 31 ASP n 1 32 LEU n 1 33 MET n 1 34 ALA n 1 35 ILE n 1 36 LEU n 1 37 SER n 1 38 LYS n 1 39 LYS n 1 40 ASP n 1 41 PRO n 1 42 LEU n 1 43 GLY n 1 44 ARG n 1 45 ASP n 1 46 SER n 1 47 ASP n 1 48 TRP n 1 49 TRP n 1 50 LYS n 1 51 VAL n 1 52 ARG n 1 53 THR n 1 54 LYS n 1 55 ASN n 1 56 GLY n 1 57 ASN n 1 58 ILE n 1 59 GLY n 1 60 TYR n 1 61 ILE n 1 62 PRO n 1 63 TYR n 1 64 ASN n 1 65 TYR n 1 66 ILE n 1 67 GLU n 1 68 ILE n 1 69 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21-DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-4T2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 302 ? ? ? A . n A 1 2 SER 2 303 ? ? ? A . n A 1 3 HIS 3 304 ? ? ? A . n A 1 4 HIS 4 305 ? ? ? A . n A 1 5 HIS 5 306 ? ? ? A . n A 1 6 HIS 6 307 ? ? ? A . n A 1 7 HIS 7 308 ? ? ? A . n A 1 8 HIS 8 309 ? ? ? A . n A 1 9 PHE 9 310 310 PHE PHE A . n A 1 10 ALA 10 311 311 ALA ALA A . n A 1 11 ARG 11 312 312 ARG ARG A . n A 1 12 ALA 12 313 313 ALA ALA A . n A 1 13 LEU 13 314 314 LEU LEU A . n A 1 14 TYR 14 315 315 TYR TYR A . n A 1 15 ASP 15 316 316 ASP ASP A . n A 1 16 PHE 16 317 317 PHE PHE A . n A 1 17 VAL 17 318 318 VAL VAL A . n A 1 18 PRO 18 319 319 PRO PRO A . n A 1 19 GLU 19 320 320 GLU GLU A . n A 1 20 ASN 20 321 321 ASN ASN A . n A 1 21 PRO 21 322 322 PRO PRO A . n A 1 22 GLU 22 323 323 GLU GLU A . n A 1 23 MET 23 324 324 MET MET A . n A 1 24 GLU 24 325 325 GLU GLU A . n A 1 25 VAL 25 326 326 VAL VAL A . n A 1 26 ALA 26 327 327 ALA ALA A . n A 1 27 LEU 27 328 328 LEU LEU A . n A 1 28 LYS 28 329 329 LYS LYS A . n A 1 29 LYS 29 330 330 LYS LYS A . n A 1 30 GLY 30 331 331 GLY GLY A . n A 1 31 ASP 31 332 332 ASP ASP A . n A 1 32 LEU 32 333 333 LEU LEU A . n A 1 33 MET 33 334 334 MET MET A . n A 1 34 ALA 34 335 335 ALA ALA A . n A 1 35 ILE 35 336 336 ILE ILE A . n A 1 36 LEU 36 337 337 LEU LEU A . n A 1 37 SER 37 338 338 SER SER A . n A 1 38 LYS 38 339 339 LYS LYS A . n A 1 39 LYS 39 340 340 LYS LYS A . n A 1 40 ASP 40 341 341 ASP ASP A . n A 1 41 PRO 41 342 342 PRO PRO A . n A 1 42 LEU 42 343 343 LEU LEU A . n A 1 43 GLY 43 344 344 GLY GLY A . n A 1 44 ARG 44 345 345 ARG ARG A . n A 1 45 ASP 45 346 346 ASP ASP A . n A 1 46 SER 46 347 347 SER SER A . n A 1 47 ASP 47 348 348 ASP ASP A . n A 1 48 TRP 48 349 349 TRP TRP A . n A 1 49 TRP 49 350 350 TRP TRP A . n A 1 50 LYS 50 351 351 LYS LYS A . n A 1 51 VAL 51 352 352 VAL VAL A . n A 1 52 ARG 52 353 353 ARG ARG A . n A 1 53 THR 53 354 354 THR THR A . n A 1 54 LYS 54 355 355 LYS LYS A . n A 1 55 ASN 55 356 356 ASN ASN A . n A 1 56 GLY 56 357 357 GLY GLY A . n A 1 57 ASN 57 358 358 ASN ASN A . n A 1 58 ILE 58 359 359 ILE ILE A . n A 1 59 GLY 59 360 360 GLY GLY A . n A 1 60 TYR 60 361 361 TYR TYR A . n A 1 61 ILE 61 362 362 ILE ILE A . n A 1 62 PRO 62 363 363 PRO PRO A . n A 1 63 TYR 63 364 364 TYR TYR A . n A 1 64 ASN 64 365 365 ASN ASN A . n A 1 65 TYR 65 366 366 TYR TYR A . n A 1 66 ILE 66 367 367 ILE ILE A . n A 1 67 GLU 67 368 368 GLU GLU A . n A 1 68 ILE 68 369 369 ILE ILE A . n A 1 69 ILE 69 370 370 ILE ILE A . n # _exptl.entry_id 1NM7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1NM7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1NM7 _struct.title 'Solution structure of the ScPex13p SH3 domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NM7 _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' _struct_keywords.text 'Yeast, Membrane protein, Pex5p, Pex14p, Pex13p, import machine, SH3 domain, PROTEIN TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PEX13_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code FARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIEII _struct_ref.pdbx_align_begin 310 _struct_ref.pdbx_db_accession P80667 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NM7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 69 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P80667 _struct_ref_seq.db_align_beg 310 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 370 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 310 _struct_ref_seq.pdbx_auth_seq_align_end 370 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1NM7 GLY A 1 ? UNP P80667 ? ? 'expression tag' 302 1 1 1NM7 SER A 2 ? UNP P80667 ? ? 'expression tag' 303 2 1 1NM7 HIS A 3 ? UNP P80667 ? ? 'expression tag' 304 3 1 1NM7 HIS A 4 ? UNP P80667 ? ? 'expression tag' 305 4 1 1NM7 HIS A 5 ? UNP P80667 ? ? 'expression tag' 306 5 1 1NM7 HIS A 6 ? UNP P80667 ? ? 'expression tag' 307 6 1 1NM7 HIS A 7 ? UNP P80667 ? ? 'expression tag' 308 7 1 1NM7 HIS A 8 ? UNP P80667 ? ? 'expression tag' 309 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 62 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 64 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 363 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 365 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 57 ? ILE A 61 ? ASN A 358 ILE A 362 A 2 TRP A 49 ? THR A 53 ? TRP A 350 THR A 354 A 3 LEU A 32 ? ILE A 35 ? LEU A 333 ILE A 336 A 4 ALA A 10 ? ALA A 12 ? ALA A 311 ALA A 313 A 5 ILE A 66 ? ILE A 68 ? ILE A 367 ILE A 369 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASN A 57 ? O ASN A 358 N THR A 53 ? N THR A 354 A 2 3 O ARG A 52 ? O ARG A 353 N ALA A 34 ? N ALA A 335 A 3 4 O MET A 33 ? O MET A 334 N ALA A 10 ? N ALA A 311 A 4 5 N ARG A 11 ? N ARG A 312 O GLU A 67 ? O GLU A 368 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HA A PRO 319 ? ? HB3 A GLU 325 ? ? 1.34 2 2 HB3 A ASP 348 ? ? HB3 A TYR 364 ? ? 1.31 3 3 HB3 A ASP 348 ? ? HB3 A TYR 364 ? ? 1.30 4 5 HB3 A MET 334 ? ? HG23 A VAL 352 ? ? 1.33 5 6 HB3 A ASP 348 ? ? HB3 A TYR 364 ? ? 1.32 6 7 HB3 A ASP 348 ? ? HB3 A TYR 364 ? ? 1.32 7 10 HB3 A ASP 348 ? ? HB3 A TYR 364 ? ? 1.26 8 10 HA A PRO 319 ? ? HB3 A GLU 325 ? ? 1.32 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 314 ? ? -76.06 -70.14 2 1 ASP A 316 ? ? -54.04 105.85 3 1 PRO A 319 ? ? -43.45 106.29 4 1 PRO A 322 ? ? -75.04 40.86 5 1 GLU A 323 ? ? -130.70 -43.75 6 1 MET A 324 ? ? -164.57 102.12 7 1 LYS A 330 ? ? -10.75 105.74 8 1 ASP A 332 ? ? -58.53 -172.40 9 1 LEU A 337 ? ? -121.88 -59.97 10 1 LYS A 339 ? ? -126.63 -120.68 11 1 ASP A 341 ? ? 104.86 -63.49 12 1 PRO A 342 ? ? -92.15 -77.09 13 1 ARG A 345 ? ? -80.76 -154.15 14 1 SER A 347 ? ? 167.84 161.01 15 1 TRP A 349 ? ? -167.56 104.55 16 1 ILE A 362 ? ? -175.63 118.25 17 2 ASP A 316 ? ? -47.84 107.67 18 2 PRO A 319 ? ? -37.51 103.03 19 2 PRO A 322 ? ? -74.82 37.90 20 2 GLU A 323 ? ? -130.29 -39.35 21 2 MET A 324 ? ? -165.88 101.74 22 2 LYS A 330 ? ? -22.96 114.92 23 2 ASP A 332 ? ? -56.49 176.14 24 2 LEU A 337 ? ? -131.49 -43.79 25 2 LYS A 339 ? ? -133.73 -117.57 26 2 ASP A 341 ? ? 109.39 -59.04 27 2 PRO A 342 ? ? -85.40 -71.98 28 2 LEU A 343 ? ? -91.08 -71.06 29 2 ARG A 345 ? ? -77.85 -128.58 30 2 ASP A 346 ? ? -100.93 -141.38 31 2 SER A 347 ? ? 65.95 150.45 32 2 TRP A 349 ? ? -161.55 113.37 33 2 ILE A 362 ? ? -178.92 121.63 34 3 ASP A 316 ? ? -53.46 109.90 35 3 PRO A 319 ? ? -38.02 103.11 36 3 PRO A 322 ? ? -74.44 46.28 37 3 GLU A 323 ? ? -133.01 -44.79 38 3 LYS A 330 ? ? -24.02 129.74 39 3 ASP A 332 ? ? -58.13 172.08 40 3 LYS A 339 ? ? -132.12 -119.66 41 3 ASP A 341 ? ? 108.45 -60.81 42 3 LEU A 343 ? ? -94.34 -75.43 43 3 ARG A 345 ? ? -75.49 -123.17 44 3 ASP A 346 ? ? -105.54 -144.35 45 3 SER A 347 ? ? 65.58 151.75 46 4 PRO A 319 ? ? -38.70 103.67 47 4 PRO A 322 ? ? -75.06 38.61 48 4 MET A 324 ? ? -165.33 101.06 49 4 LYS A 330 ? ? 28.69 -96.95 50 4 LYS A 339 ? ? -129.75 -117.17 51 4 ASP A 341 ? ? 108.25 -59.40 52 4 PRO A 342 ? ? -89.28 -83.70 53 4 ARG A 345 ? ? -79.29 -121.14 54 4 ASP A 346 ? ? -108.67 -147.59 55 4 SER A 347 ? ? 67.53 151.37 56 4 ILE A 362 ? ? -178.66 119.85 57 5 ASP A 316 ? ? -53.22 108.55 58 5 PRO A 319 ? ? -47.93 98.98 59 5 PRO A 322 ? ? -74.39 39.83 60 5 GLU A 323 ? ? -130.66 -38.26 61 5 MET A 324 ? ? -162.17 101.20 62 5 LYS A 330 ? ? -16.87 112.92 63 5 ASP A 332 ? ? -61.31 -174.17 64 5 LEU A 337 ? ? -130.57 -78.84 65 5 SER A 338 ? ? -53.82 174.02 66 5 LYS A 339 ? ? -129.18 -119.29 67 5 ASP A 341 ? ? 103.00 -64.23 68 5 PRO A 342 ? ? -94.07 -82.77 69 5 ARG A 345 ? ? -86.93 -150.61 70 5 SER A 347 ? ? 163.87 160.64 71 5 TRP A 349 ? ? -167.20 112.97 72 5 LYS A 355 ? ? 48.32 26.00 73 5 ASN A 365 ? ? 174.19 -35.92 74 6 ASP A 316 ? ? -50.21 107.59 75 6 PRO A 319 ? ? -47.74 98.81 76 6 PRO A 322 ? ? -75.40 40.88 77 6 GLU A 323 ? ? -134.56 -40.60 78 6 MET A 324 ? ? -160.25 100.46 79 6 LYS A 330 ? ? 25.08 -95.49 80 6 LYS A 339 ? ? -123.26 -121.32 81 6 ASP A 341 ? ? 107.73 -61.72 82 6 PRO A 342 ? ? -80.91 -75.98 83 6 ARG A 345 ? ? -98.30 -126.15 84 6 SER A 347 ? ? 78.90 152.25 85 6 ILE A 362 ? ? 178.75 131.11 86 7 LEU A 314 ? ? -72.69 -77.82 87 7 ASP A 316 ? ? -53.35 105.44 88 7 PRO A 319 ? ? -49.15 103.19 89 7 PRO A 322 ? ? -75.05 42.50 90 7 GLU A 323 ? ? -131.99 -35.09 91 7 MET A 324 ? ? -165.27 100.30 92 7 LYS A 330 ? ? -15.70 118.38 93 7 ASP A 332 ? ? -59.83 -176.34 94 7 LEU A 337 ? ? -121.84 -72.18 95 7 LYS A 339 ? ? -117.97 -121.07 96 7 ASP A 341 ? ? 76.02 -178.66 97 7 PRO A 342 ? ? -26.18 -46.74 98 7 ARG A 345 ? ? -103.70 -156.20 99 7 SER A 347 ? ? 166.31 156.60 100 7 TRP A 349 ? ? -165.13 107.75 101 7 LYS A 355 ? ? 49.35 21.08 102 7 ILE A 362 ? ? -175.35 119.25 103 8 GLU A 323 ? ? -137.24 -37.79 104 8 MET A 324 ? ? -165.57 99.90 105 8 LYS A 330 ? ? -16.57 118.45 106 8 LEU A 337 ? ? -120.97 -69.96 107 8 LYS A 339 ? ? -129.00 -114.39 108 8 ASP A 341 ? ? 93.18 -77.10 109 8 ARG A 345 ? ? -68.63 -119.63 110 8 ASP A 346 ? ? -120.62 -109.65 111 8 SER A 347 ? ? 56.58 158.83 112 8 TRP A 349 ? ? -167.28 108.39 113 8 ILE A 362 ? ? -171.51 118.55 114 8 ASN A 365 ? ? -176.28 -41.07 115 9 ASP A 316 ? ? -52.96 105.88 116 9 PRO A 319 ? ? -38.67 100.97 117 9 PRO A 322 ? ? -76.03 42.86 118 9 GLU A 323 ? ? -131.92 -44.38 119 9 LYS A 330 ? ? -13.46 121.15 120 9 LYS A 339 ? ? -107.41 -136.16 121 9 ASP A 341 ? ? 103.62 -63.56 122 9 PRO A 342 ? ? -96.02 -88.23 123 9 ARG A 345 ? ? -69.59 -156.41 124 9 SER A 347 ? ? -48.79 161.80 125 9 LYS A 355 ? ? 47.66 26.66 126 9 ILE A 362 ? ? -174.80 122.02 127 9 ASN A 365 ? ? 173.02 -36.61 128 10 TYR A 315 ? ? 76.76 108.82 129 10 ASP A 316 ? ? -39.70 114.05 130 10 PRO A 319 ? ? -38.59 97.16 131 10 PRO A 322 ? ? -75.58 40.59 132 10 GLU A 323 ? ? -137.45 -41.50 133 10 MET A 324 ? ? -161.19 101.46 134 10 LYS A 330 ? ? -19.92 116.66 135 10 ASP A 332 ? ? -58.46 173.21 136 10 LEU A 337 ? ? -128.69 -74.35 137 10 LYS A 339 ? ? -137.67 -116.74 138 10 ASP A 341 ? ? 115.41 -56.64 139 10 LEU A 343 ? ? -111.02 -80.88 140 10 ARG A 345 ? ? -92.65 -109.64 141 10 ASP A 346 ? ? 19.17 -139.58 142 10 LYS A 355 ? ? 49.35 21.47 143 10 ILE A 362 ? ? -172.14 128.39 144 10 TYR A 364 ? ? -63.22 91.55 145 10 ASN A 365 ? ? -177.79 -34.15 # _pdbx_nmr_ensemble.entry_id 1NM7 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1NM7 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.7mM [U-15N,13C] Pex13p SH3 domain, 20mM Phosphate Buffer, pH 6.0, 50mM NaCl' '100% D2O' 2 '0.7mM [U-15N] Pex13p SH3 domain, 20mM Phosphate Buffer, pH 6.0, 50mM NaCl' '90% H2O/10% D2O' 3 '0.7mM Unlabeled Pex13p SH3 domain, 20mM Phosphate Buffer, pH 6.0, 50mM NaCl' '90% H2O/10% D2O' 4 '0.7mM Unlabeled Pex13p SH3 domain, 20mM Phosphate Buffer, pH 6.0, 50mM NaCl' '100% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 2 1 3D_15N-separated_NOESY 3 3 1 '2D NOESY' 4 4 1 '2D NOESY' # _pdbx_nmr_refine.entry_id 1NM7 _pdbx_nmr_refine.method 'AMBIGUOUS DISTANCE RESTRAINTS SIMULATED ANNEALING WITH TORSION ANGLE DYNAMICS AS IMPLEMENTED IN ARIA1.0' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR ? processing Bruker 1 Sparky 3.106 'data analysis' ? 2 ARIA 1.0 'structure solution' ;J.P.Linge, S.I.O'Donoghue, M.Nilges ; 3 CNS 1.0 'structure solution' ? 4 CNS 1.0 refinement ? 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 302 ? A GLY 1 2 1 Y 1 A SER 303 ? A SER 2 3 1 Y 1 A HIS 304 ? A HIS 3 4 1 Y 1 A HIS 305 ? A HIS 4 5 1 Y 1 A HIS 306 ? A HIS 5 6 1 Y 1 A HIS 307 ? A HIS 6 7 1 Y 1 A HIS 308 ? A HIS 7 8 1 Y 1 A HIS 309 ? A HIS 8 9 2 Y 1 A GLY 302 ? A GLY 1 10 2 Y 1 A SER 303 ? A SER 2 11 2 Y 1 A HIS 304 ? A HIS 3 12 2 Y 1 A HIS 305 ? A HIS 4 13 2 Y 1 A HIS 306 ? A HIS 5 14 2 Y 1 A HIS 307 ? A HIS 6 15 2 Y 1 A HIS 308 ? A HIS 7 16 2 Y 1 A HIS 309 ? A HIS 8 17 3 Y 1 A GLY 302 ? A GLY 1 18 3 Y 1 A SER 303 ? A SER 2 19 3 Y 1 A HIS 304 ? A HIS 3 20 3 Y 1 A HIS 305 ? A HIS 4 21 3 Y 1 A HIS 306 ? A HIS 5 22 3 Y 1 A HIS 307 ? A HIS 6 23 3 Y 1 A HIS 308 ? A HIS 7 24 3 Y 1 A HIS 309 ? A HIS 8 25 4 Y 1 A GLY 302 ? A GLY 1 26 4 Y 1 A SER 303 ? A SER 2 27 4 Y 1 A HIS 304 ? A HIS 3 28 4 Y 1 A HIS 305 ? A HIS 4 29 4 Y 1 A HIS 306 ? A HIS 5 30 4 Y 1 A HIS 307 ? A HIS 6 31 4 Y 1 A HIS 308 ? A HIS 7 32 4 Y 1 A HIS 309 ? A HIS 8 33 5 Y 1 A GLY 302 ? A GLY 1 34 5 Y 1 A SER 303 ? A SER 2 35 5 Y 1 A HIS 304 ? A HIS 3 36 5 Y 1 A HIS 305 ? A HIS 4 37 5 Y 1 A HIS 306 ? A HIS 5 38 5 Y 1 A HIS 307 ? A HIS 6 39 5 Y 1 A HIS 308 ? A HIS 7 40 5 Y 1 A HIS 309 ? A HIS 8 41 6 Y 1 A GLY 302 ? A GLY 1 42 6 Y 1 A SER 303 ? A SER 2 43 6 Y 1 A HIS 304 ? A HIS 3 44 6 Y 1 A HIS 305 ? A HIS 4 45 6 Y 1 A HIS 306 ? A HIS 5 46 6 Y 1 A HIS 307 ? A HIS 6 47 6 Y 1 A HIS 308 ? A HIS 7 48 6 Y 1 A HIS 309 ? A HIS 8 49 7 Y 1 A GLY 302 ? A GLY 1 50 7 Y 1 A SER 303 ? A SER 2 51 7 Y 1 A HIS 304 ? A HIS 3 52 7 Y 1 A HIS 305 ? A HIS 4 53 7 Y 1 A HIS 306 ? A HIS 5 54 7 Y 1 A HIS 307 ? A HIS 6 55 7 Y 1 A HIS 308 ? A HIS 7 56 7 Y 1 A HIS 309 ? A HIS 8 57 8 Y 1 A GLY 302 ? A GLY 1 58 8 Y 1 A SER 303 ? A SER 2 59 8 Y 1 A HIS 304 ? A HIS 3 60 8 Y 1 A HIS 305 ? A HIS 4 61 8 Y 1 A HIS 306 ? A HIS 5 62 8 Y 1 A HIS 307 ? A HIS 6 63 8 Y 1 A HIS 308 ? A HIS 7 64 8 Y 1 A HIS 309 ? A HIS 8 65 9 Y 1 A GLY 302 ? A GLY 1 66 9 Y 1 A SER 303 ? A SER 2 67 9 Y 1 A HIS 304 ? A HIS 3 68 9 Y 1 A HIS 305 ? A HIS 4 69 9 Y 1 A HIS 306 ? A HIS 5 70 9 Y 1 A HIS 307 ? A HIS 6 71 9 Y 1 A HIS 308 ? A HIS 7 72 9 Y 1 A HIS 309 ? A HIS 8 73 10 Y 1 A GLY 302 ? A GLY 1 74 10 Y 1 A SER 303 ? A SER 2 75 10 Y 1 A HIS 304 ? A HIS 3 76 10 Y 1 A HIS 305 ? A HIS 4 77 10 Y 1 A HIS 306 ? A HIS 5 78 10 Y 1 A HIS 307 ? A HIS 6 79 10 Y 1 A HIS 308 ? A HIS 7 80 10 Y 1 A HIS 309 ? A HIS 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLU N N N N 74 GLU CA C N S 75 GLU C C N N 76 GLU O O N N 77 GLU CB C N N 78 GLU CG C N N 79 GLU CD C N N 80 GLU OE1 O N N 81 GLU OE2 O N N 82 GLU OXT O N N 83 GLU H H N N 84 GLU H2 H N N 85 GLU HA H N N 86 GLU HB2 H N N 87 GLU HB3 H N N 88 GLU HG2 H N N 89 GLU HG3 H N N 90 GLU HE2 H N N 91 GLU HXT H N N 92 GLY N N N N 93 GLY CA C N N 94 GLY C C N N 95 GLY O O N N 96 GLY OXT O N N 97 GLY H H N N 98 GLY H2 H N N 99 GLY HA2 H N N 100 GLY HA3 H N N 101 GLY HXT H N N 102 HIS N N N N 103 HIS CA C N S 104 HIS C C N N 105 HIS O O N N 106 HIS CB C N N 107 HIS CG C Y N 108 HIS ND1 N Y N 109 HIS CD2 C Y N 110 HIS CE1 C Y N 111 HIS NE2 N Y N 112 HIS OXT O N N 113 HIS H H N N 114 HIS H2 H N N 115 HIS HA H N N 116 HIS HB2 H N N 117 HIS HB3 H N N 118 HIS HD1 H N N 119 HIS HD2 H N N 120 HIS HE1 H N N 121 HIS HE2 H N N 122 HIS HXT H N N 123 ILE N N N N 124 ILE CA C N S 125 ILE C C N N 126 ILE O O N N 127 ILE CB C N S 128 ILE CG1 C N N 129 ILE CG2 C N N 130 ILE CD1 C N N 131 ILE OXT O N N 132 ILE H H N N 133 ILE H2 H N N 134 ILE HA H N N 135 ILE HB H N N 136 ILE HG12 H N N 137 ILE HG13 H N N 138 ILE HG21 H N N 139 ILE HG22 H N N 140 ILE HG23 H N N 141 ILE HD11 H N N 142 ILE HD12 H N N 143 ILE HD13 H N N 144 ILE HXT H N N 145 LEU N N N N 146 LEU CA C N S 147 LEU C C N N 148 LEU O O N N 149 LEU CB C N N 150 LEU CG C N N 151 LEU CD1 C N N 152 LEU CD2 C N N 153 LEU OXT O N N 154 LEU H H N N 155 LEU H2 H N N 156 LEU HA H N N 157 LEU HB2 H N N 158 LEU HB3 H N N 159 LEU HG H N N 160 LEU HD11 H N N 161 LEU HD12 H N N 162 LEU HD13 H N N 163 LEU HD21 H N N 164 LEU HD22 H N N 165 LEU HD23 H N N 166 LEU HXT H N N 167 LYS N N N N 168 LYS CA C N S 169 LYS C C N N 170 LYS O O N N 171 LYS CB C N N 172 LYS CG C N N 173 LYS CD C N N 174 LYS CE C N N 175 LYS NZ N N N 176 LYS OXT O N N 177 LYS H H N N 178 LYS H2 H N N 179 LYS HA H N N 180 LYS HB2 H N N 181 LYS HB3 H N N 182 LYS HG2 H N N 183 LYS HG3 H N N 184 LYS HD2 H N N 185 LYS HD3 H N N 186 LYS HE2 H N N 187 LYS HE3 H N N 188 LYS HZ1 H N N 189 LYS HZ2 H N N 190 LYS HZ3 H N N 191 LYS HXT H N N 192 MET N N N N 193 MET CA C N S 194 MET C C N N 195 MET O O N N 196 MET CB C N N 197 MET CG C N N 198 MET SD S N N 199 MET CE C N N 200 MET OXT O N N 201 MET H H N N 202 MET H2 H N N 203 MET HA H N N 204 MET HB2 H N N 205 MET HB3 H N N 206 MET HG2 H N N 207 MET HG3 H N N 208 MET HE1 H N N 209 MET HE2 H N N 210 MET HE3 H N N 211 MET HXT H N N 212 PHE N N N N 213 PHE CA C N S 214 PHE C C N N 215 PHE O O N N 216 PHE CB C N N 217 PHE CG C Y N 218 PHE CD1 C Y N 219 PHE CD2 C Y N 220 PHE CE1 C Y N 221 PHE CE2 C Y N 222 PHE CZ C Y N 223 PHE OXT O N N 224 PHE H H N N 225 PHE H2 H N N 226 PHE HA H N N 227 PHE HB2 H N N 228 PHE HB3 H N N 229 PHE HD1 H N N 230 PHE HD2 H N N 231 PHE HE1 H N N 232 PHE HE2 H N N 233 PHE HZ H N N 234 PHE HXT H N N 235 PRO N N N N 236 PRO CA C N S 237 PRO C C N N 238 PRO O O N N 239 PRO CB C N N 240 PRO CG C N N 241 PRO CD C N N 242 PRO OXT O N N 243 PRO H H N N 244 PRO HA H N N 245 PRO HB2 H N N 246 PRO HB3 H N N 247 PRO HG2 H N N 248 PRO HG3 H N N 249 PRO HD2 H N N 250 PRO HD3 H N N 251 PRO HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 TRP N N N N 284 TRP CA C N S 285 TRP C C N N 286 TRP O O N N 287 TRP CB C N N 288 TRP CG C Y N 289 TRP CD1 C Y N 290 TRP CD2 C Y N 291 TRP NE1 N Y N 292 TRP CE2 C Y N 293 TRP CE3 C Y N 294 TRP CZ2 C Y N 295 TRP CZ3 C Y N 296 TRP CH2 C Y N 297 TRP OXT O N N 298 TRP H H N N 299 TRP H2 H N N 300 TRP HA H N N 301 TRP HB2 H N N 302 TRP HB3 H N N 303 TRP HD1 H N N 304 TRP HE1 H N N 305 TRP HE3 H N N 306 TRP HZ2 H N N 307 TRP HZ3 H N N 308 TRP HH2 H N N 309 TRP HXT H N N 310 TYR N N N N 311 TYR CA C N S 312 TYR C C N N 313 TYR O O N N 314 TYR CB C N N 315 TYR CG C Y N 316 TYR CD1 C Y N 317 TYR CD2 C Y N 318 TYR CE1 C Y N 319 TYR CE2 C Y N 320 TYR CZ C Y N 321 TYR OH O N N 322 TYR OXT O N N 323 TYR H H N N 324 TYR H2 H N N 325 TYR HA H N N 326 TYR HB2 H N N 327 TYR HB3 H N N 328 TYR HD1 H N N 329 TYR HD2 H N N 330 TYR HE1 H N N 331 TYR HE2 H N N 332 TYR HH H N N 333 TYR HXT H N N 334 VAL N N N N 335 VAL CA C N S 336 VAL C C N N 337 VAL O O N N 338 VAL CB C N N 339 VAL CG1 C N N 340 VAL CG2 C N N 341 VAL OXT O N N 342 VAL H H N N 343 VAL H2 H N N 344 VAL HA H N N 345 VAL HB H N N 346 VAL HG11 H N N 347 VAL HG12 H N N 348 VAL HG13 H N N 349 VAL HG21 H N N 350 VAL HG22 H N N 351 VAL HG23 H N N 352 VAL HXT H N N 353 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLU N CA sing N N 70 GLU N H sing N N 71 GLU N H2 sing N N 72 GLU CA C sing N N 73 GLU CA CB sing N N 74 GLU CA HA sing N N 75 GLU C O doub N N 76 GLU C OXT sing N N 77 GLU CB CG sing N N 78 GLU CB HB2 sing N N 79 GLU CB HB3 sing N N 80 GLU CG CD sing N N 81 GLU CG HG2 sing N N 82 GLU CG HG3 sing N N 83 GLU CD OE1 doub N N 84 GLU CD OE2 sing N N 85 GLU OE2 HE2 sing N N 86 GLU OXT HXT sing N N 87 GLY N CA sing N N 88 GLY N H sing N N 89 GLY N H2 sing N N 90 GLY CA C sing N N 91 GLY CA HA2 sing N N 92 GLY CA HA3 sing N N 93 GLY C O doub N N 94 GLY C OXT sing N N 95 GLY OXT HXT sing N N 96 HIS N CA sing N N 97 HIS N H sing N N 98 HIS N H2 sing N N 99 HIS CA C sing N N 100 HIS CA CB sing N N 101 HIS CA HA sing N N 102 HIS C O doub N N 103 HIS C OXT sing N N 104 HIS CB CG sing N N 105 HIS CB HB2 sing N N 106 HIS CB HB3 sing N N 107 HIS CG ND1 sing Y N 108 HIS CG CD2 doub Y N 109 HIS ND1 CE1 doub Y N 110 HIS ND1 HD1 sing N N 111 HIS CD2 NE2 sing Y N 112 HIS CD2 HD2 sing N N 113 HIS CE1 NE2 sing Y N 114 HIS CE1 HE1 sing N N 115 HIS NE2 HE2 sing N N 116 HIS OXT HXT sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 PRO N CA sing N N 226 PRO N CD sing N N 227 PRO N H sing N N 228 PRO CA C sing N N 229 PRO CA CB sing N N 230 PRO CA HA sing N N 231 PRO C O doub N N 232 PRO C OXT sing N N 233 PRO CB CG sing N N 234 PRO CB HB2 sing N N 235 PRO CB HB3 sing N N 236 PRO CG CD sing N N 237 PRO CG HG2 sing N N 238 PRO CG HG3 sing N N 239 PRO CD HD2 sing N N 240 PRO CD HD3 sing N N 241 PRO OXT HXT sing N N 242 SER N CA sing N N 243 SER N H sing N N 244 SER N H2 sing N N 245 SER CA C sing N N 246 SER CA CB sing N N 247 SER CA HA sing N N 248 SER C O doub N N 249 SER C OXT sing N N 250 SER CB OG sing N N 251 SER CB HB2 sing N N 252 SER CB HB3 sing N N 253 SER OG HG sing N N 254 SER OXT HXT sing N N 255 THR N CA sing N N 256 THR N H sing N N 257 THR N H2 sing N N 258 THR CA C sing N N 259 THR CA CB sing N N 260 THR CA HA sing N N 261 THR C O doub N N 262 THR C OXT sing N N 263 THR CB OG1 sing N N 264 THR CB CG2 sing N N 265 THR CB HB sing N N 266 THR OG1 HG1 sing N N 267 THR CG2 HG21 sing N N 268 THR CG2 HG22 sing N N 269 THR CG2 HG23 sing N N 270 THR OXT HXT sing N N 271 TRP N CA sing N N 272 TRP N H sing N N 273 TRP N H2 sing N N 274 TRP CA C sing N N 275 TRP CA CB sing N N 276 TRP CA HA sing N N 277 TRP C O doub N N 278 TRP C OXT sing N N 279 TRP CB CG sing N N 280 TRP CB HB2 sing N N 281 TRP CB HB3 sing N N 282 TRP CG CD1 doub Y N 283 TRP CG CD2 sing Y N 284 TRP CD1 NE1 sing Y N 285 TRP CD1 HD1 sing N N 286 TRP CD2 CE2 doub Y N 287 TRP CD2 CE3 sing Y N 288 TRP NE1 CE2 sing Y N 289 TRP NE1 HE1 sing N N 290 TRP CE2 CZ2 sing Y N 291 TRP CE3 CZ3 doub Y N 292 TRP CE3 HE3 sing N N 293 TRP CZ2 CH2 doub Y N 294 TRP CZ2 HZ2 sing N N 295 TRP CZ3 CH2 sing Y N 296 TRP CZ3 HZ3 sing N N 297 TRP CH2 HH2 sing N N 298 TRP OXT HXT sing N N 299 TYR N CA sing N N 300 TYR N H sing N N 301 TYR N H2 sing N N 302 TYR CA C sing N N 303 TYR CA CB sing N N 304 TYR CA HA sing N N 305 TYR C O doub N N 306 TYR C OXT sing N N 307 TYR CB CG sing N N 308 TYR CB HB2 sing N N 309 TYR CB HB3 sing N N 310 TYR CG CD1 doub Y N 311 TYR CG CD2 sing Y N 312 TYR CD1 CE1 sing Y N 313 TYR CD1 HD1 sing N N 314 TYR CD2 CE2 doub Y N 315 TYR CD2 HD2 sing N N 316 TYR CE1 CZ doub Y N 317 TYR CE1 HE1 sing N N 318 TYR CE2 CZ sing Y N 319 TYR CE2 HE2 sing N N 320 TYR CZ OH sing N N 321 TYR OH HH sing N N 322 TYR OXT HXT sing N N 323 VAL N CA sing N N 324 VAL N H sing N N 325 VAL N H2 sing N N 326 VAL CA C sing N N 327 VAL CA CB sing N N 328 VAL CA HA sing N N 329 VAL C O doub N N 330 VAL C OXT sing N N 331 VAL CB CG1 sing N N 332 VAL CB CG2 sing N N 333 VAL CB HB sing N N 334 VAL CG1 HG11 sing N N 335 VAL CG1 HG12 sing N N 336 VAL CG1 HG13 sing N N 337 VAL CG2 HG21 sing N N 338 VAL CG2 HG22 sing N N 339 VAL CG2 HG23 sing N N 340 VAL OXT HXT sing N N 341 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1NM7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_