data_1NN0 # _entry.id 1NN0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1NN0 pdb_00001nn0 10.2210/pdb1nn0/pdb RCSB RCSB018021 ? ? WWPDB D_1000018021 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NN0 _pdbx_database_status.recvd_initial_deposition_date 2003-01-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ostermann, N.' 1 'Segura-Pena, D.' 2 'Meier, C.' 3 'Veit, T.' 4 'Monnerjahn, M.' 5 'Konrad, M.' 6 'Lavie, A.' 7 # _citation.id primary _citation.title ;Structures of human thymidylate kinase in complex with prodrugs: implications for the structure-based design of novel compounds ; _citation.journal_abbrev Biochemistry _citation.journal_volume 42 _citation.page_first 2568 _citation.page_last 2577 _citation.year 2003 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12614151 _citation.pdbx_database_id_DOI 10.1021/bi027302t # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ostermann, N.' 1 ? primary 'Segura-Pena, D.' 2 ? primary 'Meier, C.' 3 ? primary 'Veit, T.' 4 ? primary 'Monnerjahn, M.' 5 ? primary 'Konrad, M.' 6 ? primary 'Lavie, A.' 7 ? # _cell.entry_id 1NN0 _cell.length_a 100.535 _cell.length_b 100.535 _cell.length_c 49.963 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1NN0 _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thymidylate kinase' 24052.533 1 2.7.4.9 R200A ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 3 non-polymer syn "3'-DEOXYTHYMIDINE-5'-MONOPHOSPHATE" 306.209 1 ? ? ? ? 4 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201 1 ? ? ? ? 5 water nat water 18.015 305 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'dTMP kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRW EQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQ ERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGELWK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRW EQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQ ERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGELWK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 ALA n 1 7 ARG n 1 8 ARG n 1 9 GLY n 1 10 ALA n 1 11 LEU n 1 12 ILE n 1 13 VAL n 1 14 LEU n 1 15 GLU n 1 16 GLY n 1 17 VAL n 1 18 ASP n 1 19 ARG n 1 20 ALA n 1 21 GLY n 1 22 LYS n 1 23 SER n 1 24 THR n 1 25 GLN n 1 26 SER n 1 27 ARG n 1 28 LYS n 1 29 LEU n 1 30 VAL n 1 31 GLU n 1 32 ALA n 1 33 LEU n 1 34 CYS n 1 35 ALA n 1 36 ALA n 1 37 GLY n 1 38 HIS n 1 39 ARG n 1 40 ALA n 1 41 GLU n 1 42 LEU n 1 43 LEU n 1 44 ARG n 1 45 PHE n 1 46 PRO n 1 47 GLU n 1 48 ARG n 1 49 SER n 1 50 THR n 1 51 GLU n 1 52 ILE n 1 53 GLY n 1 54 LYS n 1 55 LEU n 1 56 LEU n 1 57 SER n 1 58 SER n 1 59 TYR n 1 60 LEU n 1 61 GLN n 1 62 LYS n 1 63 LYS n 1 64 SER n 1 65 ASP n 1 66 VAL n 1 67 GLU n 1 68 ASP n 1 69 HIS n 1 70 SER n 1 71 VAL n 1 72 HIS n 1 73 LEU n 1 74 LEU n 1 75 PHE n 1 76 SER n 1 77 ALA n 1 78 ASN n 1 79 ARG n 1 80 TRP n 1 81 GLU n 1 82 GLN n 1 83 VAL n 1 84 PRO n 1 85 LEU n 1 86 ILE n 1 87 LYS n 1 88 GLU n 1 89 LYS n 1 90 LEU n 1 91 SER n 1 92 GLN n 1 93 GLY n 1 94 VAL n 1 95 THR n 1 96 LEU n 1 97 VAL n 1 98 VAL n 1 99 ASP n 1 100 ARG n 1 101 TYR n 1 102 ALA n 1 103 PHE n 1 104 SER n 1 105 GLY n 1 106 VAL n 1 107 ALA n 1 108 PHE n 1 109 THR n 1 110 GLY n 1 111 ALA n 1 112 LYS n 1 113 GLU n 1 114 ASN n 1 115 PHE n 1 116 SER n 1 117 LEU n 1 118 ASP n 1 119 TRP n 1 120 CYS n 1 121 LYS n 1 122 GLN n 1 123 PRO n 1 124 ASP n 1 125 VAL n 1 126 GLY n 1 127 LEU n 1 128 PRO n 1 129 LYS n 1 130 PRO n 1 131 ASP n 1 132 LEU n 1 133 VAL n 1 134 LEU n 1 135 PHE n 1 136 LEU n 1 137 GLN n 1 138 LEU n 1 139 GLN n 1 140 LEU n 1 141 ALA n 1 142 ASP n 1 143 ALA n 1 144 ALA n 1 145 LYS n 1 146 ARG n 1 147 GLY n 1 148 ALA n 1 149 PHE n 1 150 GLY n 1 151 HIS n 1 152 GLU n 1 153 ARG n 1 154 TYR n 1 155 GLU n 1 156 ASN n 1 157 GLY n 1 158 ALA n 1 159 PHE n 1 160 GLN n 1 161 GLU n 1 162 ARG n 1 163 ALA n 1 164 LEU n 1 165 ARG n 1 166 CYS n 1 167 PHE n 1 168 HIS n 1 169 GLN n 1 170 LEU n 1 171 MET n 1 172 LYS n 1 173 ASP n 1 174 THR n 1 175 THR n 1 176 LEU n 1 177 ASN n 1 178 TRP n 1 179 LYS n 1 180 MET n 1 181 VAL n 1 182 ASP n 1 183 ALA n 1 184 SER n 1 185 LYS n 1 186 SER n 1 187 ILE n 1 188 GLU n 1 189 ALA n 1 190 VAL n 1 191 HIS n 1 192 GLU n 1 193 ASP n 1 194 ILE n 1 195 ARG n 1 196 VAL n 1 197 LEU n 1 198 SER n 1 199 GLU n 1 200 ASP n 1 201 ALA n 1 202 ILE n 1 203 ALA n 1 204 THR n 1 205 ALA n 1 206 THR n 1 207 GLU n 1 208 LYS n 1 209 PRO n 1 210 LEU n 1 211 GLY n 1 212 GLU n 1 213 LEU n 1 214 TRP n 1 215 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'DTYMK OR TYMK OR TMPK OR CDC8' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DTYMK_HUMAN _struct_ref.pdbx_db_accession P23919 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQV PLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERA LRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGELWK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NN0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 215 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P23919 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 212 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 212 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1NN0 GLY A 1 ? UNP P23919 ? ? 'cloning artifact' -2 1 1 1NN0 SER A 2 ? UNP P23919 ? ? 'cloning artifact' -1 2 1 1NN0 HIS A 3 ? UNP P23919 ? ? 'cloning artifact' 0 3 1 1NN0 ALA A 203 ? UNP P23919 ARG 200 'engineered mutation' 200 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2DT 'DNA linking' n "3'-DEOXYTHYMIDINE-5'-MONOPHOSPHATE" "2',3'-DIDEOXYTHYMIDINE-5'-MONOPHOSPHATE" 'C10 H15 N2 O7 P' 306.209 ADP non-polymer n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1NN0 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.26 _exptl_crystal.density_percent_sol 45.12 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_details '15-20% PEG 3350, 100 mM Tris/HCl, pH 8.0, 5% filtered dead sea water, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9887 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID2' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9887 # _reflns.entry_id 1NN0 _reflns.number_all ? _reflns.number_obs 35723 _reflns.percent_possible_obs 96.4 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 1.55 _reflns.d_resolution_low 70.7 _reflns.pdbx_Rmerge_I_obs 0.073 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 7.24 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.55 _reflns_shell.d_res_low 1.60 _reflns_shell.percent_possible_all 96.4 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.364 _reflns_shell.meanI_over_sigI_obs 1.32 _reflns_shell.pdbx_redundancy 2.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1NN0 _refine.ls_d_res_high 1.6 _refine.ls_d_res_low 50.3 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 119378 _refine.ls_number_reflns_obs 35723 _refine.ls_number_reflns_R_free 3235 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_work 0.211 _refine.ls_R_factor_R_free 0.265 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1641 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 49 _refine_hist.number_atoms_solvent 305 _refine_hist.number_atoms_total 1995 _refine_hist.d_res_high 1.6 _refine_hist.d_res_low 50.3 # _struct.entry_id 1NN0 _struct.title 'Crystal structure of human thymidylate kinase with ddTMP and ADP' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NN0 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'thymidylate kinase, p-loop, dideoxythymidine, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 21 ? ALA A 36 ? GLY A 18 ALA A 33 1 ? 16 HELX_P HELX_P2 2 THR A 50 ? GLN A 61 ? THR A 47 GLN A 58 1 ? 12 HELX_P HELX_P3 3 GLU A 67 ? GLU A 81 ? GLU A 64 GLU A 78 1 ? 15 HELX_P HELX_P4 4 GLN A 82 ? GLN A 92 ? GLN A 79 GLN A 89 1 ? 11 HELX_P HELX_P5 5 TYR A 101 ? ALA A 111 ? TYR A 98 ALA A 108 1 ? 11 HELX_P HELX_P6 6 SER A 116 ? GLN A 122 ? SER A 113 GLN A 119 1 ? 7 HELX_P HELX_P7 7 PRO A 123 ? VAL A 125 ? PRO A 120 VAL A 122 5 ? 3 HELX_P HELX_P8 9 ASN A 156 ? LYS A 172 ? ASN A 153 LYS A 169 1 ? 17 HELX_P HELX_P9 10 SER A 186 ? THR A 204 ? SER A 183 THR A 201 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A SER 23 OG ? ? ? 1_555 B MG . MG ? ? A SER 20 A MG 401 1_555 ? ? ? ? ? ? ? 2.157 ? ? metalc2 metalc ? ? E ADP . O2B ? ? ? 1_555 B MG . MG ? ? A ADP 302 A MG 401 1_555 ? ? ? ? ? ? ? 1.975 ? ? metalc3 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 401 A HOH 505 1_555 ? ? ? ? ? ? ? 2.135 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 401 A HOH 506 1_555 ? ? ? ? ? ? ? 2.116 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 401 A HOH 507 1_555 ? ? ? ? ? ? ? 2.219 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 401 A HOH 753 1_555 ? ? ? ? ? ? ? 2.187 ? ? metalc7 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 756 1_555 ? ? ? ? ? ? ? 2.072 ? ? metalc8 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 756 8_665 ? ? ? ? ? ? ? 1.919 ? ? metalc9 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 761 1_555 ? ? ? ? ? ? ? 2.086 ? ? metalc10 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 761 8_665 ? ? ? ? ? ? ? 2.694 ? ? metalc11 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 771 1_555 ? ? ? ? ? ? ? 2.103 ? ? metalc12 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 771 8_665 ? ? ? ? ? ? ? 2.199 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 45 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 42 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 46 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 43 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.11 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 40 ? ARG A 44 ? ALA A 37 ARG A 41 A 2 THR A 95 ? ASP A 99 ? THR A 92 ASP A 96 A 3 LEU A 11 ? GLY A 16 ? LEU A 8 GLY A 13 A 4 LEU A 132 ? GLN A 137 ? LEU A 129 GLN A 134 A 5 TRP A 178 ? ASP A 182 ? TRP A 175 ASP A 179 B 1 PRO A 128 ? LYS A 129 ? PRO A 125 LYS A 126 B 2 GLY A 211 ? GLU A 212 ? GLY A 208 GLU A 209 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 43 ? N LEU A 40 O VAL A 97 ? O VAL A 94 A 2 3 O LEU A 96 ? O LEU A 93 N ILE A 12 ? N ILE A 9 A 3 4 N GLU A 15 ? N GLU A 12 O LEU A 134 ? O LEU A 131 A 4 5 N PHE A 135 ? N PHE A 132 O VAL A 181 ? O VAL A 178 B 1 2 N LYS A 129 ? N LYS A 126 O GLY A 211 ? O GLY A 208 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 401 ? 6 'BINDING SITE FOR RESIDUE MG A 401' AC2 Software A MG 402 ? 6 'BINDING SITE FOR RESIDUE MG A 402' AC3 Software A 2DT 301 ? 17 'BINDING SITE FOR RESIDUE 2DT A 301' AC4 Software A ADP 302 ? 23 'BINDING SITE FOR RESIDUE ADP A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 SER A 23 ? SER A 20 . ? 1_555 ? 2 AC1 6 ADP E . ? ADP A 302 . ? 1_555 ? 3 AC1 6 HOH F . ? HOH A 505 . ? 1_555 ? 4 AC1 6 HOH F . ? HOH A 506 . ? 1_555 ? 5 AC1 6 HOH F . ? HOH A 507 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 753 . ? 1_555 ? 7 AC2 6 HOH F . ? HOH A 756 . ? 1_555 ? 8 AC2 6 HOH F . ? HOH A 756 . ? 8_665 ? 9 AC2 6 HOH F . ? HOH A 761 . ? 1_555 ? 10 AC2 6 HOH F . ? HOH A 761 . ? 8_665 ? 11 AC2 6 HOH F . ? HOH A 771 . ? 1_555 ? 12 AC2 6 HOH F . ? HOH A 771 . ? 8_665 ? 13 AC3 17 PHE A 45 ? PHE A 42 . ? 1_555 ? 14 AC3 17 LEU A 60 ? LEU A 57 . ? 1_555 ? 15 AC3 17 PHE A 75 ? PHE A 72 . ? 1_555 ? 16 AC3 17 ARG A 79 ? ARG A 76 . ? 1_555 ? 17 AC3 17 ARG A 100 ? ARG A 97 . ? 1_555 ? 18 AC3 17 GLY A 105 ? GLY A 102 . ? 1_555 ? 19 AC3 17 PHE A 108 ? PHE A 105 . ? 1_555 ? 20 AC3 17 TYR A 154 ? TYR A 151 . ? 1_555 ? 21 AC3 17 HOH F . ? HOH A 505 . ? 1_555 ? 22 AC3 17 HOH F . ? HOH A 507 . ? 1_555 ? 23 AC3 17 HOH F . ? HOH A 513 . ? 1_555 ? 24 AC3 17 HOH F . ? HOH A 537 . ? 1_555 ? 25 AC3 17 HOH F . ? HOH A 607 . ? 1_555 ? 26 AC3 17 HOH F . ? HOH A 753 . ? 1_555 ? 27 AC3 17 HOH F . ? HOH A 757 . ? 1_555 ? 28 AC3 17 HOH F . ? HOH A 781 . ? 1_555 ? 29 AC3 17 HOH F . ? HOH A 797 . ? 1_555 ? 30 AC4 23 ARG A 19 ? ARG A 16 . ? 1_555 ? 31 AC4 23 ALA A 20 ? ALA A 17 . ? 1_555 ? 32 AC4 23 GLY A 21 ? GLY A 18 . ? 1_555 ? 33 AC4 23 LYS A 22 ? LYS A 19 . ? 1_555 ? 34 AC4 23 SER A 23 ? SER A 20 . ? 1_555 ? 35 AC4 23 THR A 24 ? THR A 21 . ? 1_555 ? 36 AC4 23 ARG A 146 ? ARG A 143 . ? 1_555 ? 37 AC4 23 LYS A 185 ? LYS A 182 . ? 1_555 ? 38 AC4 23 SER A 186 ? SER A 183 . ? 1_555 ? 39 AC4 23 ILE A 187 ? ILE A 184 . ? 1_555 ? 40 AC4 23 ARG A 195 ? ARG A 192 . ? 4_455 ? 41 AC4 23 MG B . ? MG A 401 . ? 1_555 ? 42 AC4 23 HOH F . ? HOH A 506 . ? 1_555 ? 43 AC4 23 HOH F . ? HOH A 507 . ? 1_555 ? 44 AC4 23 HOH F . ? HOH A 508 . ? 1_555 ? 45 AC4 23 HOH F . ? HOH A 522 . ? 1_555 ? 46 AC4 23 HOH F . ? HOH A 549 . ? 1_555 ? 47 AC4 23 HOH F . ? HOH A 556 . ? 1_555 ? 48 AC4 23 HOH F . ? HOH A 564 . ? 1_555 ? 49 AC4 23 HOH F . ? HOH A 645 . ? 1_555 ? 50 AC4 23 HOH F . ? HOH A 686 . ? 1_555 ? 51 AC4 23 HOH F . ? HOH A 754 . ? 1_555 ? 52 AC4 23 HOH F . ? HOH A 765 . ? 1_555 ? # _database_PDB_matrix.entry_id 1NN0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1NN0 _atom_sites.fract_transf_matrix[1][1] 0.009947 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009947 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020015 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 ALA 5 2 ? ? ? A . n A 1 6 ALA 6 3 ? ? ? A . n A 1 7 ARG 7 4 4 ARG ARG A . n A 1 8 ARG 8 5 5 ARG ARG A . n A 1 9 GLY 9 6 6 GLY GLY A . n A 1 10 ALA 10 7 7 ALA ALA A . n A 1 11 LEU 11 8 8 LEU LEU A . n A 1 12 ILE 12 9 9 ILE ILE A . n A 1 13 VAL 13 10 10 VAL VAL A . n A 1 14 LEU 14 11 11 LEU LEU A . n A 1 15 GLU 15 12 12 GLU GLU A . n A 1 16 GLY 16 13 13 GLY GLY A . n A 1 17 VAL 17 14 14 VAL VAL A . n A 1 18 ASP 18 15 15 ASP ASP A . n A 1 19 ARG 19 16 16 ARG ARG A . n A 1 20 ALA 20 17 17 ALA ALA A . n A 1 21 GLY 21 18 18 GLY GLY A . n A 1 22 LYS 22 19 19 LYS LYS A . n A 1 23 SER 23 20 20 SER SER A . n A 1 24 THR 24 21 21 THR THR A . n A 1 25 GLN 25 22 22 GLN GLN A . n A 1 26 SER 26 23 23 SER SER A . n A 1 27 ARG 27 24 24 ARG ARG A . n A 1 28 LYS 28 25 25 LYS LYS A . n A 1 29 LEU 29 26 26 LEU LEU A . n A 1 30 VAL 30 27 27 VAL VAL A . n A 1 31 GLU 31 28 28 GLU GLU A . n A 1 32 ALA 32 29 29 ALA ALA A . n A 1 33 LEU 33 30 30 LEU LEU A . n A 1 34 CYS 34 31 31 CYS CYS A . n A 1 35 ALA 35 32 32 ALA ALA A . n A 1 36 ALA 36 33 33 ALA ALA A . n A 1 37 GLY 37 34 34 GLY GLY A . n A 1 38 HIS 38 35 35 HIS HIS A . n A 1 39 ARG 39 36 36 ARG ARG A . n A 1 40 ALA 40 37 37 ALA ALA A . n A 1 41 GLU 41 38 38 GLU GLU A . n A 1 42 LEU 42 39 39 LEU LEU A . n A 1 43 LEU 43 40 40 LEU LEU A . n A 1 44 ARG 44 41 41 ARG ARG A . n A 1 45 PHE 45 42 42 PHE PHE A . n A 1 46 PRO 46 43 43 PRO PRO A . n A 1 47 GLU 47 44 44 GLU GLU A . n A 1 48 ARG 48 45 45 ARG ARG A . n A 1 49 SER 49 46 46 SER SER A . n A 1 50 THR 50 47 47 THR THR A . n A 1 51 GLU 51 48 48 GLU GLU A . n A 1 52 ILE 52 49 49 ILE ILE A . n A 1 53 GLY 53 50 50 GLY GLY A . n A 1 54 LYS 54 51 51 LYS LYS A . n A 1 55 LEU 55 52 52 LEU LEU A . n A 1 56 LEU 56 53 53 LEU LEU A . n A 1 57 SER 57 54 54 SER SER A . n A 1 58 SER 58 55 55 SER SER A . n A 1 59 TYR 59 56 56 TYR TYR A . n A 1 60 LEU 60 57 57 LEU LEU A . n A 1 61 GLN 61 58 58 GLN GLN A . n A 1 62 LYS 62 59 59 LYS LYS A . n A 1 63 LYS 63 60 60 LYS LYS A . n A 1 64 SER 64 61 61 SER SER A . n A 1 65 ASP 65 62 62 ASP ASP A . n A 1 66 VAL 66 63 63 VAL VAL A . n A 1 67 GLU 67 64 64 GLU GLU A . n A 1 68 ASP 68 65 65 ASP ASP A . n A 1 69 HIS 69 66 66 HIS HIS A . n A 1 70 SER 70 67 67 SER SER A . n A 1 71 VAL 71 68 68 VAL VAL A . n A 1 72 HIS 72 69 69 HIS HIS A . n A 1 73 LEU 73 70 70 LEU LEU A . n A 1 74 LEU 74 71 71 LEU LEU A . n A 1 75 PHE 75 72 72 PHE PHE A . n A 1 76 SER 76 73 73 SER SER A . n A 1 77 ALA 77 74 74 ALA ALA A . n A 1 78 ASN 78 75 75 ASN ASN A . n A 1 79 ARG 79 76 76 ARG ARG A . n A 1 80 TRP 80 77 77 TRP TRP A . n A 1 81 GLU 81 78 78 GLU GLU A . n A 1 82 GLN 82 79 79 GLN GLN A . n A 1 83 VAL 83 80 80 VAL VAL A . n A 1 84 PRO 84 81 81 PRO PRO A . n A 1 85 LEU 85 82 82 LEU LEU A . n A 1 86 ILE 86 83 83 ILE ILE A . n A 1 87 LYS 87 84 84 LYS LYS A . n A 1 88 GLU 88 85 85 GLU GLU A . n A 1 89 LYS 89 86 86 LYS LYS A . n A 1 90 LEU 90 87 87 LEU LEU A . n A 1 91 SER 91 88 88 SER SER A . n A 1 92 GLN 92 89 89 GLN GLN A . n A 1 93 GLY 93 90 90 GLY GLY A . n A 1 94 VAL 94 91 91 VAL VAL A . n A 1 95 THR 95 92 92 THR THR A . n A 1 96 LEU 96 93 93 LEU LEU A . n A 1 97 VAL 97 94 94 VAL VAL A . n A 1 98 VAL 98 95 95 VAL VAL A . n A 1 99 ASP 99 96 96 ASP ASP A . n A 1 100 ARG 100 97 97 ARG ARG A . n A 1 101 TYR 101 98 98 TYR TYR A . n A 1 102 ALA 102 99 99 ALA ALA A . n A 1 103 PHE 103 100 100 PHE PHE A . n A 1 104 SER 104 101 101 SER SER A . n A 1 105 GLY 105 102 102 GLY GLY A . n A 1 106 VAL 106 103 103 VAL VAL A . n A 1 107 ALA 107 104 104 ALA ALA A . n A 1 108 PHE 108 105 105 PHE PHE A . n A 1 109 THR 109 106 106 THR THR A . n A 1 110 GLY 110 107 107 GLY GLY A . n A 1 111 ALA 111 108 108 ALA ALA A . n A 1 112 LYS 112 109 109 LYS LYS A . n A 1 113 GLU 113 110 110 GLU GLU A . n A 1 114 ASN 114 111 111 ASN ASN A . n A 1 115 PHE 115 112 112 PHE PHE A . n A 1 116 SER 116 113 113 SER SER A . n A 1 117 LEU 117 114 114 LEU LEU A . n A 1 118 ASP 118 115 115 ASP ASP A . n A 1 119 TRP 119 116 116 TRP TRP A . n A 1 120 CYS 120 117 117 CYS CYS A . n A 1 121 LYS 121 118 118 LYS LYS A . n A 1 122 GLN 122 119 119 GLN GLN A . n A 1 123 PRO 123 120 120 PRO PRO A . n A 1 124 ASP 124 121 121 ASP ASP A . n A 1 125 VAL 125 122 122 VAL VAL A . n A 1 126 GLY 126 123 123 GLY GLY A . n A 1 127 LEU 127 124 124 LEU LEU A . n A 1 128 PRO 128 125 125 PRO PRO A . n A 1 129 LYS 129 126 126 LYS LYS A . n A 1 130 PRO 130 127 127 PRO PRO A . n A 1 131 ASP 131 128 128 ASP ASP A . n A 1 132 LEU 132 129 129 LEU LEU A . n A 1 133 VAL 133 130 130 VAL VAL A . n A 1 134 LEU 134 131 131 LEU LEU A . n A 1 135 PHE 135 132 132 PHE PHE A . n A 1 136 LEU 136 133 133 LEU LEU A . n A 1 137 GLN 137 134 134 GLN GLN A . n A 1 138 LEU 138 135 135 LEU LEU A . n A 1 139 GLN 139 136 136 GLN GLN A . n A 1 140 LEU 140 137 137 LEU LEU A . n A 1 141 ALA 141 138 138 ALA ALA A . n A 1 142 ASP 142 139 139 ASP ASP A . n A 1 143 ALA 143 140 140 ALA ALA A . n A 1 144 ALA 144 141 141 ALA ALA A . n A 1 145 LYS 145 142 142 LYS ALA A . n A 1 146 ARG 146 143 143 ARG ARG A . n A 1 147 GLY 147 144 144 GLY GLY A . n A 1 148 ALA 148 145 145 ALA ALA A . n A 1 149 PHE 149 146 146 PHE PHE A . n A 1 150 GLY 150 147 147 GLY GLY A . n A 1 151 HIS 151 148 148 HIS ALA A . n A 1 152 GLU 152 149 149 GLU GLU A . n A 1 153 ARG 153 150 150 ARG ARG A . n A 1 154 TYR 154 151 151 TYR TYR A . n A 1 155 GLU 155 152 152 GLU GLU A . n A 1 156 ASN 156 153 153 ASN ASN A . n A 1 157 GLY 157 154 154 GLY GLY A . n A 1 158 ALA 158 155 155 ALA ALA A . n A 1 159 PHE 159 156 156 PHE PHE A . n A 1 160 GLN 160 157 157 GLN GLN A . n A 1 161 GLU 161 158 158 GLU GLU A . n A 1 162 ARG 162 159 159 ARG ARG A . n A 1 163 ALA 163 160 160 ALA ALA A . n A 1 164 LEU 164 161 161 LEU LEU A . n A 1 165 ARG 165 162 162 ARG ARG A . n A 1 166 CYS 166 163 163 CYS CYS A . n A 1 167 PHE 167 164 164 PHE PHE A . n A 1 168 HIS 168 165 165 HIS HIS A . n A 1 169 GLN 169 166 166 GLN GLN A . n A 1 170 LEU 170 167 167 LEU LEU A . n A 1 171 MET 171 168 168 MET MET A . n A 1 172 LYS 172 169 169 LYS LYS A . n A 1 173 ASP 173 170 170 ASP ASP A . n A 1 174 THR 174 171 171 THR THR A . n A 1 175 THR 175 172 172 THR THR A . n A 1 176 LEU 176 173 173 LEU LEU A . n A 1 177 ASN 177 174 174 ASN ASN A . n A 1 178 TRP 178 175 175 TRP TRP A . n A 1 179 LYS 179 176 176 LYS LYS A . n A 1 180 MET 180 177 177 MET MET A . n A 1 181 VAL 181 178 178 VAL VAL A . n A 1 182 ASP 182 179 179 ASP ASP A . n A 1 183 ALA 183 180 180 ALA ALA A . n A 1 184 SER 184 181 181 SER SER A . n A 1 185 LYS 185 182 182 LYS LYS A . n A 1 186 SER 186 183 183 SER SER A . n A 1 187 ILE 187 184 184 ILE ILE A . n A 1 188 GLU 188 185 185 GLU GLU A . n A 1 189 ALA 189 186 186 ALA ALA A . n A 1 190 VAL 190 187 187 VAL VAL A . n A 1 191 HIS 191 188 188 HIS HIS A . n A 1 192 GLU 192 189 189 GLU GLU A . n A 1 193 ASP 193 190 190 ASP ASP A . n A 1 194 ILE 194 191 191 ILE ILE A . n A 1 195 ARG 195 192 192 ARG ARG A . n A 1 196 VAL 196 193 193 VAL VAL A . n A 1 197 LEU 197 194 194 LEU LEU A . n A 1 198 SER 198 195 195 SER SER A . n A 1 199 GLU 199 196 196 GLU GLU A . n A 1 200 ASP 200 197 197 ASP ASP A . n A 1 201 ALA 201 198 198 ALA ALA A . n A 1 202 ILE 202 199 199 ILE ILE A . n A 1 203 ALA 203 200 200 ALA ALA A . n A 1 204 THR 204 201 201 THR THR A . n A 1 205 ALA 205 202 202 ALA ALA A . n A 1 206 THR 206 203 203 THR THR A . n A 1 207 GLU 207 204 204 GLU GLU A . n A 1 208 LYS 208 205 205 LYS ALA A . n A 1 209 PRO 209 206 206 PRO PRO A . n A 1 210 LEU 210 207 207 LEU LEU A . n A 1 211 GLY 211 208 208 GLY GLY A . n A 1 212 GLU 212 209 209 GLU GLU A . n A 1 213 LEU 213 210 210 LEU LEU A . n A 1 214 TRP 214 211 211 TRP TRP A . n A 1 215 LYS 215 212 212 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 401 401 MG IUM A . C 2 MG 1 402 402 MG IUM A . D 3 2DT 1 301 301 2DT DDT A . E 4 ADP 1 302 302 ADP ADP A . F 5 HOH 1 505 505 HOH WAT A . F 5 HOH 2 506 506 HOH WAT A . F 5 HOH 3 507 507 HOH WAT A . F 5 HOH 4 508 508 HOH WAT A . F 5 HOH 5 509 509 HOH WAT A . F 5 HOH 6 510 510 HOH WAT A . F 5 HOH 7 511 511 HOH WAT A . F 5 HOH 8 512 512 HOH WAT A . F 5 HOH 9 513 513 HOH WAT A . F 5 HOH 10 514 514 HOH WAT A . F 5 HOH 11 515 515 HOH WAT A . F 5 HOH 12 516 516 HOH WAT A . F 5 HOH 13 517 517 HOH WAT A . F 5 HOH 14 518 518 HOH WAT A . F 5 HOH 15 519 519 HOH WAT A . F 5 HOH 16 520 520 HOH WAT A . F 5 HOH 17 521 521 HOH WAT A . F 5 HOH 18 522 522 HOH WAT A . F 5 HOH 19 523 523 HOH WAT A . F 5 HOH 20 524 524 HOH WAT A . F 5 HOH 21 525 525 HOH WAT A . F 5 HOH 22 526 526 HOH WAT A . F 5 HOH 23 527 527 HOH WAT A . F 5 HOH 24 528 528 HOH WAT A . F 5 HOH 25 529 529 HOH WAT A . F 5 HOH 26 530 530 HOH WAT A . F 5 HOH 27 531 531 HOH WAT A . F 5 HOH 28 532 532 HOH WAT A . F 5 HOH 29 533 533 HOH WAT A . F 5 HOH 30 534 534 HOH WAT A . F 5 HOH 31 535 535 HOH WAT A . F 5 HOH 32 536 536 HOH WAT A . F 5 HOH 33 537 537 HOH WAT A . F 5 HOH 34 538 538 HOH WAT A . F 5 HOH 35 539 539 HOH WAT A . F 5 HOH 36 540 540 HOH WAT A . F 5 HOH 37 541 541 HOH WAT A . F 5 HOH 38 542 542 HOH WAT A . F 5 HOH 39 543 543 HOH WAT A . F 5 HOH 40 544 544 HOH WAT A . F 5 HOH 41 545 545 HOH WAT A . F 5 HOH 42 546 546 HOH WAT A . F 5 HOH 43 547 547 HOH WAT A . F 5 HOH 44 548 548 HOH WAT A . F 5 HOH 45 549 549 HOH WAT A . F 5 HOH 46 550 550 HOH WAT A . F 5 HOH 47 551 551 HOH WAT A . F 5 HOH 48 552 552 HOH WAT A . F 5 HOH 49 553 553 HOH WAT A . F 5 HOH 50 554 554 HOH WAT A . F 5 HOH 51 555 555 HOH WAT A . F 5 HOH 52 556 556 HOH WAT A . F 5 HOH 53 557 557 HOH WAT A . F 5 HOH 54 558 558 HOH WAT A . F 5 HOH 55 559 559 HOH WAT A . F 5 HOH 56 560 560 HOH WAT A . F 5 HOH 57 561 561 HOH WAT A . F 5 HOH 58 562 562 HOH WAT A . F 5 HOH 59 563 563 HOH WAT A . F 5 HOH 60 564 564 HOH WAT A . F 5 HOH 61 565 565 HOH WAT A . F 5 HOH 62 566 566 HOH WAT A . F 5 HOH 63 567 567 HOH WAT A . F 5 HOH 64 568 568 HOH WAT A . F 5 HOH 65 569 569 HOH WAT A . F 5 HOH 66 570 570 HOH WAT A . F 5 HOH 67 571 571 HOH WAT A . F 5 HOH 68 572 572 HOH WAT A . F 5 HOH 69 574 574 HOH WAT A . F 5 HOH 70 575 575 HOH WAT A . F 5 HOH 71 576 576 HOH WAT A . F 5 HOH 72 577 577 HOH WAT A . F 5 HOH 73 578 578 HOH WAT A . F 5 HOH 74 579 579 HOH WAT A . F 5 HOH 75 580 580 HOH WAT A . F 5 HOH 76 581 581 HOH WAT A . F 5 HOH 77 583 583 HOH WAT A . F 5 HOH 78 584 584 HOH WAT A . F 5 HOH 79 585 585 HOH WAT A . F 5 HOH 80 588 588 HOH WAT A . F 5 HOH 81 589 589 HOH WAT A . F 5 HOH 82 590 590 HOH WAT A . F 5 HOH 83 591 591 HOH WAT A . F 5 HOH 84 592 592 HOH WAT A . F 5 HOH 85 593 593 HOH WAT A . F 5 HOH 86 594 594 HOH WAT A . F 5 HOH 87 595 595 HOH WAT A . F 5 HOH 88 596 596 HOH WAT A . F 5 HOH 89 597 597 HOH WAT A . F 5 HOH 90 598 598 HOH WAT A . F 5 HOH 91 599 599 HOH WAT A . F 5 HOH 92 600 600 HOH WAT A . F 5 HOH 93 602 602 HOH WAT A . F 5 HOH 94 603 603 HOH WAT A . F 5 HOH 95 604 604 HOH WAT A . F 5 HOH 96 605 605 HOH WAT A . F 5 HOH 97 606 606 HOH WAT A . F 5 HOH 98 607 607 HOH WAT A . F 5 HOH 99 608 608 HOH WAT A . F 5 HOH 100 609 609 HOH WAT A . F 5 HOH 101 610 610 HOH WAT A . F 5 HOH 102 611 611 HOH WAT A . F 5 HOH 103 612 612 HOH WAT A . F 5 HOH 104 613 613 HOH WAT A . F 5 HOH 105 614 614 HOH WAT A . F 5 HOH 106 615 615 HOH WAT A . F 5 HOH 107 617 617 HOH WAT A . F 5 HOH 108 619 619 HOH WAT A . F 5 HOH 109 620 620 HOH WAT A . F 5 HOH 110 621 621 HOH WAT A . F 5 HOH 111 622 622 HOH WAT A . F 5 HOH 112 623 623 HOH WAT A . F 5 HOH 113 624 624 HOH WAT A . F 5 HOH 114 625 625 HOH WAT A . F 5 HOH 115 626 626 HOH WAT A . F 5 HOH 116 627 627 HOH WAT A . F 5 HOH 117 628 628 HOH WAT A . F 5 HOH 118 629 629 HOH WAT A . F 5 HOH 119 630 630 HOH WAT A . F 5 HOH 120 631 631 HOH WAT A . F 5 HOH 121 632 632 HOH WAT A . F 5 HOH 122 633 633 HOH WAT A . F 5 HOH 123 636 636 HOH WAT A . F 5 HOH 124 637 637 HOH WAT A . F 5 HOH 125 639 639 HOH WAT A . F 5 HOH 126 640 640 HOH WAT A . F 5 HOH 127 642 642 HOH WAT A . F 5 HOH 128 643 643 HOH WAT A . F 5 HOH 129 645 645 HOH WAT A . F 5 HOH 130 646 646 HOH WAT A . F 5 HOH 131 647 647 HOH WAT A . F 5 HOH 132 648 648 HOH WAT A . F 5 HOH 133 651 651 HOH WAT A . F 5 HOH 134 652 652 HOH WAT A . F 5 HOH 135 654 654 HOH WAT A . F 5 HOH 136 656 656 HOH WAT A . F 5 HOH 137 657 657 HOH WAT A . F 5 HOH 138 658 658 HOH WAT A . F 5 HOH 139 659 659 HOH WAT A . F 5 HOH 140 661 661 HOH WAT A . F 5 HOH 141 662 662 HOH WAT A . F 5 HOH 142 663 663 HOH WAT A . F 5 HOH 143 664 664 HOH WAT A . F 5 HOH 144 665 665 HOH WAT A . F 5 HOH 145 666 666 HOH WAT A . F 5 HOH 146 667 667 HOH WAT A . F 5 HOH 147 668 668 HOH WAT A . F 5 HOH 148 669 669 HOH WAT A . F 5 HOH 149 671 671 HOH WAT A . F 5 HOH 150 673 673 HOH WAT A . F 5 HOH 151 675 675 HOH WAT A . F 5 HOH 152 676 676 HOH WAT A . F 5 HOH 153 677 677 HOH WAT A . F 5 HOH 154 678 678 HOH WAT A . F 5 HOH 155 679 679 HOH WAT A . F 5 HOH 156 680 680 HOH WAT A . F 5 HOH 157 682 682 HOH WAT A . F 5 HOH 158 683 683 HOH WAT A . F 5 HOH 159 685 685 HOH WAT A . F 5 HOH 160 686 686 HOH WAT A . F 5 HOH 161 687 687 HOH WAT A . F 5 HOH 162 689 689 HOH WAT A . F 5 HOH 163 690 690 HOH WAT A . F 5 HOH 164 692 692 HOH WAT A . F 5 HOH 165 693 693 HOH WAT A . F 5 HOH 166 694 694 HOH WAT A . F 5 HOH 167 695 695 HOH WAT A . F 5 HOH 168 696 696 HOH WAT A . F 5 HOH 169 697 697 HOH WAT A . F 5 HOH 170 698 698 HOH WAT A . F 5 HOH 171 699 699 HOH WAT A . F 5 HOH 172 700 700 HOH WAT A . F 5 HOH 173 701 701 HOH WAT A . F 5 HOH 174 702 702 HOH WAT A . F 5 HOH 175 704 704 HOH WAT A . F 5 HOH 176 705 705 HOH WAT A . F 5 HOH 177 709 709 HOH WAT A . F 5 HOH 178 710 710 HOH WAT A . F 5 HOH 179 713 713 HOH WAT A . F 5 HOH 180 714 714 HOH WAT A . F 5 HOH 181 715 715 HOH WAT A . F 5 HOH 182 720 720 HOH WAT A . F 5 HOH 183 721 721 HOH WAT A . F 5 HOH 184 722 722 HOH WAT A . F 5 HOH 185 726 726 HOH WAT A . F 5 HOH 186 727 727 HOH WAT A . F 5 HOH 187 729 729 HOH WAT A . F 5 HOH 188 730 730 HOH WAT A . F 5 HOH 189 731 731 HOH WAT A . F 5 HOH 190 732 732 HOH WAT A . F 5 HOH 191 733 733 HOH WAT A . F 5 HOH 192 734 734 HOH WAT A . F 5 HOH 193 738 738 HOH WAT A . F 5 HOH 194 739 739 HOH WAT A . F 5 HOH 195 740 740 HOH WAT A . F 5 HOH 196 741 741 HOH WAT A . F 5 HOH 197 742 742 HOH WAT A . F 5 HOH 198 743 743 HOH WAT A . F 5 HOH 199 744 744 HOH WAT A . F 5 HOH 200 746 746 HOH WAT A . F 5 HOH 201 747 747 HOH WAT A . F 5 HOH 202 748 748 HOH WAT A . F 5 HOH 203 749 749 HOH WAT A . F 5 HOH 204 750 750 HOH WAT A . F 5 HOH 205 751 751 HOH WAT A . F 5 HOH 206 752 752 HOH WAT A . F 5 HOH 207 753 753 HOH WAT A . F 5 HOH 208 754 754 HOH WAT A . F 5 HOH 209 755 755 HOH WAT A . F 5 HOH 210 756 756 HOH WAT A . F 5 HOH 211 757 757 HOH WAT A . F 5 HOH 212 758 758 HOH WAT A . F 5 HOH 213 759 759 HOH WAT A . F 5 HOH 214 760 760 HOH WAT A . F 5 HOH 215 761 761 HOH WAT A . F 5 HOH 216 762 762 HOH WAT A . F 5 HOH 217 763 763 HOH WAT A . F 5 HOH 218 764 764 HOH WAT A . F 5 HOH 219 765 765 HOH WAT A . F 5 HOH 220 766 766 HOH WAT A . F 5 HOH 221 767 767 HOH WAT A . F 5 HOH 222 768 768 HOH WAT A . F 5 HOH 223 769 769 HOH WAT A . F 5 HOH 224 770 770 HOH WAT A . F 5 HOH 225 771 771 HOH WAT A . F 5 HOH 226 772 772 HOH WAT A . F 5 HOH 227 773 773 HOH WAT A . F 5 HOH 228 774 774 HOH WAT A . F 5 HOH 229 775 775 HOH WAT A . F 5 HOH 230 776 776 HOH WAT A . F 5 HOH 231 777 777 HOH WAT A . F 5 HOH 232 778 778 HOH WAT A . F 5 HOH 233 779 779 HOH WAT A . F 5 HOH 234 780 780 HOH WAT A . F 5 HOH 235 781 781 HOH WAT A . F 5 HOH 236 782 782 HOH WAT A . F 5 HOH 237 783 783 HOH WAT A . F 5 HOH 238 784 784 HOH WAT A . F 5 HOH 239 785 785 HOH WAT A . F 5 HOH 240 786 786 HOH WAT A . F 5 HOH 241 787 787 HOH WAT A . F 5 HOH 242 788 788 HOH WAT A . F 5 HOH 243 789 789 HOH WAT A . F 5 HOH 244 791 791 HOH WAT A . F 5 HOH 245 792 792 HOH WAT A . F 5 HOH 246 793 793 HOH WAT A . F 5 HOH 247 794 794 HOH WAT A . F 5 HOH 248 796 796 HOH WAT A . F 5 HOH 249 797 797 HOH WAT A . F 5 HOH 250 798 798 HOH WAT A . F 5 HOH 251 799 799 HOH WAT A . F 5 HOH 252 800 800 HOH WAT A . F 5 HOH 253 801 801 HOH WAT A . F 5 HOH 254 802 802 HOH WAT A . F 5 HOH 255 803 803 HOH WAT A . F 5 HOH 256 804 804 HOH WAT A . F 5 HOH 257 806 806 HOH WAT A . F 5 HOH 258 807 807 HOH WAT A . F 5 HOH 259 808 808 HOH WAT A . F 5 HOH 260 809 809 HOH WAT A . F 5 HOH 261 810 810 HOH WAT A . F 5 HOH 262 811 811 HOH WAT A . F 5 HOH 263 812 812 HOH WAT A . F 5 HOH 264 813 813 HOH WAT A . F 5 HOH 265 814 814 HOH WAT A . F 5 HOH 266 815 815 HOH WAT A . F 5 HOH 267 816 816 HOH WAT A . F 5 HOH 268 817 817 HOH WAT A . F 5 HOH 269 818 818 HOH WAT A . F 5 HOH 270 819 819 HOH WAT A . F 5 HOH 271 820 820 HOH WAT A . F 5 HOH 272 821 821 HOH WAT A . F 5 HOH 273 822 822 HOH WAT A . F 5 HOH 274 823 823 HOH WAT A . F 5 HOH 275 824 824 HOH WAT A . F 5 HOH 276 825 825 HOH WAT A . F 5 HOH 277 826 826 HOH WAT A . F 5 HOH 278 827 827 HOH WAT A . F 5 HOH 279 828 828 HOH WAT A . F 5 HOH 280 829 829 HOH WAT A . F 5 HOH 281 830 830 HOH WAT A . F 5 HOH 282 831 831 HOH WAT A . F 5 HOH 283 832 832 HOH WAT A . F 5 HOH 284 833 833 HOH WAT A . F 5 HOH 285 834 834 HOH WAT A . F 5 HOH 286 835 835 HOH WAT A . F 5 HOH 287 836 836 HOH WAT A . F 5 HOH 288 837 837 HOH WAT A . F 5 HOH 289 838 838 HOH WAT A . F 5 HOH 290 839 839 HOH WAT A . F 5 HOH 291 840 840 HOH WAT A . F 5 HOH 292 841 841 HOH WAT A . F 5 HOH 293 842 842 HOH WAT A . F 5 HOH 294 843 843 HOH WAT A . F 5 HOH 295 845 845 HOH WAT A . F 5 HOH 296 846 846 HOH WAT A . F 5 HOH 297 847 847 HOH WAT A . F 5 HOH 298 848 848 HOH WAT A . F 5 HOH 299 849 849 HOH WAT A . F 5 HOH 300 850 850 HOH WAT A . F 5 HOH 301 851 851 HOH WAT A . F 5 HOH 302 852 852 HOH WAT A . F 5 HOH 303 853 853 HOH WAT A . F 5 HOH 304 854 854 HOH WAT A . F 5 HOH 305 855 855 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4650 ? 1 MORE -73 ? 1 'SSA (A^2)' 17300 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 100.5350000000 -1.0000000000 0.0000000000 0.0000000000 100.5350000000 0.0000000000 0.0000000000 -1.0000000000 24.9815000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OG ? A SER 23 ? A SER 20 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O2B ? E ADP . ? A ADP 302 ? 1_555 95.9 ? 2 OG ? A SER 23 ? A SER 20 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 505 ? 1_555 85.3 ? 3 O2B ? E ADP . ? A ADP 302 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 505 ? 1_555 174.7 ? 4 OG ? A SER 23 ? A SER 20 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 506 ? 1_555 91.9 ? 5 O2B ? E ADP . ? A ADP 302 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 506 ? 1_555 91.9 ? 6 O ? F HOH . ? A HOH 505 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 506 ? 1_555 82.8 ? 7 OG ? A SER 23 ? A SER 20 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 507 ? 1_555 170.4 ? 8 O2B ? E ADP . ? A ADP 302 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 507 ? 1_555 91.4 ? 9 O ? F HOH . ? A HOH 505 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 507 ? 1_555 88.1 ? 10 O ? F HOH . ? A HOH 506 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 507 ? 1_555 94.1 ? 11 OG ? A SER 23 ? A SER 20 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 753 ? 1_555 86.9 ? 12 O2B ? E ADP . ? A ADP 302 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 753 ? 1_555 97.5 ? 13 O ? F HOH . ? A HOH 505 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 753 ? 1_555 87.8 ? 14 O ? F HOH . ? A HOH 506 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 753 ? 1_555 170.6 ? 15 O ? F HOH . ? A HOH 507 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 753 ? 1_555 85.9 ? 16 O ? F HOH . ? A HOH 756 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 756 ? 8_665 87.7 ? 17 O ? F HOH . ? A HOH 756 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 761 ? 1_555 103.0 ? 18 O ? F HOH . ? A HOH 756 ? 8_665 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 761 ? 1_555 94.5 ? 19 O ? F HOH . ? A HOH 756 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 761 ? 8_665 75.0 ? 20 O ? F HOH . ? A HOH 756 ? 8_665 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 761 ? 8_665 88.0 ? 21 O ? F HOH . ? A HOH 761 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 761 ? 8_665 176.7 ? 22 O ? F HOH . ? A HOH 756 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 771 ? 1_555 157.4 ? 23 O ? F HOH . ? A HOH 756 ? 8_665 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 771 ? 1_555 89.9 ? 24 O ? F HOH . ? A HOH 761 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 771 ? 1_555 99.7 ? 25 O ? F HOH . ? A HOH 761 ? 8_665 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 771 ? 1_555 82.4 ? 26 O ? F HOH . ? A HOH 756 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 771 ? 8_665 83.5 ? 27 O ? F HOH . ? A HOH 756 ? 8_665 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 771 ? 8_665 167.4 ? 28 O ? F HOH . ? A HOH 761 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 771 ? 8_665 96.2 ? 29 O ? F HOH . ? A HOH 761 ? 8_665 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 771 ? 8_665 81.0 ? 30 O ? F HOH . ? A HOH 771 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 771 ? 8_665 94.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-03-18 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-11 5 'Structure model' 1 4 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' database_2 3 5 'Structure model' pdbx_struct_conn_angle 4 5 'Structure model' struct_conn 5 5 'Structure model' struct_ref_seq_dif 6 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 17 5 'Structure model' '_pdbx_struct_conn_angle.value' 18 5 'Structure model' '_struct_conn.pdbx_dist_value' 19 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 31 5 'Structure model' '_struct_conn.ptnr2_symmetry' 32 5 'Structure model' '_struct_ref_seq_dif.details' 33 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 34 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 35 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MAR345 'data collection' . ? 1 XDS 'data reduction' . ? 2 REFMAC refinement . ? 3 XDS 'data scaling' . ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NH1 A ARG 41 ? ? O A HOH 778 ? ? 1.94 2 1 O A HOH 746 ? ? O A HOH 838 ? ? 2.02 3 1 O A HOH 510 ? ? O A HOH 803 ? ? 2.05 4 1 NH2 A ARG 4 ? ? O A HOH 855 ? ? 2.06 5 1 O A HOH 775 ? ? O A HOH 808 ? ? 2.07 6 1 O A HOH 651 ? ? O A HOH 807 ? ? 2.09 7 1 O A HOH 692 ? ? O A HOH 837 ? ? 2.10 8 1 NE2 A GLN 166 ? ? O A HOH 597 ? ? 2.13 9 1 OE1 A GLN 166 ? ? NZ A LYS 169 ? ? 2.14 10 1 OE2 A GLU 85 ? ? O A HOH 822 ? ? 2.14 11 1 O A HOH 524 ? ? O A HOH 778 ? ? 2.17 12 1 OD2 A ASP 197 ? ? O A HOH 519 ? ? 2.18 13 1 O A HOH 581 ? ? O A HOH 659 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 610 ? ? 1_555 O A HOH 675 ? ? 8_666 1.77 2 1 O A HOH 609 ? ? 1_555 O A HOH 651 ? ? 4_455 2.04 3 1 O A HOH 627 ? ? 1_555 O A HOH 818 ? ? 8_665 2.19 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 115.15 120.30 -5.15 0.50 N 2 1 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 124.37 120.30 4.07 0.50 N 3 1 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH2 A ARG 24 ? ? 116.12 120.30 -4.18 0.50 N 4 1 CB A ASP 96 ? ? CG A ASP 96 ? ? OD2 A ASP 96 ? ? 112.64 118.30 -5.66 0.90 N 5 1 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH1 A ARG 97 ? ? 125.35 120.30 5.05 0.50 N 6 1 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH2 A ARG 97 ? ? 115.39 120.30 -4.91 0.50 N 7 1 NE A ARG 143 ? ? CZ A ARG 143 ? ? NH1 A ARG 143 ? ? 116.89 120.30 -3.41 0.50 N 8 1 NE A ARG 150 ? ? CZ A ARG 150 ? ? NH1 A ARG 150 ? ? 116.94 120.30 -3.36 0.50 N 9 1 NE A ARG 150 ? ? CZ A ARG 150 ? ? NH2 A ARG 150 ? ? 124.73 120.30 4.43 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 97 ? ? 71.49 148.17 2 1 TYR A 98 ? ? -150.14 -147.76 3 1 ARG A 143 ? ? -97.49 43.83 4 1 TYR A 151 ? ? 75.73 -3.75 5 1 THR A 201 ? ? -74.41 -71.11 6 1 ALA A 202 ? ? -30.10 -36.66 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id LYS _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 19 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle 11.15 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 142 ? CG ? A LYS 145 CG 2 1 Y 1 A LYS 142 ? CD ? A LYS 145 CD 3 1 Y 1 A LYS 142 ? CE ? A LYS 145 CE 4 1 Y 1 A LYS 142 ? NZ ? A LYS 145 NZ 5 1 Y 1 A HIS 148 ? CG ? A HIS 151 CG 6 1 Y 1 A HIS 148 ? ND1 ? A HIS 151 ND1 7 1 Y 1 A HIS 148 ? CD2 ? A HIS 151 CD2 8 1 Y 1 A HIS 148 ? CE1 ? A HIS 151 CE1 9 1 Y 1 A HIS 148 ? NE2 ? A HIS 151 NE2 10 1 Y 1 A LYS 205 ? CG ? A LYS 208 CG 11 1 Y 1 A LYS 205 ? CD ? A LYS 208 CD 12 1 Y 1 A LYS 205 ? CE ? A LYS 208 CE 13 1 Y 1 A LYS 205 ? NZ ? A LYS 208 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A ALA 2 ? A ALA 5 6 1 Y 1 A ALA 3 ? A ALA 6 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 "3'-DEOXYTHYMIDINE-5'-MONOPHOSPHATE" 2DT 4 "ADENOSINE-5'-DIPHOSPHATE" ADP 5 water HOH #