data_1NNK # _entry.id 1NNK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.284 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1NNK RCSB RCSB018036 WWPDB D_1000018036 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1FTJ 'Crystal Structure Of The Glur2 Ligand Binding Core (S1S2J) In Complex With Glutamate At 1.9 Resolution.' unspecified PDB 1FTK 'Crystal Structure Of The Glur2 Ligand Binding Core (S1S2I) In Complex With Kainate At 1.6 A Resolution.' unspecified PDB 1FTO 'Crystal Structure Of The Glur2 Ligand Binding Core (S1S2J) In The Apo State At 2.0 A Resolution.' unspecified PDB 1FW0 'Crystal Structure Of The Glur2 Ligand Binding Core (S1S2J) In Complex With Kainate At 2.0 A Resolution.' unspecified PDB 1FTL 'Crystal Structure Of The Glur2 Ligand Binding Core (S1S2J) In Complex With The Antagonist Dnqx At 1.8 A Resolution.' unspecified PDB 1GR2 'Structure Of A Glutamate Receptor Ligand Binding Core (Glur2) Complexed With Kainate.' unspecified PDB 1LB8 'Crystal Structure Of The Non-Desensitizing Glur2 Ligand Binding Core Mutant (S1S2J-L483Y) In Complex With Ampa At 2.3 Resolution.' unspecified PDB 1LB9 ;Crystal Structure Of The Non-Desensitizing Glur2 Ligand Binding Core Mutant (S1S2J-L483Y) In Complex With Antagonist Dnqx At 2.3 A Resolution. ; unspecified PDB 1LBC ;Crystal Structure Of Glur2 Ligand Binding Core (S1S2J-N775S) In Complex With Cyclothiazide (Ctz) As Well As Glutamate At 1.8 A Resolution. ; unspecified PDB 1M5E 'X-Ray Structure Of The Glur2 Ligand Binding Core (S1S2J) In Complex With Acpa At 1.46 A Resolution.' unspecified PDB 1M5C 'X-Ray Structure Of The Glur2 Ligand Binding Core (S1S2J) In Complex With Br-Hibo At 1.65 A Resolution.' unspecified PDB 1M5B 'X-Ray Structure Of The Glur2 Ligand Binding Core (S1S2J) In Complex With 2-Me-Tet-Ampa At 1.85 A Resolution.' unspecified PDB 1M5F 'X-Ray Structure Of The Glur2 Ligand Binding Core (S1S2J- Y702F) In Complex With Acpa At 1.95 A Resolution.' unspecified PDB 1MM7 ;Crystal Structure of the GluR2 Ligand Binding Core (S1S2J) in Complex with Quisqualate in a Zinc Crystal Form at 1.65 Angstroms Resolution. ; unspecified PDB 1MM6 ;Crystal structure of the GluR2 ligand binding core (S1S2J) in complex with quisqualate in a non zinc crystal form at 2.15 angstroms resolution. ; unspecified PDB 1LBB 'Crystal Structure Of The Glur2 Ligand Binding Domain Mutant (S1S2J-N754D) In Complex With Kainate At 2.1 A Resolution.' unspecified PDB 1MY4 'Crystal structure of glutamate receptor ligand-binding core in complex with iodo-willardiine in the Zn crystal form.' unspecified PDB 1MY3 'crystal structure of glutamate receptor ligand-binding core in complex with bromo-willardiine in the Zn crystal form.' unspecified PDB 1M5D 'X-Ray Structure Of The Glur2 Ligand Binding Core (S1S2J- Y702F) In Complex With Br-Hibo At 1.73 A Resolution.' unspecified PDB 1FTM 'Crystal Structure Of The Glur2 Ligand Binding Core (S1S2J) In Complex With Ampa At 1.7 Resolution.' unspecified PDB 1NNP ;X-ray structure of the GluR2 ligand-binding core (S1S2J) in complex with (S)-ATPA at 1.9 A resolution. Crystallization without zinc ions. ; unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NNK _pdbx_database_status.recvd_initial_deposition_date 2003-01-14 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lunn, M.-L.' 1 'Hogner, A.' 2 'Stensbol, T.B.' 3 'Gouaux, E.' 4 'Egebjerg, J.' 5 'Kastrup, J.S.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Three-Dimensional Structure of the Ligand-Binding Core of GluR2 in Complex with the Agonist (S)-ATPA: Implications for Receptor Subunit Selectivity. ; J.Med.Chem. 46 872 875 2003 JMCMAR US 0022-2623 0151 ? 12593667 10.1021/jm021020+ 1 ;Structural basis for AMPA receptor activation and ligand selectivity: Crystal structures of five agonist complexes with the GluR2 ligand binding core. ; J.Mol.Biol. 322 93 109 2002 JMOBAK UK 0022-2836 0070 ? ? '10.1016/S0022-2836(02)00650-2' 2 ;Mechanisms for activation and antagonism of an AMPA-sensitive glutamate receptor: Crystal structures of the GluR2 ligand binding core. ; Neuron 28 165 181 2000 NERNET US 0896-6273 2038 ? ? '10.1016/S0896-6273(00)00094-5' 3 'Mechanism of glutamate receptor desensitization.' Nature 417 245 253 2002 NATUAS UK 0028-0836 0006 ? ? 10.1038/417245a 4 ;Probing the ligand binding domain of the GluR2 receptor by proteolysis and deletion mutagenesis defines domain boundaries and yields a crystallizable construct. ; 'Protein Sci.' 7 2623 2630 1998 PRCIEI US 0961-8368 0795 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lunn, M.L.' 1 primary 'Hogner, A.' 2 primary 'Stensbol, T.B.' 3 primary 'Gouaux, E.' 4 primary 'Egebjerg, J.' 5 primary 'Kastrup, J.S.' 6 1 'Hogner, A.' 7 1 'Kastrup, J.S.' 8 1 'Jin, R.' 9 1 'Liljefors, T.' 10 1 'Mayer, M.L.' 11 1 'Egebjerg, J.' 12 1 'Larsen, I.' 13 1 'Gouaux, E.' 14 2 'Armstrong, N.' 15 2 'Gouaux, E.' 16 3 'Sun, Y.' 17 3 'Olson, R.' 18 3 'Horning, M.' 19 3 'Armstrong, N.' 20 3 'Mayer, M.' 21 3 'Gouaux, E.' 22 4 'Chen, G.Q.' 23 4 'Sun, R.' 24 4 'Jin, R.' 25 4 'Gouaux, E.' 26 # _cell.entry_id 1NNK _cell.length_a 54.258 _cell.length_b 111.229 _cell.length_c 46.643 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1NNK _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Glutamate receptor 2' 29221.682 1 ? ? 'GluR2-flop ligand-binding core (S1S2J)' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn '3-(5-TERT-BUTYL-3-OXIDOISOXAZOL-4-YL)-L-ALANINATE' 227.237 1 ? ? ? ? 5 water nat water 18.015 179 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GLUR-2, GLUR-B, GLUTAMATE RECEPTOR IONOTROPIC AMPA 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GANKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVY GKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWT YMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLK LNEQGLLDKLKNKWWYDKGECGS ; _entity_poly.pdbx_seq_one_letter_code_can ;GANKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVY GKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWT YMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLK LNEQGLLDKLKNKWWYDKGECGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 ASN n 1 4 LYS n 1 5 THR n 1 6 VAL n 1 7 VAL n 1 8 VAL n 1 9 THR n 1 10 THR n 1 11 ILE n 1 12 LEU n 1 13 GLU n 1 14 SER n 1 15 PRO n 1 16 TYR n 1 17 VAL n 1 18 MET n 1 19 MET n 1 20 LYS n 1 21 LYS n 1 22 ASN n 1 23 HIS n 1 24 GLU n 1 25 MET n 1 26 LEU n 1 27 GLU n 1 28 GLY n 1 29 ASN n 1 30 GLU n 1 31 ARG n 1 32 TYR n 1 33 GLU n 1 34 GLY n 1 35 TYR n 1 36 CYS n 1 37 VAL n 1 38 ASP n 1 39 LEU n 1 40 ALA n 1 41 ALA n 1 42 GLU n 1 43 ILE n 1 44 ALA n 1 45 LYS n 1 46 HIS n 1 47 CYS n 1 48 GLY n 1 49 PHE n 1 50 LYS n 1 51 TYR n 1 52 LYS n 1 53 LEU n 1 54 THR n 1 55 ILE n 1 56 VAL n 1 57 GLY n 1 58 ASP n 1 59 GLY n 1 60 LYS n 1 61 TYR n 1 62 GLY n 1 63 ALA n 1 64 ARG n 1 65 ASP n 1 66 ALA n 1 67 ASP n 1 68 THR n 1 69 LYS n 1 70 ILE n 1 71 TRP n 1 72 ASN n 1 73 GLY n 1 74 MET n 1 75 VAL n 1 76 GLY n 1 77 GLU n 1 78 LEU n 1 79 VAL n 1 80 TYR n 1 81 GLY n 1 82 LYS n 1 83 ALA n 1 84 ASP n 1 85 ILE n 1 86 ALA n 1 87 ILE n 1 88 ALA n 1 89 PRO n 1 90 LEU n 1 91 THR n 1 92 ILE n 1 93 THR n 1 94 LEU n 1 95 VAL n 1 96 ARG n 1 97 GLU n 1 98 GLU n 1 99 VAL n 1 100 ILE n 1 101 ASP n 1 102 PHE n 1 103 SER n 1 104 LYS n 1 105 PRO n 1 106 PHE n 1 107 MET n 1 108 SER n 1 109 LEU n 1 110 GLY n 1 111 ILE n 1 112 SER n 1 113 ILE n 1 114 MET n 1 115 ILE n 1 116 LYS n 1 117 LYS n 1 118 GLY n 1 119 THR n 1 120 PRO n 1 121 ILE n 1 122 GLU n 1 123 SER n 1 124 ALA n 1 125 GLU n 1 126 ASP n 1 127 LEU n 1 128 SER n 1 129 LYS n 1 130 GLN n 1 131 THR n 1 132 GLU n 1 133 ILE n 1 134 ALA n 1 135 TYR n 1 136 GLY n 1 137 THR n 1 138 LEU n 1 139 ASP n 1 140 SER n 1 141 GLY n 1 142 SER n 1 143 THR n 1 144 LYS n 1 145 GLU n 1 146 PHE n 1 147 PHE n 1 148 ARG n 1 149 ARG n 1 150 SER n 1 151 LYS n 1 152 ILE n 1 153 ALA n 1 154 VAL n 1 155 PHE n 1 156 ASP n 1 157 LYS n 1 158 MET n 1 159 TRP n 1 160 THR n 1 161 TYR n 1 162 MET n 1 163 ARG n 1 164 SER n 1 165 ALA n 1 166 GLU n 1 167 PRO n 1 168 SER n 1 169 VAL n 1 170 PHE n 1 171 VAL n 1 172 ARG n 1 173 THR n 1 174 THR n 1 175 ALA n 1 176 GLU n 1 177 GLY n 1 178 VAL n 1 179 ALA n 1 180 ARG n 1 181 VAL n 1 182 ARG n 1 183 LYS n 1 184 SER n 1 185 LYS n 1 186 GLY n 1 187 LYS n 1 188 TYR n 1 189 ALA n 1 190 TYR n 1 191 LEU n 1 192 LEU n 1 193 GLU n 1 194 SER n 1 195 THR n 1 196 MET n 1 197 ASN n 1 198 GLU n 1 199 TYR n 1 200 ILE n 1 201 GLU n 1 202 GLN n 1 203 ARG n 1 204 LYS n 1 205 PRO n 1 206 CYS n 1 207 ASP n 1 208 THR n 1 209 MET n 1 210 LYS n 1 211 VAL n 1 212 GLY n 1 213 GLY n 1 214 ASN n 1 215 LEU n 1 216 ASP n 1 217 SER n 1 218 LYS n 1 219 GLY n 1 220 TYR n 1 221 GLY n 1 222 ILE n 1 223 ALA n 1 224 THR n 1 225 PRO n 1 226 LYS n 1 227 GLY n 1 228 SER n 1 229 SER n 1 230 LEU n 1 231 GLY n 1 232 ASN n 1 233 ALA n 1 234 VAL n 1 235 ASN n 1 236 LEU n 1 237 ALA n 1 238 VAL n 1 239 LEU n 1 240 LYS n 1 241 LEU n 1 242 ASN n 1 243 GLU n 1 244 GLN n 1 245 GLY n 1 246 LEU n 1 247 LEU n 1 248 ASP n 1 249 LYS n 1 250 LEU n 1 251 LYS n 1 252 ASN n 1 253 LYS n 1 254 TRP n 1 255 TRP n 1 256 TYR n 1 257 ASP n 1 258 LYS n 1 259 GLY n 1 260 GLU n 1 261 CYS n 1 262 GLY n 1 263 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? 3 117 'Norway rat' Rattus ? ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET30B ? ? 1 2 sample ? 120 263 'Norway rat' Rattus ? ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET30B ? ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GRIA2_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGK ADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRS AEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNEQ GLLDKLKNKWWYDKGECGS ; _struct_ref.pdbx_align_begin 413 _struct_ref.pdbx_db_accession P19491 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1NNK A 3 ? 117 ? P19491 413 ? 527 ? 0 114 2 1 1NNK A 120 ? 263 ? P19491 653 ? 796 ? 117 260 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1NNK GLY A 1 ? UNP P19491 ? ? 'CLONING ARTIFACT' -2 1 1 1NNK ALA A 2 ? UNP P19491 ? ? 'CLONING ARTIFACT' -1 2 1 1NNK GLY A 118 ? UNP P19491 ? ? LINKER 115 3 1 1NNK THR A 119 ? UNP P19491 ? ? LINKER 116 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CE2 non-polymer . '3-(5-TERT-BUTYL-3-OXIDOISOXAZOL-4-YL)-L-ALANINATE' '(S)-ATPA, (S)-2-AMINO-3-(3-HYDROXY-5-TERT-BUTYL-ISOXAZOL-4-YL)PROPIONIC ACID' 'C10 H15 N2 O4 -1' 227.237 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1NNK _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.4 _exptl_crystal.density_percent_sol 49.0 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 279 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pdbx_details 'zinc acetate, cacodylate, PEG8000, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 279K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2001-03-14 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator NULL. _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.08350 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'MAX II BEAMLINE I711' _diffrn_source.pdbx_synchrotron_site 'MAX II' _diffrn_source.pdbx_synchrotron_beamline I711 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.08350 # _reflns.entry_id 1NNK _reflns.observed_criterion_sigma_F 0.00 _reflns.observed_criterion_sigma_I 0.00 _reflns.d_resolution_high 1.85 _reflns.d_resolution_low 20.00 _reflns.number_all 23016 _reflns.number_obs 23016 _reflns.percent_possible_obs 92.6 _reflns.pdbx_Rmerge_I_obs 0.099 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 7.0 _reflns.B_iso_Wilson_estimate 18.2 _reflns.pdbx_redundancy 3.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.85 _reflns_shell.d_res_low 1.92 _reflns_shell.percent_possible_all 82.1 _reflns_shell.Rmerge_I_obs 0.34 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1996 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1NNK _refine.ls_d_res_high 1.85 _refine.ls_d_res_low 19.99 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 22974 _refine.ls_number_reflns_obs 22974 _refine.ls_number_reflns_R_free 682 _refine.ls_percent_reflns_obs 92.5 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_work 0.207 _refine.ls_R_factor_R_free 0.245 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free 3.0 _refine.ls_R_factor_R_free_error 0.009 _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'GluR2:(S)-thio-ATPA complex (Lunn et al., to be published).' _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_bsol 48.7733 _refine.solvent_model_param_ksol 0.418009 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.B_iso_mean 27.4 _refine.aniso_B[1][1] -0.04 _refine.aniso_B[1][2] 0.34 _refine.aniso_B[1][3] -0.29 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.00 _refine.details 'The first three N-terminal residues and the last two C-terminal residues were not located in the electron density map.' _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF 1449707.81 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1NNK _refine_analyze.Luzzati_coordinate_error_obs 0.21 _refine_analyze.Luzzati_sigma_a_obs 0.20 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.26 _refine_analyze.Luzzati_sigma_a_free 0.25 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2018 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 19 _refine_hist.number_atoms_solvent 179 _refine_hist.number_atoms_total 2216 _refine_hist.d_res_high 1.85 _refine_hist.d_res_low 19.99 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 21.8 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.86 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 3.89 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 5.12 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 6.69 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 9.37 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.85 _refine_ls_shell.d_res_low 1.97 _refine_ls_shell.number_reflns_R_work 3300 _refine_ls_shell.R_factor_R_work 0.265 _refine_ls_shell.percent_reflns_obs 83.7 _refine_ls_shell.R_factor_R_free 0.293 _refine_ls_shell.R_factor_R_free_error 0.029 _refine_ls_shell.percent_reflns_R_free 2.9 _refine_ls_shell.number_reflns_R_free 100 _refine_ls_shell.number_reflns_obs 3400 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _pdbx_xplor_file.serial_no 1 _pdbx_xplor_file.param_file protein_rep.param _pdbx_xplor_file.topol_file protein.top _pdbx_xplor_file.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 1NNK _struct.title ;X-ray structure of the GluR2 ligand-binding core (S1S2J) in complex with (S)-ATPA at 1.85 A resolution. Crystallization with zinc ions. ; _struct.pdbx_descriptor 'Glutamate receptor 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NNK _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'Ionotropic glutamate receptor GluR2, ligand-binding core, agonist complex, MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 _struct_biol.details ;The biological assembly is a tetramer composed of dimers-of-dimers. Only the dimer is observed in the crystal. The dimer may be generated by applying the following to chain A: TRANSFORM FRACTIONAL - -1.00000 0.00000 0.00000 - 0.00000 -1.00000 0.00000 - 0.00000 0.00000 1.00000 - 2.00000 0.00000 0.00000 ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 22 ? LEU A 26 ? ASN A 19 LEU A 23 5 ? 5 HELX_P HELX_P2 2 GLU A 27 ? GLU A 30 ? GLU A 24 GLU A 27 5 ? 4 HELX_P HELX_P3 3 GLY A 34 ? CYS A 47 ? GLY A 31 CYS A 44 1 ? 14 HELX_P HELX_P4 4 ASN A 72 ? TYR A 80 ? ASN A 69 TYR A 77 1 ? 9 HELX_P HELX_P5 5 THR A 93 ? GLU A 98 ? THR A 90 GLU A 95 1 ? 6 HELX_P HELX_P6 6 SER A 123 ? LYS A 129 ? SER A 120 LYS A 126 1 ? 7 HELX_P HELX_P7 7 GLY A 141 ? SER A 150 ? GLY A 138 SER A 147 1 ? 10 HELX_P HELX_P8 8 ILE A 152 ? ALA A 165 ? ILE A 149 ALA A 162 1 ? 14 HELX_P HELX_P9 9 THR A 173 ? SER A 184 ? THR A 170 SER A 181 1 ? 12 HELX_P HELX_P10 10 SER A 194 ? GLN A 202 ? SER A 191 GLN A 199 1 ? 9 HELX_P HELX_P11 11 SER A 228 ? GLN A 244 ? SER A 225 GLN A 241 1 ? 17 HELX_P HELX_P12 12 GLY A 245 ? TYR A 256 ? GLY A 242 TYR A 253 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 206 SG ? ? ? 1_555 A CYS 261 SG ? ? A CYS 203 A CYS 258 1_555 ? ? ? ? ? ? ? 2.025 ? metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A GLU 166 OE1 ? ? A ZN 451 A GLU 163 1_555 ? ? ? ? ? ? ? 2.168 ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A GLU 166 OE2 ? ? A ZN 451 A GLU 163 1_555 ? ? ? ? ? ? ? 2.482 ? metalc3 metalc ? ? C ZN . ZN ? ? ? 1_555 A GLU 42 OE1 ? ? A ZN 452 A GLU 39 1_555 ? ? ? ? ? ? ? 2.066 ? metalc4 metalc ? ? C ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 452 A HOH 595 1_555 ? ? ? ? ? ? ? 2.316 ? metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 46 NE2 ? ? A ZN 452 A HIS 43 1_555 ? ? ? ? ? ? ? 1.889 ? metalc6 metalc ? ? B ZN . ZN ? ? ? 1_555 A GLU 24 OE2 ? ? A ZN 451 A GLU 21 4_556 ? ? ? ? ? ? ? 2.040 ? metalc7 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 23 NE2 ? ? A ZN 451 A HIS 20 4_556 ? ? ? ? ? ? ? 2.289 ? metalc8 metalc ? ? C ZN . ZN ? ? ? 1_555 A GLU 30 OE2 ? ? A ZN 452 A GLU 27 2_655 ? ? ? ? ? ? ? 2.250 ? metalc9 metalc ? ? C ZN . ZN ? ? ? 1_555 A GLU 30 OE1 ? ? A ZN 452 A GLU 27 2_655 ? ? ? ? ? ? ? 2.372 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 14 A . ? SER 11 A PRO 15 A ? PRO 12 A 1 0.34 2 GLU 166 A . ? GLU 163 A PRO 167 A ? PRO 164 A 1 -0.03 3 LYS 204 A . ? LYS 201 A PRO 205 A ? PRO 202 A 1 0.18 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? C ? 2 ? D ? 2 ? E ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel E 1 2 ? parallel E 2 3 ? anti-parallel E 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 51 ? ILE A 55 ? TYR A 48 ILE A 52 A 2 VAL A 6 ? THR A 10 ? VAL A 3 THR A 7 A 3 ILE A 85 ? ALA A 86 ? ILE A 82 ALA A 83 B 1 MET A 18 ? MET A 19 ? MET A 15 MET A 16 B 2 TYR A 32 ? GLU A 33 ? TYR A 29 GLU A 30 C 1 ILE A 100 ? PHE A 102 ? ILE A 97 PHE A 99 C 2 ALA A 223 ? PRO A 225 ? ALA A 220 PRO A 222 D 1 MET A 107 ? LEU A 109 ? MET A 104 LEU A 106 D 2 LYS A 218 ? TYR A 220 ? LYS A 215 TYR A 217 E 1 ALA A 134 ? GLY A 136 ? ALA A 131 GLY A 133 E 2 TYR A 188 ? GLU A 193 ? TYR A 185 GLU A 190 E 3 ILE A 111 ? LYS A 116 ? ILE A 108 LYS A 113 E 4 THR A 208 ? VAL A 211 ? THR A 205 VAL A 208 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 54 ? O THR A 51 N VAL A 8 ? N VAL A 5 A 2 3 N THR A 9 ? N THR A 6 O ILE A 85 ? O ILE A 82 B 1 2 N MET A 18 ? N MET A 15 O GLU A 33 ? O GLU A 30 C 1 2 N ASP A 101 ? N ASP A 98 O THR A 224 ? O THR A 221 D 1 2 N LEU A 109 ? N LEU A 106 O LYS A 218 ? O LYS A 215 E 1 2 N GLY A 136 ? N GLY A 133 O LEU A 191 ? O LEU A 188 E 2 3 O TYR A 190 ? O TYR A 187 N MET A 114 ? N MET A 111 E 3 4 N ILE A 115 ? N ILE A 112 O MET A 209 ? O MET A 206 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 451' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 452' AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 453' AC4 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CE2 A 454' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 23 ? HIS A 20 . ? 4_556 ? 2 AC1 4 GLU A 24 ? GLU A 21 . ? 4_556 ? 3 AC1 4 GLU A 166 ? GLU A 163 . ? 1_555 ? 4 AC1 4 CL D . ? CL A 453 . ? 1_555 ? 5 AC2 4 GLU A 30 ? GLU A 27 . ? 2_655 ? 6 AC2 4 GLU A 42 ? GLU A 39 . ? 1_555 ? 7 AC2 4 HIS A 46 ? HIS A 43 . ? 1_555 ? 8 AC2 4 HOH F . ? HOH A 595 . ? 1_555 ? 9 AC3 2 GLU A 166 ? GLU A 163 . ? 1_555 ? 10 AC3 2 ZN B . ? ZN A 451 . ? 1_555 ? 11 AC4 15 GLU A 13 ? GLU A 10 . ? 1_555 ? 12 AC4 15 TYR A 61 ? TYR A 58 . ? 1_555 ? 13 AC4 15 PRO A 89 ? PRO A 86 . ? 1_555 ? 14 AC4 15 LEU A 90 ? LEU A 87 . ? 1_555 ? 15 AC4 15 THR A 91 ? THR A 88 . ? 1_555 ? 16 AC4 15 ARG A 96 ? ARG A 93 . ? 1_555 ? 17 AC4 15 GLY A 141 ? GLY A 138 . ? 1_555 ? 18 AC4 15 SER A 142 ? SER A 139 . ? 1_555 ? 19 AC4 15 THR A 143 ? THR A 140 . ? 1_555 ? 20 AC4 15 THR A 174 ? THR A 171 . ? 1_555 ? 21 AC4 15 GLU A 193 ? GLU A 190 . ? 1_555 ? 22 AC4 15 MET A 196 ? MET A 193 . ? 1_555 ? 23 AC4 15 TYR A 220 ? TYR A 217 . ? 1_555 ? 24 AC4 15 HOH F . ? HOH A 455 . ? 1_555 ? 25 AC4 15 HOH F . ? HOH A 466 . ? 1_555 ? # _database_PDB_matrix.entry_id 1NNK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1NNK _atom_sites.fract_transf_matrix[1][1] 0.018430 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008990 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021439 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 ALA 2 -1 ? ? ? A . n A 1 3 ASN 3 0 ? ? ? A . n A 1 4 LYS 4 1 1 LYS LYS A . n A 1 5 THR 5 2 2 THR THR A . n A 1 6 VAL 6 3 3 VAL VAL A . n A 1 7 VAL 7 4 4 VAL VAL A . n A 1 8 VAL 8 5 5 VAL VAL A . n A 1 9 THR 9 6 6 THR THR A . n A 1 10 THR 10 7 7 THR THR A . n A 1 11 ILE 11 8 8 ILE ILE A . n A 1 12 LEU 12 9 9 LEU LEU A . n A 1 13 GLU 13 10 10 GLU GLU A . n A 1 14 SER 14 11 11 SER SER A . n A 1 15 PRO 15 12 12 PRO PRO A . n A 1 16 TYR 16 13 13 TYR TYR A . n A 1 17 VAL 17 14 14 VAL VAL A . n A 1 18 MET 18 15 15 MET MET A . n A 1 19 MET 19 16 16 MET MET A . n A 1 20 LYS 20 17 17 LYS LYS A . n A 1 21 LYS 21 18 18 LYS LYS A . n A 1 22 ASN 22 19 19 ASN ASN A . n A 1 23 HIS 23 20 20 HIS HIS A . n A 1 24 GLU 24 21 21 GLU GLU A . n A 1 25 MET 25 22 22 MET MET A . n A 1 26 LEU 26 23 23 LEU LEU A . n A 1 27 GLU 27 24 24 GLU GLU A . n A 1 28 GLY 28 25 25 GLY GLY A . n A 1 29 ASN 29 26 26 ASN ASN A . n A 1 30 GLU 30 27 27 GLU GLU A . n A 1 31 ARG 31 28 28 ARG ARG A . n A 1 32 TYR 32 29 29 TYR TYR A . n A 1 33 GLU 33 30 30 GLU GLU A . n A 1 34 GLY 34 31 31 GLY GLY A . n A 1 35 TYR 35 32 32 TYR TYR A . n A 1 36 CYS 36 33 33 CYS CYS A . n A 1 37 VAL 37 34 34 VAL VAL A . n A 1 38 ASP 38 35 35 ASP ASP A . n A 1 39 LEU 39 36 36 LEU LEU A . n A 1 40 ALA 40 37 37 ALA ALA A . n A 1 41 ALA 41 38 38 ALA ALA A . n A 1 42 GLU 42 39 39 GLU GLU A . n A 1 43 ILE 43 40 40 ILE ILE A . n A 1 44 ALA 44 41 41 ALA ALA A . n A 1 45 LYS 45 42 42 LYS LYS A . n A 1 46 HIS 46 43 43 HIS HIS A . n A 1 47 CYS 47 44 44 CYS CYS A . n A 1 48 GLY 48 45 45 GLY GLY A . n A 1 49 PHE 49 46 46 PHE PHE A . n A 1 50 LYS 50 47 47 LYS LYS A . n A 1 51 TYR 51 48 48 TYR TYR A . n A 1 52 LYS 52 49 49 LYS LYS A . n A 1 53 LEU 53 50 50 LEU LEU A . n A 1 54 THR 54 51 51 THR THR A . n A 1 55 ILE 55 52 52 ILE ILE A . n A 1 56 VAL 56 53 53 VAL VAL A . n A 1 57 GLY 57 54 54 GLY GLY A . n A 1 58 ASP 58 55 55 ASP ASP A . n A 1 59 GLY 59 56 56 GLY GLY A . n A 1 60 LYS 60 57 57 LYS LYS A . n A 1 61 TYR 61 58 58 TYR TYR A . n A 1 62 GLY 62 59 59 GLY GLY A . n A 1 63 ALA 63 60 60 ALA ALA A . n A 1 64 ARG 64 61 61 ARG ARG A . n A 1 65 ASP 65 62 62 ASP ASP A . n A 1 66 ALA 66 63 63 ALA ALA A . n A 1 67 ASP 67 64 64 ASP ASP A . n A 1 68 THR 68 65 65 THR THR A . n A 1 69 LYS 69 66 66 LYS LYS A . n A 1 70 ILE 70 67 67 ILE ILE A . n A 1 71 TRP 71 68 68 TRP TRP A . n A 1 72 ASN 72 69 69 ASN ASN A . n A 1 73 GLY 73 70 70 GLY GLY A . n A 1 74 MET 74 71 71 MET MET A . n A 1 75 VAL 75 72 72 VAL VAL A . n A 1 76 GLY 76 73 73 GLY GLY A . n A 1 77 GLU 77 74 74 GLU GLU A . n A 1 78 LEU 78 75 75 LEU LEU A . n A 1 79 VAL 79 76 76 VAL VAL A . n A 1 80 TYR 80 77 77 TYR TYR A . n A 1 81 GLY 81 78 78 GLY GLY A . n A 1 82 LYS 82 79 79 LYS LYS A . n A 1 83 ALA 83 80 80 ALA ALA A . n A 1 84 ASP 84 81 81 ASP ASP A . n A 1 85 ILE 85 82 82 ILE ILE A . n A 1 86 ALA 86 83 83 ALA ALA A . n A 1 87 ILE 87 84 84 ILE ILE A . n A 1 88 ALA 88 85 85 ALA ALA A . n A 1 89 PRO 89 86 86 PRO PRO A . n A 1 90 LEU 90 87 87 LEU LEU A . n A 1 91 THR 91 88 88 THR THR A . n A 1 92 ILE 92 89 89 ILE ILE A . n A 1 93 THR 93 90 90 THR THR A . n A 1 94 LEU 94 91 91 LEU LEU A . n A 1 95 VAL 95 92 92 VAL VAL A . n A 1 96 ARG 96 93 93 ARG ARG A . n A 1 97 GLU 97 94 94 GLU GLU A . n A 1 98 GLU 98 95 95 GLU GLU A . n A 1 99 VAL 99 96 96 VAL VAL A . n A 1 100 ILE 100 97 97 ILE ILE A . n A 1 101 ASP 101 98 98 ASP ASP A . n A 1 102 PHE 102 99 99 PHE PHE A . n A 1 103 SER 103 100 100 SER SER A . n A 1 104 LYS 104 101 101 LYS LYS A . n A 1 105 PRO 105 102 102 PRO PRO A . n A 1 106 PHE 106 103 103 PHE PHE A . n A 1 107 MET 107 104 104 MET MET A . n A 1 108 SER 108 105 105 SER SER A . n A 1 109 LEU 109 106 106 LEU LEU A . n A 1 110 GLY 110 107 107 GLY GLY A . n A 1 111 ILE 111 108 108 ILE ILE A . n A 1 112 SER 112 109 109 SER SER A . n A 1 113 ILE 113 110 110 ILE ILE A . n A 1 114 MET 114 111 111 MET MET A . n A 1 115 ILE 115 112 112 ILE ILE A . n A 1 116 LYS 116 113 113 LYS LYS A . n A 1 117 LYS 117 114 114 LYS LYS A . n A 1 118 GLY 118 115 115 GLY GLY A . n A 1 119 THR 119 116 116 THR THR A . n A 1 120 PRO 120 117 117 PRO PRO A . n A 1 121 ILE 121 118 118 ILE ILE A . n A 1 122 GLU 122 119 119 GLU GLU A . n A 1 123 SER 123 120 120 SER SER A . n A 1 124 ALA 124 121 121 ALA ALA A . n A 1 125 GLU 125 122 122 GLU GLU A . n A 1 126 ASP 126 123 123 ASP ASP A . n A 1 127 LEU 127 124 124 LEU LEU A . n A 1 128 SER 128 125 125 SER SER A . n A 1 129 LYS 129 126 126 LYS LYS A . n A 1 130 GLN 130 127 127 GLN GLN A . n A 1 131 THR 131 128 128 THR THR A . n A 1 132 GLU 132 129 129 GLU GLU A . n A 1 133 ILE 133 130 130 ILE ILE A . n A 1 134 ALA 134 131 131 ALA ALA A . n A 1 135 TYR 135 132 132 TYR TYR A . n A 1 136 GLY 136 133 133 GLY GLY A . n A 1 137 THR 137 134 134 THR THR A . n A 1 138 LEU 138 135 135 LEU LEU A . n A 1 139 ASP 139 136 136 ASP ASP A . n A 1 140 SER 140 137 137 SER SER A . n A 1 141 GLY 141 138 138 GLY GLY A . n A 1 142 SER 142 139 139 SER SER A . n A 1 143 THR 143 140 140 THR THR A . n A 1 144 LYS 144 141 141 LYS LYS A . n A 1 145 GLU 145 142 142 GLU GLU A . n A 1 146 PHE 146 143 143 PHE PHE A . n A 1 147 PHE 147 144 144 PHE PHE A . n A 1 148 ARG 148 145 145 ARG ARG A . n A 1 149 ARG 149 146 146 ARG ARG A . n A 1 150 SER 150 147 147 SER SER A . n A 1 151 LYS 151 148 148 LYS LYS A . n A 1 152 ILE 152 149 149 ILE ILE A . n A 1 153 ALA 153 150 150 ALA ALA A . n A 1 154 VAL 154 151 151 VAL VAL A . n A 1 155 PHE 155 152 152 PHE PHE A . n A 1 156 ASP 156 153 153 ASP ASP A . n A 1 157 LYS 157 154 154 LYS LYS A . n A 1 158 MET 158 155 155 MET MET A . n A 1 159 TRP 159 156 156 TRP TRP A . n A 1 160 THR 160 157 157 THR THR A . n A 1 161 TYR 161 158 158 TYR TYR A . n A 1 162 MET 162 159 159 MET MET A . n A 1 163 ARG 163 160 160 ARG ARG A . n A 1 164 SER 164 161 161 SER SER A . n A 1 165 ALA 165 162 162 ALA ALA A . n A 1 166 GLU 166 163 163 GLU GLU A . n A 1 167 PRO 167 164 164 PRO PRO A . n A 1 168 SER 168 165 165 SER SER A . n A 1 169 VAL 169 166 166 VAL VAL A . n A 1 170 PHE 170 167 167 PHE PHE A . n A 1 171 VAL 171 168 168 VAL VAL A . n A 1 172 ARG 172 169 169 ARG ARG A . n A 1 173 THR 173 170 170 THR THR A . n A 1 174 THR 174 171 171 THR THR A . n A 1 175 ALA 175 172 172 ALA ALA A . n A 1 176 GLU 176 173 173 GLU GLU A . n A 1 177 GLY 177 174 174 GLY GLY A . n A 1 178 VAL 178 175 175 VAL VAL A . n A 1 179 ALA 179 176 176 ALA ALA A . n A 1 180 ARG 180 177 177 ARG ARG A . n A 1 181 VAL 181 178 178 VAL VAL A . n A 1 182 ARG 182 179 179 ARG ARG A . n A 1 183 LYS 183 180 180 LYS LYS A . n A 1 184 SER 184 181 181 SER SER A . n A 1 185 LYS 185 182 182 LYS LYS A . n A 1 186 GLY 186 183 183 GLY GLY A . n A 1 187 LYS 187 184 184 LYS LYS A . n A 1 188 TYR 188 185 185 TYR TYR A . n A 1 189 ALA 189 186 186 ALA ALA A . n A 1 190 TYR 190 187 187 TYR TYR A . n A 1 191 LEU 191 188 188 LEU LEU A . n A 1 192 LEU 192 189 189 LEU LEU A . n A 1 193 GLU 193 190 190 GLU GLU A . n A 1 194 SER 194 191 191 SER SER A . n A 1 195 THR 195 192 192 THR THR A . n A 1 196 MET 196 193 193 MET MET A . n A 1 197 ASN 197 194 194 ASN ASN A . n A 1 198 GLU 198 195 195 GLU GLU A . n A 1 199 TYR 199 196 196 TYR TYR A . n A 1 200 ILE 200 197 197 ILE ILE A . n A 1 201 GLU 201 198 198 GLU GLU A . n A 1 202 GLN 202 199 199 GLN GLN A . n A 1 203 ARG 203 200 200 ARG ARG A . n A 1 204 LYS 204 201 201 LYS LYS A . n A 1 205 PRO 205 202 202 PRO PRO A . n A 1 206 CYS 206 203 203 CYS CYS A . n A 1 207 ASP 207 204 204 ASP ASP A . n A 1 208 THR 208 205 205 THR THR A . n A 1 209 MET 209 206 206 MET MET A . n A 1 210 LYS 210 207 207 LYS LYS A . n A 1 211 VAL 211 208 208 VAL VAL A . n A 1 212 GLY 212 209 209 GLY GLY A . n A 1 213 GLY 213 210 210 GLY GLY A . n A 1 214 ASN 214 211 211 ASN ASN A . n A 1 215 LEU 215 212 212 LEU LEU A . n A 1 216 ASP 216 213 213 ASP ASP A . n A 1 217 SER 217 214 214 SER SER A . n A 1 218 LYS 218 215 215 LYS LYS A . n A 1 219 GLY 219 216 216 GLY GLY A . n A 1 220 TYR 220 217 217 TYR TYR A . n A 1 221 GLY 221 218 218 GLY GLY A . n A 1 222 ILE 222 219 219 ILE ILE A . n A 1 223 ALA 223 220 220 ALA ALA A . n A 1 224 THR 224 221 221 THR THR A . n A 1 225 PRO 225 222 222 PRO PRO A . n A 1 226 LYS 226 223 223 LYS LYS A . n A 1 227 GLY 227 224 224 GLY GLY A . n A 1 228 SER 228 225 225 SER SER A . n A 1 229 SER 229 226 226 SER SER A . n A 1 230 LEU 230 227 227 LEU LEU A . n A 1 231 GLY 231 228 228 GLY GLY A . n A 1 232 ASN 232 229 229 ASN ASN A . n A 1 233 ALA 233 230 230 ALA ALA A . n A 1 234 VAL 234 231 231 VAL VAL A . n A 1 235 ASN 235 232 232 ASN ASN A . n A 1 236 LEU 236 233 233 LEU LEU A . n A 1 237 ALA 237 234 234 ALA ALA A . n A 1 238 VAL 238 235 235 VAL VAL A . n A 1 239 LEU 239 236 236 LEU LEU A . n A 1 240 LYS 240 237 237 LYS LYS A . n A 1 241 LEU 241 238 238 LEU LEU A . n A 1 242 ASN 242 239 239 ASN ASN A . n A 1 243 GLU 243 240 240 GLU GLU A . n A 1 244 GLN 244 241 241 GLN GLN A . n A 1 245 GLY 245 242 242 GLY GLY A . n A 1 246 LEU 246 243 243 LEU LEU A . n A 1 247 LEU 247 244 244 LEU LEU A . n A 1 248 ASP 248 245 245 ASP ASP A . n A 1 249 LYS 249 246 246 LYS LYS A . n A 1 250 LEU 250 247 247 LEU LEU A . n A 1 251 LYS 251 248 248 LYS LYS A . n A 1 252 ASN 252 249 249 ASN ASN A . n A 1 253 LYS 253 250 250 LYS LYS A . n A 1 254 TRP 254 251 251 TRP TRP A . n A 1 255 TRP 255 252 252 TRP TRP A . n A 1 256 TYR 256 253 253 TYR TYR A . n A 1 257 ASP 257 254 254 ASP ASP A . n A 1 258 LYS 258 255 255 LYS LYS A . n A 1 259 GLY 259 256 256 GLY GLY A . n A 1 260 GLU 260 257 257 GLU GLU A . n A 1 261 CYS 261 258 258 CYS CYS A . n A 1 262 GLY 262 259 ? ? ? A . n A 1 263 SER 263 260 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 451 1 ZN ZN2 A . C 2 ZN 1 452 2 ZN ZN2 A . D 3 CL 1 453 6 CL CL1 A . E 4 CE2 1 454 1 CE2 C A . F 5 HOH 1 455 4 HOH HOH A . F 5 HOH 2 456 5 HOH HOH A . F 5 HOH 3 457 7 HOH HOH A . F 5 HOH 4 458 8 HOH HOH A . F 5 HOH 5 459 9 HOH HOH A . F 5 HOH 6 460 10 HOH HOH A . F 5 HOH 7 461 11 HOH HOH A . F 5 HOH 8 462 12 HOH HOH A . F 5 HOH 9 463 13 HOH HOH A . F 5 HOH 10 464 14 HOH HOH A . F 5 HOH 11 465 15 HOH HOH A . F 5 HOH 12 466 17 HOH HOH A . F 5 HOH 13 467 18 HOH HOH A . F 5 HOH 14 468 19 HOH HOH A . F 5 HOH 15 469 20 HOH HOH A . F 5 HOH 16 470 22 HOH HOH A . F 5 HOH 17 471 25 HOH HOH A . F 5 HOH 18 472 26 HOH HOH A . F 5 HOH 19 473 27 HOH HOH A . F 5 HOH 20 474 28 HOH HOH A . F 5 HOH 21 475 29 HOH HOH A . F 5 HOH 22 476 30 HOH HOH A . F 5 HOH 23 477 31 HOH HOH A . F 5 HOH 24 478 32 HOH HOH A . F 5 HOH 25 479 34 HOH HOH A . F 5 HOH 26 480 35 HOH HOH A . F 5 HOH 27 481 36 HOH HOH A . F 5 HOH 28 482 37 HOH HOH A . F 5 HOH 29 483 40 HOH HOH A . F 5 HOH 30 484 41 HOH HOH A . F 5 HOH 31 485 42 HOH HOH A . F 5 HOH 32 486 43 HOH HOH A . F 5 HOH 33 487 44 HOH HOH A . F 5 HOH 34 488 45 HOH HOH A . F 5 HOH 35 489 46 HOH HOH A . F 5 HOH 36 490 47 HOH HOH A . F 5 HOH 37 491 48 HOH HOH A . F 5 HOH 38 492 49 HOH HOH A . F 5 HOH 39 493 50 HOH HOH A . F 5 HOH 40 494 51 HOH HOH A . F 5 HOH 41 495 52 HOH HOH A . F 5 HOH 42 496 53 HOH HOH A . F 5 HOH 43 497 54 HOH HOH A . F 5 HOH 44 498 55 HOH HOH A . F 5 HOH 45 499 56 HOH HOH A . F 5 HOH 46 500 57 HOH HOH A . F 5 HOH 47 501 58 HOH HOH A . F 5 HOH 48 502 59 HOH HOH A . F 5 HOH 49 503 60 HOH HOH A . F 5 HOH 50 504 61 HOH HOH A . F 5 HOH 51 505 62 HOH HOH A . F 5 HOH 52 506 63 HOH HOH A . F 5 HOH 53 507 64 HOH HOH A . F 5 HOH 54 508 65 HOH HOH A . F 5 HOH 55 509 66 HOH HOH A . F 5 HOH 56 510 68 HOH HOH A . F 5 HOH 57 511 69 HOH HOH A . F 5 HOH 58 512 70 HOH HOH A . F 5 HOH 59 513 71 HOH HOH A . F 5 HOH 60 514 73 HOH HOH A . F 5 HOH 61 515 74 HOH HOH A . F 5 HOH 62 516 75 HOH HOH A . F 5 HOH 63 517 76 HOH HOH A . F 5 HOH 64 518 77 HOH HOH A . F 5 HOH 65 519 78 HOH HOH A . F 5 HOH 66 520 79 HOH HOH A . F 5 HOH 67 521 80 HOH HOH A . F 5 HOH 68 522 82 HOH HOH A . F 5 HOH 69 523 83 HOH HOH A . F 5 HOH 70 524 84 HOH HOH A . F 5 HOH 71 525 85 HOH HOH A . F 5 HOH 72 526 86 HOH HOH A . F 5 HOH 73 527 87 HOH HOH A . F 5 HOH 74 528 89 HOH HOH A . F 5 HOH 75 529 90 HOH HOH A . F 5 HOH 76 530 91 HOH HOH A . F 5 HOH 77 531 92 HOH HOH A . F 5 HOH 78 532 93 HOH HOH A . F 5 HOH 79 533 94 HOH HOH A . F 5 HOH 80 534 96 HOH HOH A . F 5 HOH 81 535 98 HOH HOH A . F 5 HOH 82 536 99 HOH HOH A . F 5 HOH 83 537 100 HOH HOH A . F 5 HOH 84 538 102 HOH HOH A . F 5 HOH 85 539 105 HOH HOH A . F 5 HOH 86 540 106 HOH HOH A . F 5 HOH 87 541 107 HOH HOH A . F 5 HOH 88 542 109 HOH HOH A . F 5 HOH 89 543 110 HOH HOH A . F 5 HOH 90 544 111 HOH HOH A . F 5 HOH 91 545 113 HOH HOH A . F 5 HOH 92 546 114 HOH HOH A . F 5 HOH 93 547 115 HOH HOH A . F 5 HOH 94 548 116 HOH HOH A . F 5 HOH 95 549 117 HOH HOH A . F 5 HOH 96 550 119 HOH HOH A . F 5 HOH 97 551 122 HOH HOH A . F 5 HOH 98 552 123 HOH HOH A . F 5 HOH 99 553 124 HOH HOH A . F 5 HOH 100 554 125 HOH HOH A . F 5 HOH 101 555 126 HOH HOH A . F 5 HOH 102 556 131 HOH HOH A . F 5 HOH 103 557 133 HOH HOH A . F 5 HOH 104 558 136 HOH HOH A . F 5 HOH 105 559 139 HOH HOH A . F 5 HOH 106 560 141 HOH HOH A . F 5 HOH 107 561 142 HOH HOH A . F 5 HOH 108 562 145 HOH HOH A . F 5 HOH 109 563 147 HOH HOH A . F 5 HOH 110 564 148 HOH HOH A . F 5 HOH 111 565 149 HOH HOH A . F 5 HOH 112 566 151 HOH HOH A . F 5 HOH 113 567 153 HOH HOH A . F 5 HOH 114 568 154 HOH HOH A . F 5 HOH 115 569 155 HOH HOH A . F 5 HOH 116 570 157 HOH HOH A . F 5 HOH 117 571 158 HOH HOH A . F 5 HOH 118 572 159 HOH HOH A . F 5 HOH 119 573 161 HOH HOH A . F 5 HOH 120 574 165 HOH HOH A . F 5 HOH 121 575 166 HOH HOH A . F 5 HOH 122 576 167 HOH HOH A . F 5 HOH 123 577 168 HOH HOH A . F 5 HOH 124 578 169 HOH HOH A . F 5 HOH 125 579 171 HOH HOH A . F 5 HOH 126 580 172 HOH HOH A . F 5 HOH 127 581 173 HOH HOH A . F 5 HOH 128 582 178 HOH HOH A . F 5 HOH 129 583 180 HOH HOH A . F 5 HOH 130 584 182 HOH HOH A . F 5 HOH 131 585 184 HOH HOH A . F 5 HOH 132 586 185 HOH HOH A . F 5 HOH 133 587 188 HOH HOH A . F 5 HOH 134 588 189 HOH HOH A . F 5 HOH 135 589 191 HOH HOH A . F 5 HOH 136 590 192 HOH HOH A . F 5 HOH 137 591 193 HOH HOH A . F 5 HOH 138 592 196 HOH HOH A . F 5 HOH 139 593 197 HOH HOH A . F 5 HOH 140 594 200 HOH HOH A . F 5 HOH 141 595 207 HOH HOH A . F 5 HOH 142 596 208 HOH HOH A . F 5 HOH 143 597 209 HOH HOH A . F 5 HOH 144 598 300 HOH HOH A . F 5 HOH 145 599 212 HOH HOH A . F 5 HOH 146 600 213 HOH HOH A . F 5 HOH 147 601 302 HOH HOH A . F 5 HOH 148 602 303 HOH HOH A . F 5 HOH 149 603 305 HOH HOH A . F 5 HOH 150 604 306 HOH HOH A . F 5 HOH 151 605 308 HOH HOH A . F 5 HOH 152 606 309 HOH HOH A . F 5 HOH 153 607 310 HOH HOH A . F 5 HOH 154 608 351 HOH HOH A . F 5 HOH 155 609 352 HOH HOH A . F 5 HOH 156 610 353 HOH HOH A . F 5 HOH 157 611 354 HOH HOH A . F 5 HOH 158 612 357 HOH HOH A . F 5 HOH 159 613 358 HOH HOH A . F 5 HOH 160 614 360 HOH HOH A . F 5 HOH 161 615 361 HOH HOH A . F 5 HOH 162 616 362 HOH HOH A . F 5 HOH 163 617 363 HOH HOH A . F 5 HOH 164 618 364 HOH HOH A . F 5 HOH 165 619 367 HOH HOH A . F 5 HOH 166 620 370 HOH HOH A . F 5 HOH 167 621 371 HOH HOH A . F 5 HOH 168 622 372 HOH HOH A . F 5 HOH 169 623 373 HOH HOH A . F 5 HOH 170 624 374 HOH HOH A . F 5 HOH 171 625 375 HOH HOH A . F 5 HOH 172 626 376 HOH HOH A . F 5 HOH 173 627 377 HOH HOH A . F 5 HOH 174 628 378 HOH HOH A . F 5 HOH 175 629 379 HOH HOH A . F 5 HOH 176 630 400 HOH HOH A . F 5 HOH 177 631 402 HOH HOH A . F 5 HOH 178 632 403 HOH HOH A . F 5 HOH 179 633 450 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3330 ? 1 MORE -110 ? 1 'SSA (A^2)' 22860 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_755 -x+2,-y,z -1.0000000000 0.0000000000 0.0000000000 108.5160000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 166 ? A GLU 163 ? 1_555 ZN ? B ZN . ? A ZN 451 ? 1_555 OE2 ? A GLU 166 ? A GLU 163 ? 1_555 55.9 ? 2 OE1 ? A GLU 166 ? A GLU 163 ? 1_555 ZN ? B ZN . ? A ZN 451 ? 1_555 OE2 ? A GLU 24 ? A GLU 21 ? 4_556 91.6 ? 3 OE2 ? A GLU 166 ? A GLU 163 ? 1_555 ZN ? B ZN . ? A ZN 451 ? 1_555 OE2 ? A GLU 24 ? A GLU 21 ? 4_556 145.9 ? 4 OE1 ? A GLU 166 ? A GLU 163 ? 1_555 ZN ? B ZN . ? A ZN 451 ? 1_555 NE2 ? A HIS 23 ? A HIS 20 ? 4_556 105.2 ? 5 OE2 ? A GLU 166 ? A GLU 163 ? 1_555 ZN ? B ZN . ? A ZN 451 ? 1_555 NE2 ? A HIS 23 ? A HIS 20 ? 4_556 93.4 ? 6 OE2 ? A GLU 24 ? A GLU 21 ? 4_556 ZN ? B ZN . ? A ZN 451 ? 1_555 NE2 ? A HIS 23 ? A HIS 20 ? 4_556 106.4 ? 7 OE1 ? A GLU 42 ? A GLU 39 ? 1_555 ZN ? C ZN . ? A ZN 452 ? 1_555 O ? F HOH . ? A HOH 595 ? 1_555 109.2 ? 8 OE1 ? A GLU 42 ? A GLU 39 ? 1_555 ZN ? C ZN . ? A ZN 452 ? 1_555 NE2 ? A HIS 46 ? A HIS 43 ? 1_555 104.6 ? 9 O ? F HOH . ? A HOH 595 ? 1_555 ZN ? C ZN . ? A ZN 452 ? 1_555 NE2 ? A HIS 46 ? A HIS 43 ? 1_555 104.1 ? 10 OE1 ? A GLU 42 ? A GLU 39 ? 1_555 ZN ? C ZN . ? A ZN 452 ? 1_555 OE2 ? A GLU 30 ? A GLU 27 ? 2_655 95.6 ? 11 O ? F HOH . ? A HOH 595 ? 1_555 ZN ? C ZN . ? A ZN 452 ? 1_555 OE2 ? A GLU 30 ? A GLU 27 ? 2_655 98.2 ? 12 NE2 ? A HIS 46 ? A HIS 43 ? 1_555 ZN ? C ZN . ? A ZN 452 ? 1_555 OE2 ? A GLU 30 ? A GLU 27 ? 2_655 142.7 ? 13 OE1 ? A GLU 42 ? A GLU 39 ? 1_555 ZN ? C ZN . ? A ZN 452 ? 1_555 OE1 ? A GLU 30 ? A GLU 27 ? 2_655 146.9 ? 14 O ? F HOH . ? A HOH 595 ? 1_555 ZN ? C ZN . ? A ZN 452 ? 1_555 OE1 ? A GLU 30 ? A GLU 27 ? 2_655 94.3 ? 15 NE2 ? A HIS 46 ? A HIS 43 ? 1_555 ZN ? C ZN . ? A ZN 452 ? 1_555 OE1 ? A GLU 30 ? A GLU 27 ? 2_655 91.3 ? 16 OE2 ? A GLU 30 ? A GLU 27 ? 2_655 ZN ? C ZN . ? A ZN 452 ? 1_555 OE1 ? A GLU 30 ? A GLU 27 ? 2_655 57.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-03-04 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-08-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Refinement description' 6 4 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn_source 2 4 'Structure model' entity_src_gen 3 4 'Structure model' software # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_diffrn_source.pdbx_synchrotron_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 AMoRE phasing . ? 3 CNS refinement 1.0 ? 4 # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 300 ; BIOMOLECULE: 1 THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT WHICH CONSISTS OF 1 CHAIN(S). SEE REMARK 350 FOR INFORMATION ON GENERATING THE BIOLOGICAL MOLECULE(S). NOTE THAT COORDINATES FOR ONE DIMER OF THE TETRAMERIC MULTIMER REPRESENTING THE KNOWN BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS GIVEN IN REMARK 350. ; 999 ;SEQUENCE Native GluR2 is a membrane protein. The protein crystallized is the extracellular ligand-binding core of GluR2. Transmembrane regions were genetically removed and replaced with a Gly-Thr linker (residues 115-116). Therefore, the sequence matches discontinuously with the reference database (413-527, 653-796). The two first residues of the sequence (Gly-2, Ala-1) are cloning artifacts and were not located in the electron density map. ; # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 257 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -140.75 _pdbx_validate_torsion.psi 14.35 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A ALA -1 ? A ALA 2 3 1 Y 1 A ASN 0 ? A ASN 3 4 1 Y 1 A GLY 259 ? A GLY 262 5 1 Y 1 A SER 260 ? A SER 263 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'CHLORIDE ION' CL 4 '3-(5-TERT-BUTYL-3-OXIDOISOXAZOL-4-YL)-L-ALANINATE' CE2 5 water HOH #