data_1NPQ # _entry.id 1NPQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1NPQ pdb_00001npq 10.2210/pdb1npq/pdb RCSB RCSB018087 ? ? WWPDB D_1000018087 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-04-29 2 'Structure model' 1 1 2007-10-21 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_ref_seq_dif.details' 29 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NPQ _pdbx_database_status.recvd_initial_deposition_date 2003-01-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mercier, P.' 1 'Ferguson, R.E.' 2 'Irving, M.' 3 'Corrie, J.E.T.' 4 'Trentham, D.R.' 5 'Sykes, B.D.' 6 # _citation.id primary _citation.title ;NMR Structure of a Bifunctional Rhodamine Labeled N-Domain of Troponin C Complexed with the Regulatory "Switch" Peptide from Troponin I: Implications for in Situ Fluorescence Studies in Muscle Fibers ; _citation.journal_abbrev Biochemistry _citation.journal_volume 42 _citation.page_first 4333 _citation.page_last 4348 _citation.year 2003 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12693929 _citation.pdbx_database_id_DOI 10.1021/bi027041n # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mercier, P.' 1 ? primary 'Ferguson, R.E.' 2 ? primary 'Irving, M.' 3 ? primary 'Corrie, J.E.T.' 4 ? primary 'Trentham, D.R.' 5 ? primary 'Sykes, B.D.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Troponin C' 9932.144 1 ? 'E56C, E63C' 'TnC, residues 1-90' ? 2 polymer syn 'Troponin I' 1890.303 1 ? ? 'switch peptide, residues 115-131' ? 3 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Troponin C, skeletal muscle' 2 'Troponin I, fast skeletal muscle; Troponin I, fast-twitch isoform' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKCELDAIICEVDEDGSGTIDFEEFLV MMVRQMKEDA ; ;ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKCELDAIICEVDEDGSGTIDFEEFLV MMVRQMKEDA ; A ? 2 'polypeptide(L)' no no RMSADAMLRALLGSKHK RMSADAMLRALLGSKHK B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 SER n 1 3 MET n 1 4 THR n 1 5 ASP n 1 6 GLN n 1 7 GLN n 1 8 ALA n 1 9 GLU n 1 10 ALA n 1 11 ARG n 1 12 ALA n 1 13 PHE n 1 14 LEU n 1 15 SER n 1 16 GLU n 1 17 GLU n 1 18 MET n 1 19 ILE n 1 20 ALA n 1 21 GLU n 1 22 PHE n 1 23 LYS n 1 24 ALA n 1 25 ALA n 1 26 PHE n 1 27 ASP n 1 28 MET n 1 29 PHE n 1 30 ASP n 1 31 ALA n 1 32 ASP n 1 33 GLY n 1 34 GLY n 1 35 GLY n 1 36 ASP n 1 37 ILE n 1 38 SER n 1 39 THR n 1 40 LYS n 1 41 GLU n 1 42 LEU n 1 43 GLY n 1 44 THR n 1 45 VAL n 1 46 MET n 1 47 ARG n 1 48 MET n 1 49 LEU n 1 50 GLY n 1 51 GLN n 1 52 ASN n 1 53 PRO n 1 54 THR n 1 55 LYS n 1 56 CYS n 1 57 GLU n 1 58 LEU n 1 59 ASP n 1 60 ALA n 1 61 ILE n 1 62 ILE n 1 63 CYS n 1 64 GLU n 1 65 VAL n 1 66 ASP n 1 67 GLU n 1 68 ASP n 1 69 GLY n 1 70 SER n 1 71 GLY n 1 72 THR n 1 73 ILE n 1 74 ASP n 1 75 PHE n 1 76 GLU n 1 77 GLU n 1 78 PHE n 1 79 LEU n 1 80 VAL n 1 81 MET n 1 82 MET n 1 83 VAL n 1 84 ARG n 1 85 GLN n 1 86 MET n 1 87 LYS n 1 88 GLU n 1 89 ASP n 1 90 ALA n 2 1 ARG n 2 2 MET n 2 3 SER n 2 4 ALA n 2 5 ASP n 2 6 ALA n 2 7 MET n 2 8 LEU n 2 9 ARG n 2 10 ALA n 2 11 LEU n 2 12 LEU n 2 13 GLY n 2 14 SER n 2 15 LYS n 2 16 HIS n 2 17 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name chicken _entity_src_gen.gene_src_genus Gallus _entity_src_gen.pdbx_gene_src_gene TNNC2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET3a _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET3asNTnC _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'This sequence occurs naturally in Oryctolagus cuniculus (rabit)' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ALA 90 90 90 ALA ALA A . n B 2 1 ARG 1 115 115 ARG ARG B . n B 2 2 MET 2 116 116 MET MET B . n B 2 3 SER 3 117 117 SER SER B . n B 2 4 ALA 4 118 118 ALA ALA B . n B 2 5 ASP 5 119 119 ASP ASP B . n B 2 6 ALA 6 120 120 ALA ALA B . n B 2 7 MET 7 121 121 MET MET B . n B 2 8 LEU 8 122 122 LEU LEU B . n B 2 9 ARG 9 123 123 ARG ARG B . n B 2 10 ALA 10 124 124 ALA ALA B . n B 2 11 LEU 11 125 125 LEU LEU B . n B 2 12 LEU 12 126 126 LEU LEU B . n B 2 13 GLY 13 127 127 GLY GLY B . n B 2 14 SER 14 128 128 SER SER B . n B 2 15 LYS 15 129 129 LYS LYS B . n B 2 16 HIS 16 130 130 HIS HIS B . n B 2 17 LYS 17 131 131 LYS LYS B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 132 132 CA CA A . D 3 CA 1 133 133 CA CA A . # _exptl.entry_id 1NPQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1NPQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1NPQ _struct.title 'structure of a rhodamine-labeled N-domain Troponin C mutant (Ca2+ saturated) in complex with skeletal Troponin I 115-131' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1NPQ _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text 'Troponin C- Troponin I complex, bifunctional rhodamine labeled Toponin C, STRUCTURAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_db_isoform 1 1 UNP TNNC2_CHICK P02588 1 ;ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLV MMVRQMKEDA ; ? 2 2 UNP TNNI2_RABIT P02643 115 RMSADAMLRALLGSKHK ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1NPQ A 1 ? 90 ? P02588 1 ? 90 ? 1 90 2 2 1NPQ B 1 ? 17 ? P02643 115 ? 131 ? 115 131 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1NPQ CYS A 56 ? UNP P02588 GLU 56 'engineered mutation' 56 1 1 1NPQ CYS A 63 ? UNP P02588 GLU 63 'engineered mutation' 63 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 5 ? LEU A 14 ? ASP A 5 LEU A 14 1 ? 10 HELX_P HELX_P2 2 SER A 15 ? LYS A 23 ? SER A 15 LYS A 23 1 ? 9 HELX_P HELX_P3 3 ALA A 25 ? ASP A 30 ? ALA A 25 ASP A 30 1 ? 6 HELX_P HELX_P4 4 SER A 38 ? MET A 48 ? SER A 38 MET A 48 1 ? 11 HELX_P HELX_P5 5 THR A 54 ? ASP A 66 ? THR A 54 ASP A 66 1 ? 13 HELX_P HELX_P6 6 GLU A 76 ? LYS A 87 ? GLU A 76 LYS A 87 1 ? 12 HELX_P HELX_P7 7 ALA B 4 ? LEU B 12 ? ALA B 118 LEU B 126 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 30 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 30 A CA 133 1_555 ? ? ? ? ? ? ? 2.580 ? ? metalc2 metalc ? ? A ALA 31 N ? ? ? 1_555 D CA . CA ? ? A ALA 31 A CA 133 1_555 ? ? ? ? ? ? ? 3.176 ? ? metalc3 metalc ? ? A ASP 32 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 32 A CA 133 1_555 ? ? ? ? ? ? ? 2.822 ? ? metalc4 metalc ? ? A ASP 36 O ? ? ? 1_555 D CA . CA ? ? A ASP 36 A CA 133 1_555 ? ? ? ? ? ? ? 2.779 ? ? metalc5 metalc ? ? A GLU 41 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 41 A CA 133 1_555 ? ? ? ? ? ? ? 2.826 ? ? metalc6 metalc ? ? A GLU 41 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 41 A CA 133 1_555 ? ? ? ? ? ? ? 2.164 ? ? metalc7 metalc ? ? A ASP 66 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 66 A CA 132 1_555 ? ? ? ? ? ? ? 2.497 ? ? metalc8 metalc ? ? A ASP 68 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 68 A CA 132 1_555 ? ? ? ? ? ? ? 2.953 ? ? metalc9 metalc ? ? A SER 70 OG ? ? ? 1_555 C CA . CA ? ? A SER 70 A CA 132 1_555 ? ? ? ? ? ? ? 2.975 ? ? metalc10 metalc ? ? A THR 72 O ? ? ? 1_555 C CA . CA ? ? A THR 72 A CA 132 1_555 ? ? ? ? ? ? ? 2.871 ? ? metalc11 metalc ? ? A GLU 77 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 77 A CA 132 1_555 ? ? ? ? ? ? ? 2.971 ? ? metalc12 metalc ? ? A GLU 77 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 77 A CA 132 1_555 ? ? ? ? ? ? ? 2.840 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 CA ? D CA . ? A CA 133 ? 1_555 N ? A ALA 31 ? A ALA 31 ? 1_555 108.8 ? 2 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 CA ? D CA . ? A CA 133 ? 1_555 OD1 ? A ASP 32 ? A ASP 32 ? 1_555 121.1 ? 3 N ? A ALA 31 ? A ALA 31 ? 1_555 CA ? D CA . ? A CA 133 ? 1_555 OD1 ? A ASP 32 ? A ASP 32 ? 1_555 81.7 ? 4 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 CA ? D CA . ? A CA 133 ? 1_555 O ? A ASP 36 ? A ASP 36 ? 1_555 86.1 ? 5 N ? A ALA 31 ? A ALA 31 ? 1_555 CA ? D CA . ? A CA 133 ? 1_555 O ? A ASP 36 ? A ASP 36 ? 1_555 148.0 ? 6 OD1 ? A ASP 32 ? A ASP 32 ? 1_555 CA ? D CA . ? A CA 133 ? 1_555 O ? A ASP 36 ? A ASP 36 ? 1_555 115.4 ? 7 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 CA ? D CA . ? A CA 133 ? 1_555 OE1 ? A GLU 41 ? A GLU 41 ? 1_555 89.0 ? 8 N ? A ALA 31 ? A ALA 31 ? 1_555 CA ? D CA . ? A CA 133 ? 1_555 OE1 ? A GLU 41 ? A GLU 41 ? 1_555 79.4 ? 9 OD1 ? A ASP 32 ? A ASP 32 ? 1_555 CA ? D CA . ? A CA 133 ? 1_555 OE1 ? A GLU 41 ? A GLU 41 ? 1_555 148.4 ? 10 O ? A ASP 36 ? A ASP 36 ? 1_555 CA ? D CA . ? A CA 133 ? 1_555 OE1 ? A GLU 41 ? A GLU 41 ? 1_555 72.5 ? 11 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 CA ? D CA . ? A CA 133 ? 1_555 OE2 ? A GLU 41 ? A GLU 41 ? 1_555 132.6 ? 12 N ? A ALA 31 ? A ALA 31 ? 1_555 CA ? D CA . ? A CA 133 ? 1_555 OE2 ? A GLU 41 ? A GLU 41 ? 1_555 88.6 ? 13 OD1 ? A ASP 32 ? A ASP 32 ? 1_555 CA ? D CA . ? A CA 133 ? 1_555 OE2 ? A GLU 41 ? A GLU 41 ? 1_555 104.5 ? 14 O ? A ASP 36 ? A ASP 36 ? 1_555 CA ? D CA . ? A CA 133 ? 1_555 OE2 ? A GLU 41 ? A GLU 41 ? 1_555 61.7 ? 15 OE1 ? A GLU 41 ? A GLU 41 ? 1_555 CA ? D CA . ? A CA 133 ? 1_555 OE2 ? A GLU 41 ? A GLU 41 ? 1_555 50.1 ? 16 OD2 ? A ASP 66 ? A ASP 66 ? 1_555 CA ? C CA . ? A CA 132 ? 1_555 OD1 ? A ASP 68 ? A ASP 68 ? 1_555 96.8 ? 17 OD2 ? A ASP 66 ? A ASP 66 ? 1_555 CA ? C CA . ? A CA 132 ? 1_555 OG ? A SER 70 ? A SER 70 ? 1_555 62.3 ? 18 OD1 ? A ASP 68 ? A ASP 68 ? 1_555 CA ? C CA . ? A CA 132 ? 1_555 OG ? A SER 70 ? A SER 70 ? 1_555 62.4 ? 19 OD2 ? A ASP 66 ? A ASP 66 ? 1_555 CA ? C CA . ? A CA 132 ? 1_555 O ? A THR 72 ? A THR 72 ? 1_555 55.2 ? 20 OD1 ? A ASP 68 ? A ASP 68 ? 1_555 CA ? C CA . ? A CA 132 ? 1_555 O ? A THR 72 ? A THR 72 ? 1_555 151.8 ? 21 OG ? A SER 70 ? A SER 70 ? 1_555 CA ? C CA . ? A CA 132 ? 1_555 O ? A THR 72 ? A THR 72 ? 1_555 96.9 ? 22 OD2 ? A ASP 66 ? A ASP 66 ? 1_555 CA ? C CA . ? A CA 132 ? 1_555 OE1 ? A GLU 77 ? A GLU 77 ? 1_555 113.9 ? 23 OD1 ? A ASP 68 ? A ASP 68 ? 1_555 CA ? C CA . ? A CA 132 ? 1_555 OE1 ? A GLU 77 ? A GLU 77 ? 1_555 139.5 ? 24 OG ? A SER 70 ? A SER 70 ? 1_555 CA ? C CA . ? A CA 132 ? 1_555 OE1 ? A GLU 77 ? A GLU 77 ? 1_555 155.7 ? 25 O ? A THR 72 ? A THR 72 ? 1_555 CA ? C CA . ? A CA 132 ? 1_555 OE1 ? A GLU 77 ? A GLU 77 ? 1_555 65.7 ? 26 OD2 ? A ASP 66 ? A ASP 66 ? 1_555 CA ? C CA . ? A CA 132 ? 1_555 OE2 ? A GLU 77 ? A GLU 77 ? 1_555 128.0 ? 27 OD1 ? A ASP 68 ? A ASP 68 ? 1_555 CA ? C CA . ? A CA 132 ? 1_555 OE2 ? A GLU 77 ? A GLU 77 ? 1_555 96.0 ? 28 OG ? A SER 70 ? A SER 70 ? 1_555 CA ? C CA . ? A CA 132 ? 1_555 OE2 ? A GLU 77 ? A GLU 77 ? 1_555 158.2 ? 29 O ? A THR 72 ? A THR 72 ? 1_555 CA ? C CA . ? A CA 132 ? 1_555 OE2 ? A GLU 77 ? A GLU 77 ? 1_555 104.4 ? 30 OE1 ? A GLU 77 ? A GLU 77 ? 1_555 CA ? C CA . ? A CA 132 ? 1_555 OE2 ? A GLU 77 ? A GLU 77 ? 1_555 44.4 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 132 ? 5 'BINDING SITE FOR RESIDUE CA A 132' AC2 Software A CA 133 ? 5 'BINDING SITE FOR RESIDUE CA A 133' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 66 ? ASP A 66 . ? 1_555 ? 2 AC1 5 ASP A 68 ? ASP A 68 . ? 1_555 ? 3 AC1 5 SER A 70 ? SER A 70 . ? 1_555 ? 4 AC1 5 THR A 72 ? THR A 72 . ? 1_555 ? 5 AC1 5 GLU A 77 ? GLU A 77 . ? 1_555 ? 6 AC2 5 ASP A 30 ? ASP A 30 . ? 1_555 ? 7 AC2 5 ALA A 31 ? ALA A 31 . ? 1_555 ? 8 AC2 5 ASP A 32 ? ASP A 32 . ? 1_555 ? 9 AC2 5 ASP A 36 ? ASP A 36 . ? 1_555 ? 10 AC2 5 GLU A 41 ? GLU A 41 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 3 ? ? -139.34 -47.14 2 1 THR A 4 ? ? -161.86 117.26 3 1 ALA A 24 ? ? -58.10 -78.05 4 1 PHE A 29 ? ? -55.45 -70.30 5 1 SER A 38 ? ? -115.01 -166.18 6 1 THR A 44 ? ? -59.57 -76.97 7 1 MET A 48 ? ? -97.79 35.63 8 1 LEU A 49 ? ? -146.39 -47.98 9 1 ASN A 52 ? ? -149.70 53.15 10 1 THR A 54 ? ? -57.27 -178.52 11 1 ASP A 74 ? ? -75.93 -169.40 12 1 PHE A 75 ? ? -60.23 -75.78 13 1 MET A 86 ? ? -63.06 -75.97 14 1 GLU A 88 ? ? -54.51 103.57 15 1 ASP A 89 ? ? -178.04 86.51 16 1 MET B 116 ? ? -67.16 -72.31 17 1 ALA B 124 ? ? -50.85 -73.00 18 1 LEU B 126 ? ? 60.50 158.84 19 1 HIS B 130 ? ? 68.31 -65.72 20 2 MET A 3 ? ? -157.16 -46.15 21 2 ALA A 24 ? ? -46.01 -73.32 22 2 PHE A 29 ? ? -57.74 -73.87 23 2 ASP A 36 ? ? 52.28 -177.56 24 2 SER A 38 ? ? -102.02 -163.00 25 2 THR A 44 ? ? -58.83 -78.67 26 2 ASN A 52 ? ? -144.21 48.78 27 2 ASP A 74 ? ? -66.91 -174.00 28 2 PHE A 75 ? ? -59.89 -78.15 29 2 ASP A 89 ? ? 60.37 -175.71 30 2 MET B 116 ? ? -101.87 -65.06 31 2 ALA B 124 ? ? -78.51 -75.02 32 2 LEU B 126 ? ? 56.68 170.45 33 2 HIS B 130 ? ? -163.71 -67.44 34 3 SER A 2 ? ? 60.32 175.79 35 3 MET A 3 ? ? -176.99 -39.95 36 3 ALA A 24 ? ? -47.54 -74.27 37 3 PHE A 29 ? ? -58.71 -75.05 38 3 ASP A 36 ? ? 55.82 -175.21 39 3 SER A 38 ? ? -106.78 -164.13 40 3 THR A 44 ? ? -59.29 -75.95 41 3 ASN A 52 ? ? -144.24 51.08 42 3 THR A 54 ? ? -56.36 -178.31 43 3 ASP A 66 ? ? -68.91 97.50 44 3 ASP A 74 ? ? -71.47 -168.86 45 3 PHE A 75 ? ? -61.12 -73.59 46 3 MET B 116 ? ? 63.88 -76.89 47 3 LEU B 126 ? ? 59.64 159.73 48 4 MET A 3 ? ? -125.91 -50.76 49 4 THR A 4 ? ? -177.19 109.70 50 4 ALA A 24 ? ? -44.70 -77.22 51 4 ASP A 36 ? ? 56.45 -176.05 52 4 SER A 38 ? ? -102.87 -164.86 53 4 THR A 44 ? ? -58.64 -78.26 54 4 ASN A 52 ? ? -144.14 48.88 55 4 THR A 54 ? ? -58.38 179.52 56 4 ASP A 68 ? ? -149.16 22.10 57 4 ASP A 74 ? ? -64.82 -167.28 58 4 PHE A 75 ? ? -59.29 -80.42 59 4 LYS A 87 ? ? -62.77 81.74 60 4 ASP A 89 ? ? -58.97 89.73 61 4 ALA B 124 ? ? -66.86 -71.91 62 4 LEU B 126 ? ? 57.49 171.53 63 5 SER A 2 ? ? -168.27 92.63 64 5 MET A 3 ? ? -143.49 -47.15 65 5 THR A 4 ? ? -162.34 114.91 66 5 PHE A 29 ? ? -57.69 -75.16 67 5 SER A 38 ? ? -107.00 -164.42 68 5 THR A 44 ? ? -65.60 -79.00 69 5 ASN A 52 ? ? -144.19 44.93 70 5 PRO A 53 ? ? -52.44 107.83 71 5 ASP A 68 ? ? -148.60 21.50 72 5 ASP A 74 ? ? -77.42 -169.20 73 5 PHE A 75 ? ? -58.84 -81.25 74 5 GLU A 88 ? ? -97.75 32.23 75 5 ASP A 89 ? ? -177.31 -46.21 76 5 SER B 128 ? ? -153.46 -51.67 77 5 LYS B 129 ? ? -141.67 -65.97 78 6 MET A 3 ? ? -153.29 -64.91 79 6 ALA A 24 ? ? -51.96 -72.20 80 6 PHE A 29 ? ? -55.85 -70.45 81 6 ASP A 36 ? ? 56.04 -174.40 82 6 SER A 38 ? ? -111.66 -164.11 83 6 THR A 44 ? ? -58.72 -79.67 84 6 ASN A 52 ? ? -144.22 46.67 85 6 ASP A 74 ? ? -62.44 -170.24 86 6 PHE A 75 ? ? -60.09 -78.32 87 6 ALA B 124 ? ? -86.40 -72.39 88 6 LEU B 126 ? ? -170.17 106.18 89 6 SER B 128 ? ? -107.24 -73.51 90 6 HIS B 130 ? ? -143.18 31.34 91 7 MET A 3 ? ? -134.77 -55.88 92 7 ALA A 24 ? ? -44.23 -74.04 93 7 PHE A 29 ? ? -57.01 -74.35 94 7 SER A 38 ? ? -112.59 -163.69 95 7 THR A 44 ? ? -78.46 -75.76 96 7 ASN A 52 ? ? -144.19 51.13 97 7 THR A 54 ? ? -55.78 -177.08 98 7 ASP A 66 ? ? -57.35 92.11 99 7 ASP A 74 ? ? -58.11 -166.29 100 7 PHE A 75 ? ? -65.25 -79.85 101 7 ASP A 89 ? ? -161.85 -46.66 102 7 ALA B 124 ? ? -77.35 -70.34 103 7 LEU B 126 ? ? 64.37 -75.63 104 7 LYS B 129 ? ? -98.66 31.32 105 8 MET A 3 ? ? -166.04 -44.24 106 8 ALA A 24 ? ? -44.85 -80.13 107 8 PHE A 29 ? ? -58.69 -71.42 108 8 SER A 38 ? ? -102.78 -162.43 109 8 THR A 44 ? ? -57.65 -76.80 110 8 ASN A 52 ? ? -144.18 50.30 111 8 THR A 54 ? ? -54.34 173.33 112 8 ASP A 74 ? ? -63.53 -171.89 113 8 GLU A 88 ? ? 58.53 91.35 114 8 MET B 116 ? ? 65.50 -70.22 115 8 SER B 117 ? ? -90.66 39.38 116 8 HIS B 130 ? ? -67.29 -74.73 117 9 ALA A 24 ? ? -45.11 -75.43 118 9 PHE A 29 ? ? -54.51 -75.19 119 9 ASP A 36 ? ? 52.72 -173.83 120 9 SER A 38 ? ? -106.77 -164.52 121 9 THR A 44 ? ? -65.01 -80.46 122 9 ASN A 52 ? ? -144.16 48.52 123 9 THR A 54 ? ? -61.34 -175.37 124 9 ASP A 74 ? ? -73.31 -167.19 125 9 PHE A 75 ? ? -55.95 -79.69 126 9 GLU A 88 ? ? 63.63 -79.92 127 9 ALA B 124 ? ? -84.67 -70.15 128 9 LEU B 126 ? ? -52.58 101.18 129 10 MET A 3 ? ? -174.33 -60.16 130 10 THR A 4 ? ? -176.21 119.69 131 10 ALA A 24 ? ? -42.44 -75.08 132 10 PHE A 29 ? ? -58.17 -74.65 133 10 ASP A 36 ? ? 54.67 -176.32 134 10 THR A 44 ? ? -58.07 -78.11 135 10 ASN A 52 ? ? -144.23 50.57 136 10 THR A 54 ? ? -57.02 -170.03 137 10 ASP A 74 ? ? -71.08 -168.72 138 10 PHE A 75 ? ? -61.48 -79.63 139 10 MET B 116 ? ? -93.40 -66.40 140 10 ALA B 124 ? ? -77.29 -73.94 141 10 LEU B 126 ? ? 60.40 157.90 142 11 MET A 3 ? ? -134.82 -46.58 143 11 ALA A 24 ? ? -40.03 -77.03 144 11 ASP A 36 ? ? 57.17 -177.86 145 11 THR A 44 ? ? -55.52 -78.52 146 11 ASN A 52 ? ? -144.23 50.32 147 11 THR A 54 ? ? -57.66 -179.82 148 11 ASP A 74 ? ? -62.87 -169.62 149 11 PHE A 75 ? ? -58.31 -80.17 150 11 GLU A 88 ? ? 64.62 152.37 151 11 MET B 116 ? ? 59.08 161.16 152 11 ALA B 124 ? ? -79.72 -73.59 153 11 LEU B 126 ? ? 61.81 150.58 154 11 LYS B 129 ? ? -64.69 80.47 155 12 MET A 3 ? ? -162.21 -44.97 156 12 ALA A 24 ? ? -48.05 -70.93 157 12 THR A 44 ? ? -58.01 -79.43 158 12 ASN A 52 ? ? -144.26 55.05 159 12 THR A 54 ? ? -52.48 171.58 160 12 ASP A 68 ? ? -148.11 21.40 161 12 ASP A 74 ? ? -68.70 -166.60 162 12 PHE A 75 ? ? -57.51 -84.74 163 12 ALA B 124 ? ? -84.89 -75.74 164 12 LYS B 129 ? ? -172.74 -41.82 165 13 MET A 3 ? ? -146.03 -48.20 166 13 THR A 4 ? ? -179.38 117.97 167 13 PHE A 29 ? ? -60.26 -75.26 168 13 SER A 38 ? ? -79.25 -163.53 169 13 THR A 44 ? ? -56.79 -76.66 170 13 ASN A 52 ? ? -144.26 48.74 171 13 THR A 54 ? ? -59.90 -175.60 172 13 GLU A 67 ? ? 46.27 28.90 173 13 ASP A 68 ? ? -165.64 -46.89 174 13 ASP A 74 ? ? -60.14 -169.87 175 13 PHE A 75 ? ? -68.77 -82.96 176 13 GLU A 88 ? ? 60.24 163.56 177 13 ALA B 124 ? ? -83.42 -75.18 178 13 SER B 128 ? ? 61.15 -177.40 179 13 HIS B 130 ? ? -131.36 -51.48 180 14 SER A 2 ? ? -106.86 -169.72 181 14 MET A 3 ? ? -176.61 -62.57 182 14 ALA A 24 ? ? -44.63 -78.74 183 14 PHE A 29 ? ? -55.78 -71.93 184 14 ASP A 36 ? ? 58.95 -177.05 185 14 SER A 38 ? ? -101.57 -163.03 186 14 THR A 44 ? ? -74.30 -77.43 187 14 ASN A 52 ? ? -144.32 52.94 188 14 THR A 54 ? ? -54.78 179.30 189 14 ASP A 68 ? ? -155.60 -45.20 190 14 ASP A 74 ? ? -70.04 -167.05 191 14 ALA B 124 ? ? -82.07 -71.37 192 14 LEU B 126 ? ? 59.60 160.31 193 14 SER B 128 ? ? 58.92 173.95 194 15 MET A 3 ? ? -161.97 -49.05 195 15 THR A 4 ? ? -175.47 113.70 196 15 ALA A 24 ? ? -46.06 -71.54 197 15 ALA A 31 ? ? 63.96 -68.50 198 15 THR A 44 ? ? -54.32 -78.19 199 15 ASN A 52 ? ? -144.09 55.46 200 15 THR A 54 ? ? -57.56 -177.94 201 15 ASP A 68 ? ? -149.54 22.06 202 15 ASP A 74 ? ? -73.28 -167.85 203 15 PHE A 75 ? ? -62.60 -81.84 204 15 LYS A 87 ? ? -69.41 67.87 205 15 MET B 116 ? ? 63.78 -77.76 206 15 ALA B 120 ? ? -51.17 -70.35 207 15 ALA B 124 ? ? -77.53 -76.50 208 15 SER B 128 ? ? -154.30 -67.51 209 16 SER A 2 ? ? 62.74 147.15 210 16 MET A 3 ? ? -158.53 -45.90 211 16 ALA A 24 ? ? -45.81 -73.22 212 16 ASP A 36 ? ? 55.31 -175.21 213 16 THR A 44 ? ? -56.69 -78.18 214 16 ASN A 52 ? ? -144.22 51.21 215 16 THR A 54 ? ? -56.45 -178.89 216 16 ASP A 74 ? ? -78.68 -169.37 217 16 PHE A 75 ? ? -62.14 -70.29 218 16 ALA B 124 ? ? -57.49 -79.21 219 16 LEU B 126 ? ? 54.62 175.84 220 16 SER B 128 ? ? -174.93 -175.88 221 17 MET A 3 ? ? -174.12 -41.41 222 17 ALA A 24 ? ? -43.83 -78.28 223 17 PHE A 29 ? ? -56.84 -73.26 224 17 SER A 38 ? ? -119.18 -164.34 225 17 THR A 44 ? ? -57.04 -76.41 226 17 ASN A 52 ? ? -144.14 51.74 227 17 THR A 54 ? ? -59.01 -177.44 228 17 ASP A 74 ? ? -72.38 -168.54 229 17 PHE A 75 ? ? -60.34 -77.97 230 17 ASP A 89 ? ? 60.22 159.02 231 17 SER B 117 ? ? -57.32 -100.26 232 17 ALA B 118 ? ? 68.44 -26.00 233 17 ALA B 124 ? ? -76.77 -74.44 234 17 LEU B 126 ? ? 58.22 178.21 235 17 LYS B 129 ? ? -168.59 119.03 236 18 SER A 2 ? ? 60.54 104.26 237 18 MET A 3 ? ? -164.97 -43.93 238 18 ALA A 24 ? ? -45.13 -78.09 239 18 THR A 44 ? ? -57.66 -76.84 240 18 ASN A 52 ? ? -144.12 51.60 241 18 THR A 54 ? ? -56.12 174.91 242 18 ASP A 68 ? ? -138.23 -45.42 243 18 ASP A 74 ? ? -69.78 -165.32 244 18 PHE A 75 ? ? -62.67 -73.17 245 18 MET B 116 ? ? 63.21 -78.40 246 18 SER B 117 ? ? -49.30 -91.89 247 18 ALA B 118 ? ? 69.09 -40.27 248 18 ALA B 124 ? ? -77.21 -71.87 249 18 HIS B 130 ? ? -130.85 -46.42 250 19 MET A 3 ? ? -153.17 -48.54 251 19 THR A 4 ? ? -177.07 119.97 252 19 ALA A 24 ? ? -45.05 -72.20 253 19 PHE A 29 ? ? -59.08 -75.63 254 19 ASP A 36 ? ? 52.75 -163.48 255 19 SER A 38 ? ? -105.78 -164.21 256 19 THR A 44 ? ? -57.21 -75.82 257 19 ASN A 52 ? ? -144.22 58.65 258 19 THR A 54 ? ? -56.15 179.23 259 19 ASP A 68 ? ? -155.92 26.03 260 19 ASP A 74 ? ? -52.59 -179.17 261 19 PHE A 75 ? ? -51.71 -77.36 262 19 GLU A 88 ? ? 61.14 -170.71 263 19 MET B 116 ? ? -62.06 -72.43 264 19 ALA B 120 ? ? -51.79 -70.16 265 19 ALA B 124 ? ? -58.29 -71.54 266 19 LEU B 126 ? ? 65.11 -71.76 267 19 LYS B 129 ? ? -140.22 30.34 268 20 MET A 3 ? ? -144.04 -62.75 269 20 ALA A 24 ? ? -47.95 -71.94 270 20 SER A 38 ? ? -104.18 -164.34 271 20 THR A 44 ? ? -62.47 -81.26 272 20 ASN A 52 ? ? -144.17 54.34 273 20 THR A 54 ? ? -55.25 173.60 274 20 ASP A 68 ? ? -148.60 21.26 275 20 ASP A 74 ? ? -70.57 -165.59 276 20 PHE A 75 ? ? -62.96 -78.82 277 20 GLU A 88 ? ? 75.26 -58.59 278 20 ASP A 89 ? ? 74.29 146.64 279 20 ALA B 120 ? ? -47.42 -72.79 280 20 ALA B 124 ? ? -52.40 -72.66 281 21 MET A 3 ? ? -158.57 -43.53 282 21 ALA A 24 ? ? -44.17 -73.32 283 21 PHE A 29 ? ? -57.30 -74.07 284 21 SER A 38 ? ? -110.06 -164.76 285 21 THR A 44 ? ? -56.61 -77.57 286 21 ASN A 52 ? ? -144.33 52.54 287 21 THR A 54 ? ? -60.29 -176.31 288 21 PHE A 75 ? ? -62.10 -74.79 289 21 ASP A 89 ? ? -158.13 29.20 290 21 MET B 116 ? ? -58.66 -165.57 291 21 SER B 117 ? ? 52.86 -109.26 292 21 ALA B 118 ? ? 70.75 -23.48 293 21 ALA B 124 ? ? -76.85 -79.44 294 21 LEU B 126 ? ? 53.08 179.74 295 21 HIS B 130 ? ? -150.82 88.43 # _pdbx_nmr_ensemble.entry_id 1NPQ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 21 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1NPQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '320 mM KCl, 10 mM imidazole, 1.3% NaN3, pH 6.5, ~1mM sNTnC.2Ca2+.TnI115-131.BR56-63' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambiant _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '320 mM KCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_15N/13C-NOESY 3 1 1 HNHA 4 1 1 2D_13C/15N-edited-NOESY 5 1 1 2D_13C/15N-filtered/edited-NOESY # _pdbx_nmr_details.entry_id 1NPQ _pdbx_nmr_details.text ;The structure was determined using triple-resonance spectroscopy. The chemical shifts for TnI115-131 were obtained from a 2D_15N/13C_filtered-DIPSI experiment. Intramolecular NOEs for TnI115-131 were obtained from a 2D_15N/13C_filtered-NOESY experiment. ; # _pdbx_nmr_refine.entry_id 1NPQ _pdbx_nmr_refine.method ;simulated annealing using torsion angle dynamics AND cartesian dynamics with the program CNS 1.1 ; _pdbx_nmr_refine.details ;calcium restraints were introduced only during the 2nd cooling stage using cartesian dynamics. See table 3 of the reference paper for a detailed description of the distance and dihedral restraints. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal CNS 1.1 'structure solution' A.T.Brunger 1 NMRPipe 'Feb 2002' processing 'Frank Delaglio' 2 NMRView 5.0.4 'data analysis' 'Bruce Johnson' 3 Procheck 3.5.4 'data analysis' Laskowski 4 CNS 1.1 refinement A.T.Brunger 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 ILE N N N N 159 ILE CA C N S 160 ILE C C N N 161 ILE O O N N 162 ILE CB C N S 163 ILE CG1 C N N 164 ILE CG2 C N N 165 ILE CD1 C N N 166 ILE OXT O N N 167 ILE H H N N 168 ILE H2 H N N 169 ILE HA H N N 170 ILE HB H N N 171 ILE HG12 H N N 172 ILE HG13 H N N 173 ILE HG21 H N N 174 ILE HG22 H N N 175 ILE HG23 H N N 176 ILE HD11 H N N 177 ILE HD12 H N N 178 ILE HD13 H N N 179 ILE HXT H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 VAL N N N N 319 VAL CA C N S 320 VAL C C N N 321 VAL O O N N 322 VAL CB C N N 323 VAL CG1 C N N 324 VAL CG2 C N N 325 VAL OXT O N N 326 VAL H H N N 327 VAL H2 H N N 328 VAL HA H N N 329 VAL HB H N N 330 VAL HG11 H N N 331 VAL HG12 H N N 332 VAL HG13 H N N 333 VAL HG21 H N N 334 VAL HG22 H N N 335 VAL HG23 H N N 336 VAL HXT H N N 337 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 VAL N CA sing N N 304 VAL N H sing N N 305 VAL N H2 sing N N 306 VAL CA C sing N N 307 VAL CA CB sing N N 308 VAL CA HA sing N N 309 VAL C O doub N N 310 VAL C OXT sing N N 311 VAL CB CG1 sing N N 312 VAL CB CG2 sing N N 313 VAL CB HB sing N N 314 VAL CG1 HG11 sing N N 315 VAL CG1 HG12 sing N N 316 VAL CG1 HG13 sing N N 317 VAL CG2 HG21 sing N N 318 VAL CG2 HG22 sing N N 319 VAL CG2 HG23 sing N N 320 VAL OXT HXT sing N N 321 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 800 2 ? Varian UNITY 600 3 ? Varian INOVA 500 # _atom_sites.entry_id 1NPQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_