data_1NTP # _entry.id 1NTP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1NTP WWPDB D_1000175397 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NTP _pdbx_database_status.recvd_initial_deposition_date 1987-09-16 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Kossiakoff, A.A.' _audit_author.pdbx_ordinal 1 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Use of the neutron diffraction--H/D exchange technique to determine the conformational dynamics of trypsin' 'Basic Life Sci.' 27 281 304 1984 BLFSBY US 0090-5542 0658 ? 6712567 ? 1 'Protein Dynamics Investigated by the Neutron Diffraction-Hydrogen Exchange Technique' Nature 296 713 ? 1982 NATUAS UK 0028-0836 0006 ? ? ? 2 ;Direct Determination of the Protonation States of Aspartic Acid-102 and Histidine-57 in the Tetrahedral Intermediate of the Serine Proteases. Neutron Structure of Trypsin ; Biochemistry 20 6462 ? 1981 BICHAW US 0006-2960 0033 ? ? ? 3 'Neutron Diffraction Identifies His 57 as the Catalytic Base in Trypsin' Nature 288 414 ? 1980 NATUAS UK 0028-0836 0006 ? ? ? 4 'The Accuracy of Refined Protein Structures, Comparison of Two Independently Refined Models of Bovine Trypsin' 'Acta Crystallogr.,Sect.B' 35 1861 ? 1979 ASBSDK DK 0108-7681 0622 ? ? ? 5 'Difference-Fourier Refinement of the Structure of Dip-Trypsin at 1.5 Angstroms Using a Minicomputer Technique' 'Acta Crystallogr.,Sect.B' 33 1824 ? 1977 ASBSDK DK 0108-7681 0622 ? ? ? 6 'Structure-Function Relationships in the Serine Proteases' 'Proteases and Biological Control' ? 13 ? 1975 ? ? 0-87969-144-X 0988 'Cold Spring Harbor Lab.,Cold Spring Harbor,N.Y.' ? ? 7 'Silver Ion Inhibition of Serine Proteases, Crystallographic Study of Silver-Trypsin' Biochem.Biophys.Res.Commun. 59 70 ? 1974 BBRCA9 US 0006-291X 0146 ? ? ? 8 'The Structure of Bovine Trypsin,Electron Density Maps of the Inhibited Enzyme at 5 Angstroms and at 2.7 Angstroms Resolution' J.Mol.Biol. 83 185 ? 1974 JMOBAK UK 0022-2836 0070 ? ? ? 9 'Structure and Specific Binding of Trypsin, Comparison of Inhibited Derivatives and a Model for Substrate Binding' J.Mol.Biol. 83 209 ? 1974 JMOBAK UK 0022-2836 0070 ? ? ? 10 'The Crystal and Molecular Structure of Dip-Inhibited Bovine Trypsin at 2.7 Angstroms Resolution' 'Cold Spring Harbor Symp.Quant.Biol.' 36 125 ? 1972 CSHSAZ US 0091-7451 0421 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kossiakoff, A.A.' 1 1 'Kossiakoff, A.A.' 2 2 'Kossiakoff, A.A.' 3 2 'Spencer, S.A.' 4 3 'Kossiakoff, A.A.' 5 3 'Spencer, S.A.' 6 4 'Chambers, J.L.' 7 4 'Stroud, R.M.' 8 5 'Chambers, J.L.' 9 5 'Stroud, R.M.' 10 6 'Stroud, R.M.' 11 6 'Krieger, M.' 12 6 'Koeppeii, R.E.' 13 6 'Kossiakoff, A.A.' 14 6 'Chambers, J.L.' 15 7 'Chambers, J.L.' 16 7 'Christoph, G.G.' 17 7 'Krieger, M.' 18 7 'Kay, L.' 19 7 'Stroud, R.M.' 20 8 'Stroud, R.M.' 21 8 'Kay, L.M.' 22 8 'Dickerson, R.E.' 23 9 'Krieger, M.' 24 9 'Kay, L.M.' 25 9 'Stroud, R.M.' 26 10 'Stroud, R.M.' 27 10 'Kay, L.M.' 28 10 'Dickerson, R.E.' 29 # loop_ _citation_editor.citation_id _citation_editor.name _citation_editor.ordinal 6 'Reich, E.' 1 6 'Rifkin, D.B.' 2 6 'Shaw, E.' 3 # _cell.entry_id 1NTP _cell.length_a 54.840 _cell.length_b 58.610 _cell.length_c 67.470 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1NTP _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man BETA-TRYPSIN 23327.242 1 3.4.21.4 ? ? ? 2 non-polymer syn PHOSPHORYLISOPROPANE 140.075 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLIDSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYDSNT LNNDIMLIKLKSAASLDSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _entity_poly.pdbx_seq_one_letter_code_can ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLIDSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYDSNT LNNDIMLIKLKSAASLDSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 TYR n 1 6 THR n 1 7 CYS n 1 8 GLY n 1 9 ALA n 1 10 ASN n 1 11 THR n 1 12 VAL n 1 13 PRO n 1 14 TYR n 1 15 GLN n 1 16 VAL n 1 17 SER n 1 18 LEU n 1 19 ASN n 1 20 SER n 1 21 GLY n 1 22 TYR n 1 23 HIS n 1 24 PHE n 1 25 CYS n 1 26 GLY n 1 27 GLY n 1 28 SER n 1 29 LEU n 1 30 ILE n 1 31 ASP n 1 32 SER n 1 33 GLN n 1 34 TRP n 1 35 VAL n 1 36 VAL n 1 37 SER n 1 38 ALA n 1 39 ALA n 1 40 HIS n 1 41 CYS n 1 42 TYR n 1 43 LYS n 1 44 SER n 1 45 GLY n 1 46 ILE n 1 47 GLN n 1 48 VAL n 1 49 ARG n 1 50 LEU n 1 51 GLY n 1 52 GLU n 1 53 ASP n 1 54 ASN n 1 55 ILE n 1 56 ASN n 1 57 VAL n 1 58 VAL n 1 59 GLU n 1 60 GLY n 1 61 ASN n 1 62 GLU n 1 63 GLN n 1 64 PHE n 1 65 ILE n 1 66 SER n 1 67 ALA n 1 68 SER n 1 69 LYS n 1 70 SER n 1 71 ILE n 1 72 VAL n 1 73 HIS n 1 74 PRO n 1 75 SER n 1 76 TYR n 1 77 ASP n 1 78 SER n 1 79 ASN n 1 80 THR n 1 81 LEU n 1 82 ASN n 1 83 ASN n 1 84 ASP n 1 85 ILE n 1 86 MET n 1 87 LEU n 1 88 ILE n 1 89 LYS n 1 90 LEU n 1 91 LYS n 1 92 SER n 1 93 ALA n 1 94 ALA n 1 95 SER n 1 96 LEU n 1 97 ASP n 1 98 SER n 1 99 ARG n 1 100 VAL n 1 101 ALA n 1 102 SER n 1 103 ILE n 1 104 SER n 1 105 LEU n 1 106 PRO n 1 107 THR n 1 108 SER n 1 109 CYS n 1 110 ALA n 1 111 SER n 1 112 ALA n 1 113 GLY n 1 114 THR n 1 115 GLN n 1 116 CYS n 1 117 LEU n 1 118 ILE n 1 119 SER n 1 120 GLY n 1 121 TRP n 1 122 GLY n 1 123 ASN n 1 124 THR n 1 125 LYS n 1 126 SER n 1 127 SER n 1 128 GLY n 1 129 THR n 1 130 SER n 1 131 TYR n 1 132 PRO n 1 133 ASP n 1 134 VAL n 1 135 LEU n 1 136 LYS n 1 137 CYS n 1 138 LEU n 1 139 LYS n 1 140 ALA n 1 141 PRO n 1 142 ILE n 1 143 LEU n 1 144 SER n 1 145 ASP n 1 146 SER n 1 147 SER n 1 148 CYS n 1 149 LYS n 1 150 SER n 1 151 ALA n 1 152 TYR n 1 153 PRO n 1 154 GLY n 1 155 GLN n 1 156 ILE n 1 157 THR n 1 158 SER n 1 159 ASN n 1 160 MET n 1 161 PHE n 1 162 CYS n 1 163 ALA n 1 164 GLY n 1 165 TYR n 1 166 LEU n 1 167 GLU n 1 168 GLY n 1 169 GLY n 1 170 LYS n 1 171 ASP n 1 172 SER n 1 173 CYS n 1 174 GLN n 1 175 GLY n 1 176 ASP n 1 177 SER n 1 178 GLY n 1 179 GLY n 1 180 PRO n 1 181 VAL n 1 182 VAL n 1 183 CYS n 1 184 SER n 1 185 GLY n 1 186 LYS n 1 187 LEU n 1 188 GLN n 1 189 GLY n 1 190 ILE n 1 191 VAL n 1 192 SER n 1 193 TRP n 1 194 GLY n 1 195 SER n 1 196 GLY n 1 197 CYS n 1 198 ALA n 1 199 GLN n 1 200 LYS n 1 201 ASN n 1 202 LYS n 1 203 PRO n 1 204 GLY n 1 205 VAL n 1 206 TYR n 1 207 THR n 1 208 LYS n 1 209 VAL n 1 210 CYS n 1 211 ASN n 1 212 TYR n 1 213 VAL n 1 214 SER n 1 215 TRP n 1 216 ILE n 1 217 LYS n 1 218 GLN n 1 219 THR n 1 220 ILE n 1 221 ALA n 1 222 SER n 1 223 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRY1_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00760 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;FIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEG NEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKA PILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTI ASN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NTP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 223 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00760 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 243 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 16 _struct_ref_seq.pdbx_auth_seq_align_end 245 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1NTP ASP A 31 ? UNP P00760 ASN 51 CONFLICT 48 1 1 1NTP ASP A 77 ? UNP P00760 ASN 97 CONFLICT 95 2 1 1NTP ASP A 97 ? UNP P00760 ASN 117 CONFLICT 115 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 ISP non-polymer . PHOSPHORYLISOPROPANE ? 'C3 H9 O4 P' 140.075 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1NTP _exptl.method 'NEUTRON DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type neutron # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1NTP _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 1.8 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.187 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'NEUTRON DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'NEUTRON DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 3216 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3230 _refine_hist.d_res_high 1.8 _refine_hist.d_res_low . # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function o_bond_d 0.013 ? ? ? 'NEUTRON DIFFRACTION' ? o_bond_d_na ? ? ? ? 'NEUTRON DIFFRACTION' ? o_bond_d_prot ? ? ? ? 'NEUTRON DIFFRACTION' ? o_angle_d ? ? ? ? 'NEUTRON DIFFRACTION' ? o_angle_d_na ? ? ? ? 'NEUTRON DIFFRACTION' ? o_angle_d_prot ? ? ? ? 'NEUTRON DIFFRACTION' ? o_angle_deg 2.3 ? ? ? 'NEUTRON DIFFRACTION' ? o_angle_deg_na ? ? ? ? 'NEUTRON DIFFRACTION' ? o_angle_deg_prot ? ? ? ? 'NEUTRON DIFFRACTION' ? o_dihedral_angle_d ? ? ? ? 'NEUTRON DIFFRACTION' ? o_dihedral_angle_d_na ? ? ? ? 'NEUTRON DIFFRACTION' ? o_dihedral_angle_d_prot ? ? ? ? 'NEUTRON DIFFRACTION' ? o_improper_angle_d ? ? ? ? 'NEUTRON DIFFRACTION' ? o_improper_angle_d_na ? ? ? ? 'NEUTRON DIFFRACTION' ? o_improper_angle_d_prot ? ? ? ? 'NEUTRON DIFFRACTION' ? o_mcbond_it ? ? ? ? 'NEUTRON DIFFRACTION' ? o_mcangle_it ? ? ? ? 'NEUTRON DIFFRACTION' ? o_scbond_it ? ? ? ? 'NEUTRON DIFFRACTION' ? o_scangle_it ? ? ? ? 'NEUTRON DIFFRACTION' ? # _struct.entry_id 1NTP _struct.title 'USE OF THE NEUTRON DIFFRACTION H/D EXCHANGE TECHNIQUE TO DETERMINE THE CONFORMATIONAL DYNAMICS OF TRYPSIN' _struct.pdbx_descriptor 'MODIFIED BETA TRYPSIN (MONOISOPROPYLPHOSPHORYL INHIBITED) (E.C.3.4.21.4) (NEUTRON DATA)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NTP _struct_keywords.pdbx_keywords 'HYDROLASE (SERINE PROTEINASE)' _struct_keywords.text 'HYDROLASE (SERINE PROTEINASE)' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 SHO SER A 144 ? TYR A 152 ? SER A 164 TYR A 172 1 'IRREGULAR AFTER CYS 168' 9 HELX_P HELX_P2 310 LYS A 208 ? VAL A 213 ? LYS A 230 VAL A 235 5 'LEADS INTO TERMINAL ALPHA-HLX' 6 HELX_P HELX_P3 TER TYR A 212 ? ASN A 223 ? TYR A 234 ASN A 245 1 'C-TERMINAL HELIX' 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 137 SG ? ? A CYS 22 A CYS 157 1_555 ? ? ? ? ? ? ? 1.874 ? disulf2 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 42 A CYS 58 1_555 ? ? ? ? ? ? ? 1.944 ? disulf3 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 210 SG ? ? A CYS 128 A CYS 232 1_555 ? ? ? ? ? ? ? 2.174 ? disulf4 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 183 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.073 ? disulf5 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 162 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 1.778 ? disulf6 disulf ? ? A CYS 173 SG ? ? ? 1_555 A CYS 197 SG ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.188 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details SH1 ? 7 ? SH2 ? 4 ? SH3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense SH1 1 2 ? anti-parallel SH1 2 3 ? anti-parallel SH1 3 4 ? anti-parallel SH1 4 5 ? anti-parallel SH1 5 6 ? anti-parallel SH1 6 7 ? anti-parallel SH2 1 2 ? anti-parallel SH2 2 3 ? anti-parallel SH2 3 4 ? anti-parallel SH3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id SH1 1 TYR A 5 ? TYR A 5 ? TYR A 20 TYR A 20 SH1 2 LYS A 136 ? PRO A 141 ? LYS A 156 PRO A 161 SH1 3 CYS A 116 ? GLY A 120 ? CYS A 136 GLY A 140 SH1 4 GLY A 179 ? CYS A 183 ? GLY A 197 CYS A 201 SH1 5 LYS A 186 ? SER A 192 ? LYS A 204 SER A 214 SH1 6 GLY A 204 ? VAL A 209 ? GLY A 226 VAL A 231 SH1 7 ASN A 159 ? ALA A 163 ? ASN A 179 ALA A 183 SH2 1 GLY A 26 ? SER A 28 ? GLY A 43 SER A 45 SH2 2 VAL A 35 ? ALA A 38 ? VAL A 52 ALA A 55 SH2 3 ILE A 85 ? LYS A 89 ? ILE A 103 LYS A 107 SH2 4 LYS A 69 ? HIS A 73 ? LYS A 87 HIS A 91 SH3 1 ILE A 46 ? LEU A 50 ? ILE A 63 LEU A 66 SH3 2 GLN A 63 ? ALA A 67 ? GLN A 81 ALA A 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id SH1 1 2 N TYR A 5 ? N TYR A 20 O CYS A 137 ? O CYS A 157 SH1 2 3 N LEU A 138 ? N LEU A 158 O ILE A 118 ? O ILE A 138 SH1 3 4 O LEU A 117 ? O LEU A 137 N VAL A 182 ? N VAL A 200 SH1 4 5 O GLY A 179 ? O GLY A 197 N VAL A 191 ? N VAL A 213 SH1 5 6 O ILE A 190 ? O ILE A 212 N THR A 207 ? N THR A 229 SH1 6 7 O TYR A 206 ? O TYR A 228 N PHE A 161 ? N PHE A 181 SH2 1 2 O SER A 28 ? O SER A 45 N VAL A 36 ? N VAL A 53 SH2 2 3 N SER A 37 ? N SER A 54 O MET A 86 ? O MET A 104 SH2 3 4 O ILE A 85 ? O ILE A 103 N HIS A 73 ? N HIS A 91 SH3 1 2 O LEU A 50 ? O LEU A 66 N GLN A 63 ? N GLN A 81 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details CAT Author ? ? ? ? 4 ;CATALYTIC SITE: THE OG ATOM OF SER-195 NUCLEOPHILICALLY ATTACKS THE SUBSTRATE CARBONYL CARBON ATOM. ASP-102 AND HIS-57 TOGETHER PROVIDE GENERAL BASE CATALYSIS. THE N-H GROUPS OF GLY-193 AND SER-195 STABILIZE REACTION INTERMEDIATES THROUGH H-BONDS TO THE SUBSTRATE CARBONYL OXYGEN ATOM. ; BIN Author ? ? ? ? 10 ;SPECIFIC BINDING POCKET: ASP-189 AT THE BOTTOM OF THIS POCKET FORMS AN H-BOND TO THE POSITIVELY CHARGED SIDE CHAIN OF A SPECIFIC SUBSTRATE, GIVING TRYPSIN ITS SPECIFICITY FOR THIS TYPE OF SIDE CHAIN. THE BACKBONE IN THE REGION FROM SER-214 TO CYS-220 IS INVOLVED IN HYDROGEN BONDING TO A PEPTIDE SUBSTRATE ; ION Author ? ? ? ? 11 ;CONTAINS A TIGHTLY BOUND POSITIVE ION WHICH IS PROBABLY A CA2+ IN THIS STRUCTURE. THE ION IS COORDINATED IN A ROUGHLY OCTAHEDRAL FASHION BY GLU 70, ASN 72, VAL 75, GLU 80, HOH 53 AND HOH 54. THIS REGION WAS FIRST IDENTIFIED AS THE PRIMARY CA2+ BINDING SITE OF TRYPSIN BY BODE AND SCHWAGER, F.E.B.S. LETT., VOL. 56, P139 (1975) ; # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CAT 4 HIS A 40 ? HIS A 57 . ? 1_555 ? 2 CAT 4 ASP A 84 ? ASP A 102 . ? 1_555 ? 3 CAT 4 GLY A 175 ? GLY A 193 . ? 1_555 ? 4 CAT 4 SER A 177 ? SER A 195 . ? 1_555 ? 5 BIN 10 ASP A 171 ? ASP A 189 . ? 1_555 ? 6 BIN 10 SER A 172 ? SER A 190 . ? 1_555 ? 7 BIN 10 CYS A 173 ? CYS A 191 . ? 1_555 ? 8 BIN 10 GLN A 174 ? GLN A 192 . ? 1_555 ? 9 BIN 10 SER A 192 ? SER A 214 . ? 1_555 ? 10 BIN 10 TRP A 193 ? TRP A 215 . ? 1_555 ? 11 BIN 10 GLY A 194 ? GLY A 216 . ? 1_555 ? 12 BIN 10 SER A 195 ? SER A 217 . ? 1_555 ? 13 BIN 10 GLY A 196 ? GLY A 219 . ? 1_555 ? 14 BIN 10 CYS A 197 ? CYS A 220 . ? 1_555 ? 15 ION 11 GLU A 52 ? GLU A 70 . ? 1_555 ? 16 ION 11 ASP A 53 ? ASP A 71 . ? 1_555 ? 17 ION 11 ASN A 54 ? ASN A 72 . ? 1_555 ? 18 ION 11 ILE A 55 ? ILE A 73 . ? 1_555 ? 19 ION 11 ASN A 56 ? ASN A 74 . ? 1_555 ? 20 ION 11 VAL A 57 ? VAL A 75 . ? 1_555 ? 21 ION 11 VAL A 58 ? VAL A 76 . ? 1_555 ? 22 ION 11 GLU A 59 ? GLU A 77 . ? 1_555 ? 23 ION 11 GLY A 60 ? GLY A 78 . ? 1_555 ? 24 ION 11 ASN A 61 ? ASN A 79 . ? 1_555 ? 25 ION 11 GLU A 62 ? GLU A 80 . ? 1_555 ? # _database_PDB_matrix.entry_id 1NTP _database_PDB_matrix.origx[1][1] 0.018235 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 0.017062 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 0.014821 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1NTP _atom_sites.fract_transf_matrix[1][1] 0.018235 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017062 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014821 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_sites_footnote.id _atom_sites_footnote.text 1 'SEE REMARK 4.' 2 'AN OCCUPANCY OF 0.0 INDICATES THAT NO SIGNIFICANT ELECTRON DENSITY WAS FOUND IN THE FINAL FOURIER MAP.' # loop_ _atom_type.symbol C D H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 16 16 ILE ILE A . n A 1 2 VAL 2 17 17 VAL VAL A . n A 1 3 GLY 3 18 18 GLY GLY A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 TYR 5 20 20 TYR TYR A . n A 1 6 THR 6 21 21 THR THR A . n A 1 7 CYS 7 22 22 CYS CYS A . n A 1 8 GLY 8 23 23 GLY GLY A . n A 1 9 ALA 9 24 24 ALA ALA A . n A 1 10 ASN 10 25 25 ASN ASN A . n A 1 11 THR 11 26 26 THR THR A . n A 1 12 VAL 12 27 27 VAL VAL A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 TYR 14 29 29 TYR TYR A . n A 1 15 GLN 15 30 30 GLN GLN A . n A 1 16 VAL 16 31 31 VAL VAL A . n A 1 17 SER 17 32 32 SER SER A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 ASN 19 34 34 ASN ASN A . n A 1 20 SER 20 37 37 SER SER A . n A 1 21 GLY 21 38 38 GLY GLY A . n A 1 22 TYR 22 39 39 TYR TYR A . n A 1 23 HIS 23 40 40 HIS HIS A . n A 1 24 PHE 24 41 41 PHE PHE A . n A 1 25 CYS 25 42 42 CYS CYS A . n A 1 26 GLY 26 43 43 GLY GLY A . n A 1 27 GLY 27 44 44 GLY GLY A . n A 1 28 SER 28 45 45 SER SER A . n A 1 29 LEU 29 46 46 LEU LEU A . n A 1 30 ILE 30 47 47 ILE ILE A . n A 1 31 ASP 31 48 48 ASP ASP A . n A 1 32 SER 32 49 49 SER SER A . n A 1 33 GLN 33 50 50 GLN GLN A . n A 1 34 TRP 34 51 51 TRP TRP A . n A 1 35 VAL 35 52 52 VAL VAL A . n A 1 36 VAL 36 53 53 VAL VAL A . n A 1 37 SER 37 54 54 SER SER A . n A 1 38 ALA 38 55 55 ALA ALA A . n A 1 39 ALA 39 56 56 ALA ALA A . n A 1 40 HIS 40 57 57 HIS HIS A . n A 1 41 CYS 41 58 58 CYS CYS A . n A 1 42 TYR 42 59 59 TYR TYR A . n A 1 43 LYS 43 60 60 LYS LYS A . n A 1 44 SER 44 61 61 SER SER A . n A 1 45 GLY 45 62 62 GLY GLY A . n A 1 46 ILE 46 63 63 ILE ILE A . n A 1 47 GLN 47 64 64 GLN GLN A . n A 1 48 VAL 48 65 65 VAL VAL A . n A 1 49 ARG 49 65 65 ARG ARG A A n A 1 50 LEU 50 66 66 LEU LEU A . n A 1 51 GLY 51 69 69 GLY GLY A . n A 1 52 GLU 52 70 70 GLU GLU A . n A 1 53 ASP 53 71 71 ASP ASP A . n A 1 54 ASN 54 72 72 ASN ASN A . n A 1 55 ILE 55 73 73 ILE ILE A . n A 1 56 ASN 56 74 74 ASN ASN A . n A 1 57 VAL 57 75 75 VAL VAL A . n A 1 58 VAL 58 76 76 VAL VAL A . n A 1 59 GLU 59 77 77 GLU GLU A . n A 1 60 GLY 60 78 78 GLY GLY A . n A 1 61 ASN 61 79 79 ASN ASN A . n A 1 62 GLU 62 80 80 GLU GLU A . n A 1 63 GLN 63 81 81 GLN GLN A . n A 1 64 PHE 64 82 82 PHE PHE A . n A 1 65 ILE 65 83 83 ILE ILE A . n A 1 66 SER 66 84 84 SER SER A . n A 1 67 ALA 67 85 85 ALA ALA A . n A 1 68 SER 68 86 86 SER SER A . n A 1 69 LYS 69 87 87 LYS LYS A . n A 1 70 SER 70 88 88 SER SER A . n A 1 71 ILE 71 89 89 ILE ILE A . n A 1 72 VAL 72 90 90 VAL VAL A . n A 1 73 HIS 73 91 91 HIS HIS A . n A 1 74 PRO 74 92 92 PRO PRO A . n A 1 75 SER 75 93 93 SER SER A . n A 1 76 TYR 76 94 94 TYR TYR A . n A 1 77 ASP 77 95 95 ASP ASP A . n A 1 78 SER 78 96 96 SER SER A . n A 1 79 ASN 79 97 97 ASN ASN A . n A 1 80 THR 80 98 98 THR THR A . n A 1 81 LEU 81 99 99 LEU LEU A . n A 1 82 ASN 82 100 100 ASN ASN A . n A 1 83 ASN 83 101 101 ASN ASN A . n A 1 84 ASP 84 102 102 ASP ASP A . n A 1 85 ILE 85 103 103 ILE ILE A . n A 1 86 MET 86 104 104 MET MET A . n A 1 87 LEU 87 105 105 LEU LEU A . n A 1 88 ILE 88 106 106 ILE ILE A . n A 1 89 LYS 89 107 107 LYS LYS A . n A 1 90 LEU 90 108 108 LEU LEU A . n A 1 91 LYS 91 109 109 LYS LYS A . n A 1 92 SER 92 110 110 SER SER A . n A 1 93 ALA 93 111 111 ALA ALA A . n A 1 94 ALA 94 112 112 ALA ALA A . n A 1 95 SER 95 113 113 SER SER A . n A 1 96 LEU 96 114 114 LEU LEU A . n A 1 97 ASP 97 115 115 ASP ASP A . n A 1 98 SER 98 116 116 SER SER A . n A 1 99 ARG 99 117 117 ARG ARG A . n A 1 100 VAL 100 118 118 VAL VAL A . n A 1 101 ALA 101 119 119 ALA ALA A . n A 1 102 SER 102 120 120 SER SER A . n A 1 103 ILE 103 121 121 ILE ILE A . n A 1 104 SER 104 122 122 SER SER A . n A 1 105 LEU 105 123 123 LEU LEU A . n A 1 106 PRO 106 124 124 PRO PRO A . n A 1 107 THR 107 125 125 THR THR A . n A 1 108 SER 108 127 127 SER SER A . n A 1 109 CYS 109 128 128 CYS CYS A . n A 1 110 ALA 110 129 129 ALA ALA A . n A 1 111 SER 111 130 130 SER SER A . n A 1 112 ALA 112 132 132 ALA ALA A . n A 1 113 GLY 113 133 133 GLY GLY A . n A 1 114 THR 114 134 134 THR THR A . n A 1 115 GLN 115 135 135 GLN GLN A . n A 1 116 CYS 116 136 136 CYS CYS A . n A 1 117 LEU 117 137 137 LEU LEU A . n A 1 118 ILE 118 138 138 ILE ILE A . n A 1 119 SER 119 139 139 SER SER A . n A 1 120 GLY 120 140 140 GLY GLY A . n A 1 121 TRP 121 141 141 TRP TRP A . n A 1 122 GLY 122 142 142 GLY GLY A . n A 1 123 ASN 123 143 143 ASN ASN A . n A 1 124 THR 124 144 144 THR THR A . n A 1 125 LYS 125 145 145 LYS LYS A . n A 1 126 SER 126 146 146 SER SER A . n A 1 127 SER 127 147 147 SER SER A . n A 1 128 GLY 128 148 148 GLY GLY A . n A 1 129 THR 129 149 149 THR THR A . n A 1 130 SER 130 150 150 SER SER A . n A 1 131 TYR 131 151 151 TYR TYR A . n A 1 132 PRO 132 152 152 PRO PRO A . n A 1 133 ASP 133 153 153 ASP ASP A . n A 1 134 VAL 134 154 154 VAL VAL A . n A 1 135 LEU 135 155 155 LEU LEU A . n A 1 136 LYS 136 156 156 LYS LYS A . n A 1 137 CYS 137 157 157 CYS CYS A . n A 1 138 LEU 138 158 158 LEU LEU A . n A 1 139 LYS 139 159 159 LYS LYS A . n A 1 140 ALA 140 160 160 ALA ALA A . n A 1 141 PRO 141 161 161 PRO PRO A . n A 1 142 ILE 142 162 162 ILE ILE A . n A 1 143 LEU 143 163 163 LEU LEU A . n A 1 144 SER 144 164 164 SER SER A . n A 1 145 ASP 145 165 165 ASP ASP A . n A 1 146 SER 146 166 166 SER SER A . n A 1 147 SER 147 167 167 SER SER A . n A 1 148 CYS 148 168 168 CYS CYS A . n A 1 149 LYS 149 169 169 LYS LYS A . n A 1 150 SER 150 170 170 SER SER A . n A 1 151 ALA 151 171 171 ALA ALA A . n A 1 152 TYR 152 172 172 TYR TYR A . n A 1 153 PRO 153 173 173 PRO PRO A . n A 1 154 GLY 154 174 174 GLY GLY A . n A 1 155 GLN 155 175 175 GLN GLN A . n A 1 156 ILE 156 176 176 ILE ILE A . n A 1 157 THR 157 177 177 THR THR A . n A 1 158 SER 158 178 178 SER SER A . n A 1 159 ASN 159 179 179 ASN ASN A . n A 1 160 MET 160 180 180 MET MET A . n A 1 161 PHE 161 181 181 PHE PHE A . n A 1 162 CYS 162 182 182 CYS CYS A . n A 1 163 ALA 163 183 183 ALA ALA A . n A 1 164 GLY 164 184 184 GLY GLY A . n A 1 165 TYR 165 184 184 TYR TYR A A n A 1 166 LEU 166 185 185 LEU LEU A . n A 1 167 GLU 167 186 186 GLU GLU A . n A 1 168 GLY 168 187 187 GLY GLY A . n A 1 169 GLY 169 188 188 GLY GLY A . n A 1 170 LYS 170 188 188 LYS LYS A A n A 1 171 ASP 171 189 189 ASP ASP A . n A 1 172 SER 172 190 190 SER SER A . n A 1 173 CYS 173 191 191 CYS CYS A . n A 1 174 GLN 174 192 192 GLN GLN A . n A 1 175 GLY 175 193 193 GLY GLY A . n A 1 176 ASP 176 194 194 ASP ASP A . n A 1 177 SER 177 195 195 SER SER A . n A 1 178 GLY 178 196 196 GLY GLY A . n A 1 179 GLY 179 197 197 GLY GLY A . n A 1 180 PRO 180 198 198 PRO PRO A . n A 1 181 VAL 181 199 199 VAL VAL A . n A 1 182 VAL 182 200 200 VAL VAL A . n A 1 183 CYS 183 201 201 CYS CYS A . n A 1 184 SER 184 202 202 SER SER A . n A 1 185 GLY 185 203 203 GLY GLY A . n A 1 186 LYS 186 204 204 LYS LYS A . n A 1 187 LEU 187 209 209 LEU LEU A . n A 1 188 GLN 188 210 210 GLN GLN A . n A 1 189 GLY 189 211 211 GLY GLY A . n A 1 190 ILE 190 212 212 ILE ILE A . n A 1 191 VAL 191 213 213 VAL VAL A . n A 1 192 SER 192 214 214 SER SER A . n A 1 193 TRP 193 215 215 TRP TRP A . n A 1 194 GLY 194 216 216 GLY GLY A . n A 1 195 SER 195 217 217 SER SER A . n A 1 196 GLY 196 219 219 GLY GLY A . n A 1 197 CYS 197 220 220 CYS CYS A . n A 1 198 ALA 198 221 221 ALA ALA A . n A 1 199 GLN 199 221 221 GLN GLN A A n A 1 200 LYS 200 222 222 LYS LYS A . n A 1 201 ASN 201 223 223 ASN ASN A . n A 1 202 LYS 202 224 224 LYS LYS A . n A 1 203 PRO 203 225 225 PRO PRO A . n A 1 204 GLY 204 226 226 GLY GLY A . n A 1 205 VAL 205 227 227 VAL VAL A . n A 1 206 TYR 206 228 228 TYR TYR A . n A 1 207 THR 207 229 229 THR THR A . n A 1 208 LYS 208 230 230 LYS LYS A . n A 1 209 VAL 209 231 231 VAL VAL A . n A 1 210 CYS 210 232 232 CYS CYS A . n A 1 211 ASN 211 233 233 ASN ASN A . n A 1 212 TYR 212 234 234 TYR TYR A . n A 1 213 VAL 213 235 235 VAL VAL A . n A 1 214 SER 214 236 236 SER SER A . n A 1 215 TRP 215 237 237 TRP TRP A . n A 1 216 ILE 216 238 238 ILE ILE A . n A 1 217 LYS 217 239 239 LYS LYS A . n A 1 218 GLN 218 240 240 GLN GLN A . n A 1 219 THR 219 241 241 THR THR A . n A 1 220 ILE 220 242 242 ILE ILE A . n A 1 221 ALA 221 243 243 ALA ALA A . n A 1 222 SER 222 244 244 SER SER A . n A 1 223 ASN 223 245 245 ASN ASN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ISP _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 1 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id ISP _pdbx_nonpoly_scheme.auth_mon_id ISP _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1988-01-16 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_conf 3 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # _pdbx_entry_details.entry_id 1NTP _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ;THE ENZYME IS INHIBITED BY A MONOISOPROPYLPHOSPHORYL DERIVATIVE. THE REFINED STRUCTURE IN THIS REGION LOOKS VERY MUCH LIKE THAT EXPECTED FOR THE TETRAHEDRAL INTERMEDIATE IN THE REACTION SEQUENCE. THE NE2 OF HIS 57 IS HYDROGEN-BONDED TO O1A OF THE ISP GROUP, WHICH CORRESPONDS TO THE LEAVING GROUP NITROGEN OF A SPECIFIC SUBSTRATE. ; _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG A SER 195 ? ? P A ISP 1 ? ? 1.52 2 1 DZ1 A LYS 87 ? ? OD1 A ASN 245 ? ? 1.56 3 1 OE1 A GLN 221 A ? DZ3 A LYS 222 ? ? 1.59 4 1 OD1 A ASN 25 ? ? DH22 A ARG 117 ? ? 1.59 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 DZ1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 LYS _pdbx_validate_symm_contact.auth_seq_id_1 107 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 DG _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 SER _pdbx_validate_symm_contact.auth_seq_id_2 130 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_565 _pdbx_validate_symm_contact.dist 1.29 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE1 A TRP 51 ? ? CE2 A TRP 51 ? ? 1.293 1.371 -0.078 0.013 N 2 1 CA A SER 61 ? ? CB A SER 61 ? ? 1.619 1.525 0.094 0.015 N 3 1 CD A GLU 70 ? ? OE1 A GLU 70 ? ? 1.343 1.252 0.091 0.011 N 4 1 NE1 A TRP 237 ? ? CE2 A TRP 237 ? ? 1.278 1.371 -0.093 0.013 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A CYS 22 ? ? CB A CYS 22 ? ? SG A CYS 22 ? ? 120.89 114.20 6.69 1.10 N 2 1 CB A GLN 50 ? ? CA A GLN 50 ? ? C A GLN 50 ? ? 95.46 110.40 -14.94 2.00 N 3 1 CD1 A TYR 59 ? ? CG A TYR 59 ? ? CD2 A TYR 59 ? ? 126.88 117.90 8.98 1.10 N 4 1 CB A TYR 59 ? ? CG A TYR 59 ? ? CD1 A TYR 59 ? ? 111.88 121.00 -9.12 0.60 N 5 1 CG A TYR 59 ? ? CD1 A TYR 59 ? ? CE1 A TYR 59 ? ? 114.58 121.30 -6.72 0.80 N 6 1 CG A TYR 59 ? ? CD2 A TYR 59 ? ? CE2 A TYR 59 ? ? 114.84 121.30 -6.46 0.80 N 7 1 O A SER 61 ? ? C A SER 61 ? ? N A GLY 62 ? ? 112.78 123.20 -10.42 1.70 Y 8 1 NE A ARG 65 A ? CZ A ARG 65 A ? NH1 A ARG 65 A ? 117.23 120.30 -3.07 0.50 N 9 1 OE1 A GLU 80 ? ? CD A GLU 80 ? ? OE2 A GLU 80 ? ? 110.25 123.30 -13.05 1.20 N 10 1 CD1 A TYR 94 ? ? CG A TYR 94 ? ? CD2 A TYR 94 ? ? 124.82 117.90 6.92 1.10 N 11 1 CB A TYR 94 ? ? CG A TYR 94 ? ? CD1 A TYR 94 ? ? 117.06 121.00 -3.94 0.60 N 12 1 OD1 A ASP 102 ? ? CG A ASP 102 ? ? OD2 A ASP 102 ? ? 106.63 123.30 -16.67 1.90 N 13 1 CB A ASP 102 ? ? CG A ASP 102 ? ? OD1 A ASP 102 ? ? 127.54 118.30 9.24 0.90 N 14 1 CB A ASP 102 ? ? CG A ASP 102 ? ? OD2 A ASP 102 ? ? 125.81 118.30 7.51 0.90 N 15 1 NH1 A ARG 117 ? ? CZ A ARG 117 ? ? NH2 A ARG 117 ? ? 104.42 119.40 -14.98 1.10 N 16 1 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 124.27 120.30 3.97 0.50 N 17 1 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH2 A ARG 117 ? ? 131.30 120.30 11.00 0.50 N 18 1 O A THR 125 ? ? C A THR 125 ? ? N A SER 127 ? ? 132.42 122.70 9.72 1.60 Y 19 1 CB A TYR 151 ? ? CG A TYR 151 ? ? CD1 A TYR 151 ? ? 116.89 121.00 -4.11 0.60 N 20 1 CA A SER 164 ? ? C A SER 164 ? ? N A ASP 165 ? ? 103.11 117.20 -14.09 2.20 Y 21 1 O A SER 164 ? ? C A SER 164 ? ? N A ASP 165 ? ? 134.97 122.70 12.27 1.60 Y 22 1 N A ASP 165 ? ? CA A ASP 165 ? ? CB A ASP 165 ? ? 99.10 110.60 -11.50 1.80 N 23 1 CA A ASP 165 ? ? CB A ASP 165 ? ? CG A ASP 165 ? ? 129.08 113.40 15.68 2.20 N 24 1 OD1 A ASP 165 ? ? CG A ASP 165 ? ? OD2 A ASP 165 ? ? 109.89 123.30 -13.41 1.90 N 25 1 CB A ASP 165 ? ? CG A ASP 165 ? ? OD2 A ASP 165 ? ? 127.74 118.30 9.44 0.90 N 26 1 N A SER 170 ? ? CA A SER 170 ? ? CB A SER 170 ? ? 120.77 110.50 10.27 1.50 N 27 1 CB A TYR 172 ? ? CG A TYR 172 ? ? CD2 A TYR 172 ? ? 114.70 121.00 -6.30 0.60 N 28 1 CD1 A TYR 172 ? ? CG A TYR 172 ? ? CD2 A TYR 172 ? ? 124.76 117.90 6.86 1.10 N 29 1 CG A TYR 172 ? ? CD1 A TYR 172 ? ? CE1 A TYR 172 ? ? 115.25 121.30 -6.05 0.80 N 30 1 CG A TYR 172 ? ? CD2 A TYR 172 ? ? CE2 A TYR 172 ? ? 115.71 121.30 -5.59 0.80 N 31 1 CG A MET 180 ? ? SD A MET 180 ? ? CE A MET 180 ? ? 110.14 100.20 9.94 1.60 N 32 1 CD1 A TYR 184 A ? CE1 A TYR 184 A ? CZ A TYR 184 A ? 127.61 119.80 7.81 0.90 N 33 1 O A GLU 186 ? ? C A GLU 186 ? ? N A GLY 187 ? ? 111.64 123.20 -11.56 1.70 Y 34 1 CB A ASP 189 ? ? CG A ASP 189 ? ? OD1 A ASP 189 ? ? 112.88 118.30 -5.42 0.90 N 35 1 CB A GLN 192 ? ? CG A GLN 192 ? ? CD A GLN 192 ? ? 130.96 111.60 19.36 2.60 N 36 1 OD1 A ASP 194 ? ? CG A ASP 194 ? ? OD2 A ASP 194 ? ? 111.58 123.30 -11.72 1.90 N 37 1 CB A ASP 194 ? ? CG A ASP 194 ? ? OD1 A ASP 194 ? ? 123.84 118.30 5.54 0.90 N 38 1 CB A ASP 194 ? ? CG A ASP 194 ? ? OD2 A ASP 194 ? ? 124.55 118.30 6.25 0.90 N 39 1 O A LYS 204 ? ? C A LYS 204 ? ? N A LEU 209 ? ? 132.52 122.70 9.82 1.60 Y 40 1 O A GLY 211 ? ? C A GLY 211 ? ? N A ILE 212 ? ? 133.41 122.70 10.71 1.60 Y 41 1 N A LYS 222 ? ? CA A LYS 222 ? ? CB A LYS 222 ? ? 96.38 110.60 -14.22 1.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 54 ? ? -143.26 -158.60 2 1 ASP A 71 ? ? -122.09 -83.10 3 1 SER A 150 ? ? -162.37 114.91 4 1 LYS A 222 ? ? -36.96 129.33 5 1 ASN A 223 ? ? 72.81 -7.86 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 39 ? ? 0.122 'SIDE CHAIN' 2 1 TYR A 59 ? ? 0.071 'SIDE CHAIN' # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag N _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id ISP _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id O2P _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id B _pdbx_unobs_or_zero_occ_atoms.label_comp_id ISP _pdbx_unobs_or_zero_occ_atoms.label_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.label_atom_id O2P # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name PHOSPHORYLISOPROPANE _pdbx_entity_nonpoly.comp_id ISP #