data_1NYG # _entry.id 1NYG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1NYG pdb_00001nyg 10.2210/pdb1nyg/pdb WWPDB D_1000175410 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1NYF _pdbx_database_related.details . _pdbx_database_related.content_type 'representative structure' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NYG _pdbx_database_status.recvd_initial_deposition_date 1996-04-22 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Morton, C.J.' 1 'Pugh, D.J.R.' 2 'Campbell, I.D.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure and peptide binding of the SH3 domain from human Fyn.' Structure 4 705 714 1996 STRUE6 UK 0969-2126 2005 ? 8805554 '10.1016/S0969-2126(96)00076-7' 1 ;Crystal Structure of the SH3 Domain in Human Fyn; Comparison of the Three-Dimensional Structures of SH3 Domains in Tyrosine Kinases and Spectrin ; 'Embo J.' 12 2617 ? 1993 EMJODG UK 0261-4189 0897 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Morton, C.J.' 1 ? primary 'Pugh, D.J.' 2 ? primary 'Brown, E.L.' 3 ? primary 'Kahmann, J.D.' 4 ? primary 'Renzoni, D.A.' 5 ? primary 'Campbell, I.D.' 6 ? 1 'Noble, M.E.' 7 ? 1 'Musacchio, A.' 8 ? 1 'Saraste, M.' 9 ? 1 'Courtneidge, S.A.' 10 ? 1 'Wierenga, R.K.' 11 ? # _cell.entry_id 1NYG _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1NYG _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description FYN _entity.formula_weight 7554.108 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.1.112 _entity.pdbx_mutation 'INS(GS-T82)' _entity.pdbx_fragment 'SH3 DOMAIN, RESIDUES 82 - 148' _entity.details 'N-TERMINAL GS FROM EXPRESSION SYSTEM' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code TGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEE _entity_poly.pdbx_seq_one_letter_code_can TGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 GLY n 1 3 VAL n 1 4 THR n 1 5 LEU n 1 6 PHE n 1 7 VAL n 1 8 ALA n 1 9 LEU n 1 10 TYR n 1 11 ASP n 1 12 TYR n 1 13 GLU n 1 14 ALA n 1 15 ARG n 1 16 THR n 1 17 GLU n 1 18 ASP n 1 19 ASP n 1 20 LEU n 1 21 SER n 1 22 PHE n 1 23 HIS n 1 24 LYS n 1 25 GLY n 1 26 GLU n 1 27 LYS n 1 28 PHE n 1 29 GLN n 1 30 ILE n 1 31 LEU n 1 32 ASN n 1 33 SER n 1 34 SER n 1 35 GLU n 1 36 GLY n 1 37 ASP n 1 38 TRP n 1 39 TRP n 1 40 GLU n 1 41 ALA n 1 42 ARG n 1 43 SER n 1 44 LEU n 1 45 THR n 1 46 THR n 1 47 GLY n 1 48 GLU n 1 49 THR n 1 50 GLY n 1 51 TYR n 1 52 ILE n 1 53 PRO n 1 54 SER n 1 55 ASN n 1 56 TYR n 1 57 VAL n 1 58 ALA n 1 59 PRO n 1 60 VAL n 1 61 ASP n 1 62 SER n 1 63 ILE n 1 64 GLN n 1 65 ALA n 1 66 GLU n 1 67 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FYN_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P06241 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGG TGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAER QLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCR LVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKL KHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNG LICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVER GYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NYG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06241 _struct_ref_seq.db_align_beg 81 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 82 _struct_ref_seq.pdbx_auth_seq_align_end 148 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1NYG _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version 3.1 _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1NYG _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1NYG _struct.title 'NMR STUDY OF THE SH3 DOMAIN FROM FYN PROTO-ONCOGENE TYROSINE KINASE, FAMILY OF 20 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NYG _struct_keywords.pdbx_keywords PHOSPHOTRANSFERASE _struct_keywords.text 'SH3 DOMAIN, POLYPROLINE-BINDING, PHOSPHOTRANSFERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id HA _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 53 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 56 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 134 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 137 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1 ? 3 ? S2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel S2 1 2 ? anti-parallel S2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 LYS A 27 ? LEU A 31 ? LYS A 108 LEU A 112 S1 2 LEU A 5 ? ALA A 8 ? LEU A 86 ALA A 89 S1 3 VAL A 57 ? PRO A 59 ? VAL A 138 PRO A 140 S2 1 ASN A 32 ? SER A 33 ? ASN A 113 SER A 114 S2 2 TRP A 38 ? SER A 43 ? TRP A 119 SER A 124 S2 3 THR A 49 ? ILE A 52 ? THR A 130 ILE A 133 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 O PHE A 28 ? O PHE A 109 N PHE A 6 ? N PHE A 87 S1 2 3 N VAL A 7 ? N VAL A 88 O ALA A 58 ? O ALA A 139 S2 1 2 O ASN A 32 ? O ASN A 113 N GLU A 40 ? N GLU A 121 S2 2 3 N TRP A 39 ? N TRP A 120 O ILE A 52 ? O ILE A 133 # _database_PDB_matrix.entry_id 1NYG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1NYG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 82 ? ? ? A . n A 1 2 GLY 2 83 ? ? ? A . n A 1 3 VAL 3 84 84 VAL VAL A . n A 1 4 THR 4 85 85 THR THR A . n A 1 5 LEU 5 86 86 LEU LEU A . n A 1 6 PHE 6 87 87 PHE PHE A . n A 1 7 VAL 7 88 88 VAL VAL A . n A 1 8 ALA 8 89 89 ALA ALA A . n A 1 9 LEU 9 90 90 LEU LEU A . n A 1 10 TYR 10 91 91 TYR TYR A . n A 1 11 ASP 11 92 92 ASP ASP A . n A 1 12 TYR 12 93 93 TYR TYR A . n A 1 13 GLU 13 94 94 GLU GLU A . n A 1 14 ALA 14 95 95 ALA ALA A . n A 1 15 ARG 15 96 96 ARG ARG A . n A 1 16 THR 16 97 97 THR THR A . n A 1 17 GLU 17 98 98 GLU GLU A . n A 1 18 ASP 18 99 99 ASP ASP A . n A 1 19 ASP 19 100 100 ASP ASP A . n A 1 20 LEU 20 101 101 LEU LEU A . n A 1 21 SER 21 102 102 SER SER A . n A 1 22 PHE 22 103 103 PHE PHE A . n A 1 23 HIS 23 104 104 HIS HIS A . n A 1 24 LYS 24 105 105 LYS LYS A . n A 1 25 GLY 25 106 106 GLY GLY A . n A 1 26 GLU 26 107 107 GLU GLU A . n A 1 27 LYS 27 108 108 LYS LYS A . n A 1 28 PHE 28 109 109 PHE PHE A . n A 1 29 GLN 29 110 110 GLN GLN A . n A 1 30 ILE 30 111 111 ILE ILE A . n A 1 31 LEU 31 112 112 LEU LEU A . n A 1 32 ASN 32 113 113 ASN ASN A . n A 1 33 SER 33 114 114 SER SER A . n A 1 34 SER 34 115 115 SER SER A . n A 1 35 GLU 35 116 116 GLU GLU A . n A 1 36 GLY 36 117 117 GLY GLY A . n A 1 37 ASP 37 118 118 ASP ASP A . n A 1 38 TRP 38 119 119 TRP TRP A . n A 1 39 TRP 39 120 120 TRP TRP A . n A 1 40 GLU 40 121 121 GLU GLU A . n A 1 41 ALA 41 122 122 ALA ALA A . n A 1 42 ARG 42 123 123 ARG ARG A . n A 1 43 SER 43 124 124 SER SER A . n A 1 44 LEU 44 125 125 LEU LEU A . n A 1 45 THR 45 126 126 THR THR A . n A 1 46 THR 46 127 127 THR THR A . n A 1 47 GLY 47 128 128 GLY GLY A . n A 1 48 GLU 48 129 129 GLU GLU A . n A 1 49 THR 49 130 130 THR THR A . n A 1 50 GLY 50 131 131 GLY GLY A . n A 1 51 TYR 51 132 132 TYR TYR A . n A 1 52 ILE 52 133 133 ILE ILE A . n A 1 53 PRO 53 134 134 PRO PRO A . n A 1 54 SER 54 135 135 SER SER A . n A 1 55 ASN 55 136 136 ASN ASN A . n A 1 56 TYR 56 137 137 TYR TYR A . n A 1 57 VAL 57 138 138 VAL VAL A . n A 1 58 ALA 58 139 139 ALA ALA A . n A 1 59 PRO 59 140 140 PRO PRO A . n A 1 60 VAL 60 141 141 VAL VAL A . n A 1 61 ASP 61 142 ? ? ? A . n A 1 62 SER 62 143 ? ? ? A . n A 1 63 ILE 63 144 ? ? ? A . n A 1 64 GLN 64 145 ? ? ? A . n A 1 65 ALA 65 146 ? ? ? A . n A 1 66 GLU 66 147 ? ? ? A . n A 1 67 GLU 67 148 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-11-08 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 85 ? ? -150.46 86.69 2 1 ALA A 95 ? ? -41.85 103.73 3 1 SER A 114 ? ? -109.39 -81.96 4 1 GLU A 116 ? ? 40.15 -161.77 5 1 ASP A 118 ? ? -176.59 -36.50 6 2 ALA A 95 ? ? -52.25 96.47 7 2 THR A 97 ? ? -119.66 -169.75 8 2 PHE A 103 ? ? -172.83 -178.36 9 2 SER A 114 ? ? -155.79 84.95 10 2 SER A 115 ? ? -119.68 -79.25 11 2 GLU A 116 ? ? -106.18 -166.28 12 3 THR A 85 ? ? -162.12 65.23 13 3 ALA A 95 ? ? -46.53 93.22 14 3 PHE A 103 ? ? -178.64 -173.03 15 3 SER A 114 ? ? -161.52 82.90 16 3 SER A 115 ? ? -160.55 23.22 17 4 ALA A 95 ? ? -56.96 107.58 18 4 ASP A 118 ? ? -160.23 -74.46 19 4 THR A 126 ? ? -102.33 -64.64 20 5 PHE A 103 ? ? -161.98 -169.99 21 5 THR A 127 ? ? -91.79 -67.85 22 6 THR A 85 ? ? -150.85 79.97 23 6 ALA A 95 ? ? -42.05 96.48 24 6 SER A 114 ? ? -150.77 23.30 25 6 ASP A 118 ? ? -175.41 -41.56 26 7 THR A 85 ? ? -171.27 63.90 27 7 PHE A 103 ? ? -174.48 -173.75 28 7 SER A 114 ? ? -163.86 87.28 29 7 SER A 115 ? ? -92.44 53.79 30 7 GLU A 116 ? ? 49.40 100.55 31 8 ALA A 95 ? ? -48.25 108.28 32 8 PHE A 103 ? ? -179.22 -172.51 33 8 SER A 114 ? ? -118.45 -102.11 34 8 SER A 115 ? ? 38.64 47.27 35 8 ASP A 118 ? ? -152.23 25.10 36 9 ALA A 95 ? ? -51.64 97.88 37 9 SER A 114 ? ? -116.97 70.66 38 9 SER A 115 ? ? -89.06 -81.13 39 9 ASP A 118 ? ? -139.99 -55.47 40 10 ALA A 95 ? ? -56.46 107.66 41 10 PHE A 103 ? ? -175.21 -173.10 42 10 SER A 114 ? ? -107.41 48.55 43 10 GLU A 116 ? ? -104.65 -166.06 44 11 THR A 85 ? ? -164.75 87.90 45 11 LYS A 105 ? ? -55.76 109.73 46 11 ILE A 111 ? ? -50.23 101.03 47 11 SER A 114 ? ? -152.01 -87.20 48 11 SER A 115 ? ? 44.41 27.58 49 11 ASP A 118 ? ? 175.74 -39.20 50 12 THR A 85 ? ? -154.12 66.51 51 12 PHE A 103 ? ? 174.39 -171.34 52 12 SER A 114 ? ? -96.92 -79.19 53 12 GLU A 116 ? ? 46.94 -173.11 54 12 ASP A 118 ? ? -170.61 -49.21 55 12 THR A 126 ? ? -86.89 -70.46 56 13 PHE A 103 ? ? -178.88 -176.31 57 13 ASP A 118 ? ? -176.76 -53.44 58 13 THR A 126 ? ? -84.77 -70.26 59 14 ALA A 95 ? ? -53.16 103.56 60 14 PHE A 103 ? ? -174.01 -174.29 61 14 SER A 115 ? ? -93.63 -84.33 62 14 ASP A 118 ? ? -176.73 -63.71 63 15 THR A 85 ? ? -168.83 85.63 64 15 PHE A 103 ? ? 179.79 -174.93 65 15 SER A 114 ? ? -150.83 84.01 66 15 SER A 115 ? ? -97.38 -78.96 67 15 GLU A 116 ? ? -127.91 -169.25 68 16 SER A 102 ? ? 77.18 138.53 69 16 PHE A 103 ? ? -177.53 -171.99 70 16 SER A 114 ? ? -136.20 -77.21 71 16 GLU A 116 ? ? 44.62 95.14 72 16 ASP A 118 ? ? -164.60 -36.96 73 16 THR A 126 ? ? -91.99 -73.30 74 17 GLU A 94 ? ? -115.51 69.32 75 17 SER A 114 ? ? -142.44 36.95 76 18 GLU A 94 ? ? -111.07 73.70 77 18 GLU A 116 ? ? -65.68 -171.85 78 19 ALA A 95 ? ? -42.96 95.77 79 19 PHE A 103 ? ? -177.28 -169.99 80 19 SER A 115 ? ? -169.27 33.26 81 20 PHE A 103 ? ? -168.04 -169.78 82 20 GLU A 116 ? ? -72.46 -163.33 83 20 ASP A 118 ? ? 178.55 -36.95 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 96 ? ? 0.291 'SIDE CHAIN' 2 1 ARG A 123 ? ? 0.312 'SIDE CHAIN' 3 2 ARG A 96 ? ? 0.123 'SIDE CHAIN' 4 2 ARG A 123 ? ? 0.217 'SIDE CHAIN' 5 3 ARG A 96 ? ? 0.307 'SIDE CHAIN' 6 3 ARG A 123 ? ? 0.197 'SIDE CHAIN' 7 4 ARG A 96 ? ? 0.317 'SIDE CHAIN' 8 4 ARG A 123 ? ? 0.263 'SIDE CHAIN' 9 5 ARG A 96 ? ? 0.280 'SIDE CHAIN' 10 5 ARG A 123 ? ? 0.257 'SIDE CHAIN' 11 6 ARG A 96 ? ? 0.237 'SIDE CHAIN' 12 6 ARG A 123 ? ? 0.307 'SIDE CHAIN' 13 7 ARG A 96 ? ? 0.231 'SIDE CHAIN' 14 7 ARG A 123 ? ? 0.314 'SIDE CHAIN' 15 8 ARG A 96 ? ? 0.250 'SIDE CHAIN' 16 8 ARG A 123 ? ? 0.299 'SIDE CHAIN' 17 9 ARG A 96 ? ? 0.136 'SIDE CHAIN' 18 9 ARG A 123 ? ? 0.274 'SIDE CHAIN' 19 10 ARG A 96 ? ? 0.247 'SIDE CHAIN' 20 10 ARG A 123 ? ? 0.270 'SIDE CHAIN' 21 11 ARG A 96 ? ? 0.090 'SIDE CHAIN' 22 11 ARG A 123 ? ? 0.246 'SIDE CHAIN' 23 12 ARG A 96 ? ? 0.316 'SIDE CHAIN' 24 12 ARG A 123 ? ? 0.233 'SIDE CHAIN' 25 13 ARG A 96 ? ? 0.317 'SIDE CHAIN' 26 13 ARG A 123 ? ? 0.314 'SIDE CHAIN' 27 14 ARG A 96 ? ? 0.266 'SIDE CHAIN' 28 14 ARG A 123 ? ? 0.285 'SIDE CHAIN' 29 15 ARG A 96 ? ? 0.297 'SIDE CHAIN' 30 15 ARG A 123 ? ? 0.078 'SIDE CHAIN' 31 16 ARG A 96 ? ? 0.258 'SIDE CHAIN' 32 16 ARG A 123 ? ? 0.318 'SIDE CHAIN' 33 17 ARG A 96 ? ? 0.300 'SIDE CHAIN' 34 17 ARG A 123 ? ? 0.174 'SIDE CHAIN' 35 18 ARG A 96 ? ? 0.187 'SIDE CHAIN' 36 18 ARG A 123 ? ? 0.314 'SIDE CHAIN' 37 19 ARG A 123 ? ? 0.306 'SIDE CHAIN' 38 20 ARG A 96 ? ? 0.318 'SIDE CHAIN' 39 20 ARG A 123 ? ? 0.304 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 82 ? A THR 1 2 1 Y 1 A GLY 83 ? A GLY 2 3 1 Y 1 A ASP 142 ? A ASP 61 4 1 Y 1 A SER 143 ? A SER 62 5 1 Y 1 A ILE 144 ? A ILE 63 6 1 Y 1 A GLN 145 ? A GLN 64 7 1 Y 1 A ALA 146 ? A ALA 65 8 1 Y 1 A GLU 147 ? A GLU 66 9 1 Y 1 A GLU 148 ? A GLU 67 10 2 Y 1 A THR 82 ? A THR 1 11 2 Y 1 A GLY 83 ? A GLY 2 12 2 Y 1 A ASP 142 ? A ASP 61 13 2 Y 1 A SER 143 ? A SER 62 14 2 Y 1 A ILE 144 ? A ILE 63 15 2 Y 1 A GLN 145 ? A GLN 64 16 2 Y 1 A ALA 146 ? A ALA 65 17 2 Y 1 A GLU 147 ? A GLU 66 18 2 Y 1 A GLU 148 ? A GLU 67 19 3 Y 1 A THR 82 ? A THR 1 20 3 Y 1 A GLY 83 ? A GLY 2 21 3 Y 1 A ASP 142 ? A ASP 61 22 3 Y 1 A SER 143 ? A SER 62 23 3 Y 1 A ILE 144 ? A ILE 63 24 3 Y 1 A GLN 145 ? A GLN 64 25 3 Y 1 A ALA 146 ? A ALA 65 26 3 Y 1 A GLU 147 ? A GLU 66 27 3 Y 1 A GLU 148 ? A GLU 67 28 4 Y 1 A THR 82 ? A THR 1 29 4 Y 1 A GLY 83 ? A GLY 2 30 4 Y 1 A ASP 142 ? A ASP 61 31 4 Y 1 A SER 143 ? A SER 62 32 4 Y 1 A ILE 144 ? A ILE 63 33 4 Y 1 A GLN 145 ? A GLN 64 34 4 Y 1 A ALA 146 ? A ALA 65 35 4 Y 1 A GLU 147 ? A GLU 66 36 4 Y 1 A GLU 148 ? A GLU 67 37 5 Y 1 A THR 82 ? A THR 1 38 5 Y 1 A GLY 83 ? A GLY 2 39 5 Y 1 A ASP 142 ? A ASP 61 40 5 Y 1 A SER 143 ? A SER 62 41 5 Y 1 A ILE 144 ? A ILE 63 42 5 Y 1 A GLN 145 ? A GLN 64 43 5 Y 1 A ALA 146 ? A ALA 65 44 5 Y 1 A GLU 147 ? A GLU 66 45 5 Y 1 A GLU 148 ? A GLU 67 46 6 Y 1 A THR 82 ? A THR 1 47 6 Y 1 A GLY 83 ? A GLY 2 48 6 Y 1 A ASP 142 ? A ASP 61 49 6 Y 1 A SER 143 ? A SER 62 50 6 Y 1 A ILE 144 ? A ILE 63 51 6 Y 1 A GLN 145 ? A GLN 64 52 6 Y 1 A ALA 146 ? A ALA 65 53 6 Y 1 A GLU 147 ? A GLU 66 54 6 Y 1 A GLU 148 ? A GLU 67 55 7 Y 1 A THR 82 ? A THR 1 56 7 Y 1 A GLY 83 ? A GLY 2 57 7 Y 1 A ASP 142 ? A ASP 61 58 7 Y 1 A SER 143 ? A SER 62 59 7 Y 1 A ILE 144 ? A ILE 63 60 7 Y 1 A GLN 145 ? A GLN 64 61 7 Y 1 A ALA 146 ? A ALA 65 62 7 Y 1 A GLU 147 ? A GLU 66 63 7 Y 1 A GLU 148 ? A GLU 67 64 8 Y 1 A THR 82 ? A THR 1 65 8 Y 1 A GLY 83 ? A GLY 2 66 8 Y 1 A ASP 142 ? A ASP 61 67 8 Y 1 A SER 143 ? A SER 62 68 8 Y 1 A ILE 144 ? A ILE 63 69 8 Y 1 A GLN 145 ? A GLN 64 70 8 Y 1 A ALA 146 ? A ALA 65 71 8 Y 1 A GLU 147 ? A GLU 66 72 8 Y 1 A GLU 148 ? A GLU 67 73 9 Y 1 A THR 82 ? A THR 1 74 9 Y 1 A GLY 83 ? A GLY 2 75 9 Y 1 A ASP 142 ? A ASP 61 76 9 Y 1 A SER 143 ? A SER 62 77 9 Y 1 A ILE 144 ? A ILE 63 78 9 Y 1 A GLN 145 ? A GLN 64 79 9 Y 1 A ALA 146 ? A ALA 65 80 9 Y 1 A GLU 147 ? A GLU 66 81 9 Y 1 A GLU 148 ? A GLU 67 82 10 Y 1 A THR 82 ? A THR 1 83 10 Y 1 A GLY 83 ? A GLY 2 84 10 Y 1 A ASP 142 ? A ASP 61 85 10 Y 1 A SER 143 ? A SER 62 86 10 Y 1 A ILE 144 ? A ILE 63 87 10 Y 1 A GLN 145 ? A GLN 64 88 10 Y 1 A ALA 146 ? A ALA 65 89 10 Y 1 A GLU 147 ? A GLU 66 90 10 Y 1 A GLU 148 ? A GLU 67 91 11 Y 1 A THR 82 ? A THR 1 92 11 Y 1 A GLY 83 ? A GLY 2 93 11 Y 1 A ASP 142 ? A ASP 61 94 11 Y 1 A SER 143 ? A SER 62 95 11 Y 1 A ILE 144 ? A ILE 63 96 11 Y 1 A GLN 145 ? A GLN 64 97 11 Y 1 A ALA 146 ? A ALA 65 98 11 Y 1 A GLU 147 ? A GLU 66 99 11 Y 1 A GLU 148 ? A GLU 67 100 12 Y 1 A THR 82 ? A THR 1 101 12 Y 1 A GLY 83 ? A GLY 2 102 12 Y 1 A ASP 142 ? A ASP 61 103 12 Y 1 A SER 143 ? A SER 62 104 12 Y 1 A ILE 144 ? A ILE 63 105 12 Y 1 A GLN 145 ? A GLN 64 106 12 Y 1 A ALA 146 ? A ALA 65 107 12 Y 1 A GLU 147 ? A GLU 66 108 12 Y 1 A GLU 148 ? A GLU 67 109 13 Y 1 A THR 82 ? A THR 1 110 13 Y 1 A GLY 83 ? A GLY 2 111 13 Y 1 A ASP 142 ? A ASP 61 112 13 Y 1 A SER 143 ? A SER 62 113 13 Y 1 A ILE 144 ? A ILE 63 114 13 Y 1 A GLN 145 ? A GLN 64 115 13 Y 1 A ALA 146 ? A ALA 65 116 13 Y 1 A GLU 147 ? A GLU 66 117 13 Y 1 A GLU 148 ? A GLU 67 118 14 Y 1 A THR 82 ? A THR 1 119 14 Y 1 A GLY 83 ? A GLY 2 120 14 Y 1 A ASP 142 ? A ASP 61 121 14 Y 1 A SER 143 ? A SER 62 122 14 Y 1 A ILE 144 ? A ILE 63 123 14 Y 1 A GLN 145 ? A GLN 64 124 14 Y 1 A ALA 146 ? A ALA 65 125 14 Y 1 A GLU 147 ? A GLU 66 126 14 Y 1 A GLU 148 ? A GLU 67 127 15 Y 1 A THR 82 ? A THR 1 128 15 Y 1 A GLY 83 ? A GLY 2 129 15 Y 1 A ASP 142 ? A ASP 61 130 15 Y 1 A SER 143 ? A SER 62 131 15 Y 1 A ILE 144 ? A ILE 63 132 15 Y 1 A GLN 145 ? A GLN 64 133 15 Y 1 A ALA 146 ? A ALA 65 134 15 Y 1 A GLU 147 ? A GLU 66 135 15 Y 1 A GLU 148 ? A GLU 67 136 16 Y 1 A THR 82 ? A THR 1 137 16 Y 1 A GLY 83 ? A GLY 2 138 16 Y 1 A ASP 142 ? A ASP 61 139 16 Y 1 A SER 143 ? A SER 62 140 16 Y 1 A ILE 144 ? A ILE 63 141 16 Y 1 A GLN 145 ? A GLN 64 142 16 Y 1 A ALA 146 ? A ALA 65 143 16 Y 1 A GLU 147 ? A GLU 66 144 16 Y 1 A GLU 148 ? A GLU 67 145 17 Y 1 A THR 82 ? A THR 1 146 17 Y 1 A GLY 83 ? A GLY 2 147 17 Y 1 A ASP 142 ? A ASP 61 148 17 Y 1 A SER 143 ? A SER 62 149 17 Y 1 A ILE 144 ? A ILE 63 150 17 Y 1 A GLN 145 ? A GLN 64 151 17 Y 1 A ALA 146 ? A ALA 65 152 17 Y 1 A GLU 147 ? A GLU 66 153 17 Y 1 A GLU 148 ? A GLU 67 154 18 Y 1 A THR 82 ? A THR 1 155 18 Y 1 A GLY 83 ? A GLY 2 156 18 Y 1 A ASP 142 ? A ASP 61 157 18 Y 1 A SER 143 ? A SER 62 158 18 Y 1 A ILE 144 ? A ILE 63 159 18 Y 1 A GLN 145 ? A GLN 64 160 18 Y 1 A ALA 146 ? A ALA 65 161 18 Y 1 A GLU 147 ? A GLU 66 162 18 Y 1 A GLU 148 ? A GLU 67 163 19 Y 1 A THR 82 ? A THR 1 164 19 Y 1 A GLY 83 ? A GLY 2 165 19 Y 1 A ASP 142 ? A ASP 61 166 19 Y 1 A SER 143 ? A SER 62 167 19 Y 1 A ILE 144 ? A ILE 63 168 19 Y 1 A GLN 145 ? A GLN 64 169 19 Y 1 A ALA 146 ? A ALA 65 170 19 Y 1 A GLU 147 ? A GLU 66 171 19 Y 1 A GLU 148 ? A GLU 67 172 20 Y 1 A THR 82 ? A THR 1 173 20 Y 1 A GLY 83 ? A GLY 2 174 20 Y 1 A ASP 142 ? A ASP 61 175 20 Y 1 A SER 143 ? A SER 62 176 20 Y 1 A ILE 144 ? A ILE 63 177 20 Y 1 A GLN 145 ? A GLN 64 178 20 Y 1 A ALA 146 ? A ALA 65 179 20 Y 1 A GLU 147 ? A GLU 66 180 20 Y 1 A GLU 148 ? A GLU 67 #