data_1NYP # _entry.id 1NYP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1NYP pdb_00001nyp 10.2210/pdb1nyp/pdb RCSB RCSB018358 ? ? WWPDB D_1000018358 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-07-01 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.value' 14 4 'Structure model' '_struct_conn.pdbx_dist_value' 15 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 16 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 27 4 'Structure model' '_struct_ref_seq_dif.details' 28 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 29 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 30 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NYP _pdbx_database_status.recvd_initial_deposition_date 2003-02-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1g47 _pdbx_database_related.details 'another LIM domain from the same multi-domain adaptor protein' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Velyvis, A.' 1 'Vaynberg, J.' 2 'Vinogradova, O.' 3 'Zhang, Y.' 4 'Wu, C.' 5 'Qin, J.' 6 # _citation.id primary _citation.title 'Structural and functional insights into PINCH LIM4 domain-mediated integrin signaling' _citation.journal_abbrev Nat.Struct.Biol. _citation.journal_volume 10 _citation.page_first 558 _citation.page_last 564 _citation.year 2003 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12794636 _citation.pdbx_database_id_DOI 10.1038/nsb938 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Velyvis, A.' 1 ? primary 'Vaynberg, J.' 2 ? primary 'Yang, Y.' 3 ? primary 'Vinogradova, O.' 4 ? primary 'Zhang, Y.' 5 ? primary 'Wu, C.' 6 ? primary 'Qin, J.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PINCH protein' 7532.742 1 ? ? '4th LIM domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'LIM and senescent cell antigen-like domains 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDV _entity_poly.pdbx_seq_one_letter_code_can GSMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDV _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 GLY n 1 5 VAL n 1 6 PRO n 1 7 ILE n 1 8 CYS n 1 9 GLY n 1 10 ALA n 1 11 CYS n 1 12 ARG n 1 13 ARG n 1 14 PRO n 1 15 ILE n 1 16 GLU n 1 17 GLY n 1 18 ARG n 1 19 VAL n 1 20 VAL n 1 21 ASN n 1 22 ALA n 1 23 MET n 1 24 GLY n 1 25 LYS n 1 26 GLN n 1 27 TRP n 1 28 HIS n 1 29 VAL n 1 30 GLU n 1 31 HIS n 1 32 PHE n 1 33 VAL n 1 34 CYS n 1 35 ALA n 1 36 LYS n 1 37 CYS n 1 38 GLU n 1 39 LYS n 1 40 PRO n 1 41 PHE n 1 42 LEU n 1 43 GLY n 1 44 HIS n 1 45 ARG n 1 46 HIS n 1 47 TYR n 1 48 GLU n 1 49 ARG n 1 50 LYS n 1 51 GLY n 1 52 LEU n 1 53 ALA n 1 54 TYR n 1 55 CYS n 1 56 GLU n 1 57 THR n 1 58 HIS n 1 59 TYR n 1 60 ASN n 1 61 GLN n 1 62 LEU n 1 63 PHE n 1 64 GLY n 1 65 ASP n 1 66 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene LIMS1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-4T1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 VAL 66 66 66 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 67 67 ZN ZN A . C 2 ZN 1 68 68 ZN ZN A . # _exptl.entry_id 1NYP _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1NYP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1NYP _struct.title '4th LIM domain of PINCH protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NYP _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text 'LIM domain, protein recognition, CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PINC_HUMAN _struct_ref.pdbx_db_accession P48059 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDV _struct_ref.pdbx_align_begin 188 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NYP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P48059 _struct_ref_seq.db_align_beg 188 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 251 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1NYP GLY A 1 ? UNP P48059 ? ? 'cloning artifact' 1 1 1 1NYP SER A 2 ? UNP P48059 ? ? 'cloning artifact' 2 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 55 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 63 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 55 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 63 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 8 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 8 A ZN 67 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc2 metalc ? ? A CYS 11 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 11 A ZN 67 1_555 ? ? ? ? ? ? ? 2.300 ? ? metalc3 metalc ? ? A HIS 28 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 28 A ZN 67 1_555 ? ? ? ? ? ? ? 1.998 ? ? metalc4 metalc ? ? A HIS 31 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 31 A ZN 67 1_555 ? ? ? ? ? ? ? 2.004 ? ? metalc5 metalc ? ? A CYS 34 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 34 A ZN 68 1_555 ? ? ? ? ? ? ? 2.300 ? ? metalc6 metalc ? ? A CYS 37 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 37 A ZN 68 1_555 ? ? ? ? ? ? ? 2.296 ? ? metalc7 metalc ? ? A CYS 55 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 55 A ZN 68 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc8 metalc ? ? A HIS 58 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 58 A ZN 68 1_555 ? ? ? ? ? ? ? 2.003 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 67 ? 1_555 SG ? A CYS 11 ? A CYS 11 ? 1_555 109.6 ? 2 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 67 ? 1_555 ND1 ? A HIS 28 ? A HIS 28 ? 1_555 104.8 ? 3 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 67 ? 1_555 ND1 ? A HIS 28 ? A HIS 28 ? 1_555 108.0 ? 4 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 67 ? 1_555 ND1 ? A HIS 31 ? A HIS 31 ? 1_555 123.1 ? 5 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 67 ? 1_555 ND1 ? A HIS 31 ? A HIS 31 ? 1_555 106.4 ? 6 ND1 ? A HIS 28 ? A HIS 28 ? 1_555 ZN ? B ZN . ? A ZN 67 ? 1_555 ND1 ? A HIS 31 ? A HIS 31 ? 1_555 104.1 ? 7 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 68 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 104.5 ? 8 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 68 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 117.0 ? 9 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 68 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 92.2 ? 10 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 68 ? 1_555 ND1 ? A HIS 58 ? A HIS 58 ? 1_555 117.7 ? 11 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 68 ? 1_555 ND1 ? A HIS 58 ? A HIS 58 ? 1_555 97.0 ? 12 SG ? A CYS 55 ? A CYS 55 ? 1_555 ZN ? C ZN . ? A ZN 68 ? 1_555 ND1 ? A HIS 58 ? A HIS 58 ? 1_555 119.8 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 7 ? CYS A 8 ? ILE A 7 CYS A 8 A 2 ARG A 13 ? PRO A 14 ? ARG A 13 PRO A 14 B 1 VAL A 19 ? VAL A 20 ? VAL A 19 VAL A 20 B 2 TRP A 27 ? HIS A 28 ? TRP A 27 HIS A 28 C 1 TYR A 47 ? ARG A 49 ? TYR A 47 ARG A 49 C 2 LEU A 52 ? TYR A 54 ? LEU A 52 TYR A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 8 ? N CYS A 8 O ARG A 13 ? O ARG A 13 B 1 2 N VAL A 20 ? N VAL A 20 O TRP A 27 ? O TRP A 27 C 1 2 N TYR A 47 ? N TYR A 47 O TYR A 54 ? O TYR A 54 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 67 ? 4 'BINDING SITE FOR RESIDUE ZN A 67' AC2 Software A ZN 68 ? 4 'BINDING SITE FOR RESIDUE ZN A 68' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 8 ? CYS A 8 . ? 1_555 ? 2 AC1 4 CYS A 11 ? CYS A 11 . ? 1_555 ? 3 AC1 4 HIS A 28 ? HIS A 28 . ? 1_555 ? 4 AC1 4 HIS A 31 ? HIS A 31 . ? 1_555 ? 5 AC2 4 CYS A 34 ? CYS A 34 . ? 1_555 ? 6 AC2 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 7 AC2 4 CYS A 55 ? CYS A 55 . ? 1_555 ? 8 AC2 4 HIS A 58 ? HIS A 58 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A THR 57 ? ? H A GLN 61 ? ? 1.44 2 1 O A GLU 56 ? ? HD21 A ASN 60 ? ? 1.50 3 1 H A ALA 35 ? ? O A ALA 53 ? ? 1.54 4 1 O A PRO 6 ? ? H A ILE 15 ? ? 1.60 5 2 O A THR 57 ? ? H A GLN 61 ? ? 1.43 6 2 H A ALA 35 ? ? O A ALA 53 ? ? 1.52 7 2 O A PRO 6 ? ? H A ILE 15 ? ? 1.58 8 2 O A TYR 47 ? ? H A TYR 54 ? ? 1.59 9 3 O A THR 57 ? ? H A GLN 61 ? ? 1.44 10 3 O A GLU 56 ? ? HD21 A ASN 60 ? ? 1.47 11 3 H A ALA 35 ? ? O A ALA 53 ? ? 1.51 12 3 O A PRO 6 ? ? H A ILE 15 ? ? 1.57 13 4 O A THR 57 ? ? H A GLN 61 ? ? 1.42 14 4 O A GLU 56 ? ? HD21 A ASN 60 ? ? 1.46 15 4 H A ALA 35 ? ? O A ALA 53 ? ? 1.50 16 4 O A PRO 6 ? ? H A ILE 15 ? ? 1.57 17 4 H A ARG 49 ? ? O A LEU 52 ? ? 1.58 18 5 O A TYR 47 ? ? H A TYR 54 ? ? 1.45 19 5 H A ALA 35 ? ? O A ALA 53 ? ? 1.50 20 5 O A THR 57 ? ? H A GLN 61 ? ? 1.51 21 5 O A PRO 6 ? ? H A ILE 15 ? ? 1.58 22 5 H A ARG 49 ? ? O A LEU 52 ? ? 1.59 23 5 O A ALA 22 ? ? H A LYS 25 ? ? 1.59 24 6 O A THR 57 ? ? H A GLN 61 ? ? 1.52 25 6 H A ALA 35 ? ? O A ALA 53 ? ? 1.53 26 6 O A GLU 56 ? ? HD21 A ASN 60 ? ? 1.54 27 6 O A TYR 47 ? ? H A TYR 54 ? ? 1.57 28 6 O A HIS 58 ? ? H A LEU 62 ? ? 1.58 29 6 O A PRO 6 ? ? H A ILE 15 ? ? 1.59 30 7 O A GLU 56 ? ? HD21 A ASN 60 ? ? 1.46 31 7 O A THR 57 ? ? H A GLN 61 ? ? 1.51 32 7 H A ALA 35 ? ? O A ALA 53 ? ? 1.54 33 7 O A PRO 6 ? ? H A ILE 15 ? ? 1.57 34 7 O A TYR 59 ? ? H A PHE 63 ? ? 1.60 35 8 O A THR 57 ? ? H A GLN 61 ? ? 1.41 36 8 H A ALA 35 ? ? O A ALA 53 ? ? 1.49 37 8 O A GLU 56 ? ? HD21 A ASN 60 ? ? 1.50 38 8 O A PRO 6 ? ? H A ILE 15 ? ? 1.53 39 9 O A THR 57 ? ? H A GLN 61 ? ? 1.44 40 9 O A GLU 56 ? ? HD21 A ASN 60 ? ? 1.49 41 9 H A ALA 35 ? ? O A ALA 53 ? ? 1.50 42 9 O A HIS 58 ? ? H A LEU 62 ? ? 1.54 43 9 H A ARG 49 ? ? O A LEU 52 ? ? 1.57 44 9 O A PRO 6 ? ? H A ILE 15 ? ? 1.60 45 10 O A THR 57 ? ? H A GLN 61 ? ? 1.41 46 10 O A GLU 56 ? ? HD21 A ASN 60 ? ? 1.45 47 10 H A ALA 35 ? ? O A ALA 53 ? ? 1.50 48 10 O A HIS 58 ? ? H A LEU 62 ? ? 1.55 49 11 HH21 A ARG 18 ? ? OE2 A GLU 30 ? ? 1.42 50 11 O A THR 57 ? ? H A GLN 61 ? ? 1.43 51 11 H A ALA 35 ? ? O A ALA 53 ? ? 1.48 52 11 O A PRO 6 ? ? H A ILE 15 ? ? 1.59 53 12 O A THR 57 ? ? H A GLN 61 ? ? 1.44 54 12 H A ALA 35 ? ? O A ALA 53 ? ? 1.53 55 12 O A GLU 56 ? ? HD21 A ASN 60 ? ? 1.56 56 13 H2 A GLY 1 ? ? H A SER 2 ? ? 1.31 57 13 O A THR 57 ? ? H A GLN 61 ? ? 1.43 58 13 H A ALA 35 ? ? O A ALA 53 ? ? 1.49 59 13 O A GLU 56 ? ? HD21 A ASN 60 ? ? 1.50 60 13 O A HIS 58 ? ? H A LEU 62 ? ? 1.51 61 13 H A ARG 49 ? ? O A LEU 52 ? ? 1.57 62 13 O A PRO 6 ? ? H A ILE 15 ? ? 1.59 63 14 O A THR 57 ? ? H A GLN 61 ? ? 1.44 64 14 O A TYR 47 ? ? H A TYR 54 ? ? 1.46 65 14 O A GLU 56 ? ? HD21 A ASN 60 ? ? 1.48 66 14 H A ALA 35 ? ? O A ALA 53 ? ? 1.51 67 14 H A ARG 49 ? ? O A LEU 52 ? ? 1.57 68 14 O A PRO 6 ? ? H A ILE 15 ? ? 1.60 69 15 O A THR 57 ? ? H A GLN 61 ? ? 1.44 70 15 H A ALA 35 ? ? O A ALA 53 ? ? 1.52 71 15 O A TYR 59 ? ? H A PHE 63 ? ? 1.60 72 15 O A PRO 6 ? ? H A ILE 15 ? ? 1.60 73 16 O A THR 57 ? ? H A GLN 61 ? ? 1.45 74 16 O A GLU 56 ? ? HD21 A ASN 60 ? ? 1.51 75 16 H A ALA 35 ? ? O A ALA 53 ? ? 1.54 76 16 O A PRO 6 ? ? H A ILE 15 ? ? 1.54 77 16 O A HIS 58 ? ? H A LEU 62 ? ? 1.54 78 17 O A THR 57 ? ? H A GLN 61 ? ? 1.44 79 17 H A ALA 35 ? ? O A ALA 53 ? ? 1.50 80 17 O A HIS 58 ? ? H A LEU 62 ? ? 1.54 81 17 O A PRO 6 ? ? H A ILE 15 ? ? 1.59 82 17 O A ALA 22 ? ? H A LYS 25 ? ? 1.59 83 17 O A TYR 47 ? ? H A TYR 54 ? ? 1.59 84 18 O A THR 57 ? ? H A GLN 61 ? ? 1.44 85 18 O A GLU 56 ? ? HD21 A ASN 60 ? ? 1.44 86 18 O A TYR 47 ? ? H A TYR 54 ? ? 1.45 87 18 H A ALA 35 ? ? O A ALA 53 ? ? 1.48 88 18 O A ALA 22 ? ? H A LYS 25 ? ? 1.54 89 18 O A HIS 58 ? ? H A LEU 62 ? ? 1.58 90 19 O A THR 57 ? ? H A GLN 61 ? ? 1.45 91 19 O A GLU 56 ? ? HD21 A ASN 60 ? ? 1.52 92 19 H A ALA 35 ? ? O A ALA 53 ? ? 1.52 93 19 O A PRO 6 ? ? H A ILE 15 ? ? 1.57 94 20 HE A ARG 49 ? ? H A LYS 50 ? ? 1.25 95 20 O A GLU 56 ? ? HD21 A ASN 60 ? ? 1.45 96 20 O A THR 57 ? ? H A GLN 61 ? ? 1.51 97 20 H A ALA 35 ? ? O A ALA 53 ? ? 1.53 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 3 ? ? -49.80 167.87 2 1 GLU A 16 ? ? -160.54 61.47 3 1 MET A 23 ? ? 58.09 17.19 4 1 LYS A 25 ? ? -130.23 -154.80 5 1 LYS A 36 ? ? -138.81 -31.69 6 1 GLU A 38 ? ? 71.70 47.60 7 1 PHE A 41 ? ? -95.78 56.90 8 1 CYS A 55 ? ? -57.55 177.47 9 1 PHE A 63 ? ? -158.58 -81.64 10 2 VAL A 5 ? ? 57.16 117.70 11 2 GLU A 16 ? ? -161.77 62.84 12 2 MET A 23 ? ? 58.38 16.01 13 2 LYS A 25 ? ? -133.05 -151.11 14 2 ALA A 35 ? ? -92.46 35.11 15 2 LYS A 36 ? ? -142.99 -40.23 16 2 GLU A 38 ? ? 75.10 47.89 17 2 PHE A 41 ? ? -96.21 57.82 18 2 CYS A 55 ? ? -57.28 175.80 19 2 PHE A 63 ? ? -158.49 -81.54 20 2 ASP A 65 ? ? 55.92 80.97 21 3 MET A 3 ? ? -163.93 -167.53 22 3 GLU A 16 ? ? -159.59 62.02 23 3 MET A 23 ? ? 57.52 16.96 24 3 LYS A 25 ? ? -125.38 -155.37 25 3 LYS A 36 ? ? -138.70 -32.03 26 3 PHE A 41 ? ? -95.78 56.44 27 3 CYS A 55 ? ? -57.81 178.15 28 3 PHE A 63 ? ? -160.13 -81.93 29 3 ASP A 65 ? ? -172.55 25.27 30 4 SER A 2 ? ? -166.43 43.49 31 4 MET A 3 ? ? 50.62 -128.48 32 4 VAL A 5 ? ? 57.13 129.27 33 4 GLU A 16 ? ? -159.19 62.12 34 4 MET A 23 ? ? 58.10 18.14 35 4 LYS A 25 ? ? -130.32 -154.67 36 4 LYS A 36 ? ? -134.10 -39.07 37 4 GLU A 38 ? ? 73.70 46.94 38 4 LYS A 50 ? ? 44.73 20.94 39 4 CYS A 55 ? ? -56.57 172.03 40 4 PHE A 63 ? ? -156.11 -83.88 41 4 ASP A 65 ? ? 56.38 81.46 42 5 SER A 2 ? ? -165.90 -120.49 43 5 MET A 3 ? ? 51.63 98.56 44 5 VAL A 5 ? ? 56.67 116.19 45 5 GLU A 16 ? ? -161.26 62.41 46 5 MET A 23 ? ? 58.31 14.46 47 5 LYS A 25 ? ? -120.21 -154.83 48 5 LYS A 36 ? ? -138.09 -33.21 49 5 PHE A 41 ? ? -96.08 56.35 50 5 LYS A 50 ? ? 42.33 21.66 51 5 CYS A 55 ? ? -56.51 -175.51 52 5 PHE A 63 ? ? -153.79 -83.31 53 5 ASP A 65 ? ? 170.27 -24.17 54 6 MET A 3 ? ? -164.36 40.31 55 6 GLU A 16 ? ? -160.45 61.25 56 6 MET A 23 ? ? 58.07 16.80 57 6 LYS A 25 ? ? -130.72 -154.78 58 6 LYS A 36 ? ? -135.43 -32.75 59 6 PHE A 41 ? ? -95.72 56.81 60 6 LYS A 50 ? ? 42.04 21.51 61 6 CYS A 55 ? ? -56.56 178.76 62 6 PHE A 63 ? ? -153.74 -81.71 63 6 ASP A 65 ? ? 158.79 -18.43 64 7 SER A 2 ? ? 55.50 102.87 65 7 MET A 3 ? ? -74.22 31.16 66 7 GLU A 16 ? ? -158.38 62.40 67 7 MET A 23 ? ? 58.31 16.65 68 7 LYS A 25 ? ? -130.83 -153.83 69 7 LYS A 36 ? ? -136.02 -31.53 70 7 GLU A 38 ? ? 71.98 47.43 71 7 PHE A 41 ? ? -95.50 57.82 72 7 HIS A 44 ? ? -115.64 -163.61 73 7 LYS A 50 ? ? 41.80 22.41 74 7 CYS A 55 ? ? -56.05 179.15 75 7 PHE A 63 ? ? -156.85 -83.48 76 7 ASP A 65 ? ? 49.78 71.16 77 8 GLU A 16 ? ? -161.38 61.45 78 8 MET A 23 ? ? 58.02 15.98 79 8 LYS A 25 ? ? -124.24 -154.69 80 8 ALA A 35 ? ? -92.25 34.49 81 8 LYS A 36 ? ? -142.79 -40.05 82 8 GLU A 38 ? ? 76.32 47.59 83 8 PHE A 41 ? ? -96.11 58.13 84 8 CYS A 55 ? ? -56.05 173.27 85 8 PHE A 63 ? ? -160.33 -80.16 86 8 ASP A 65 ? ? -164.40 -99.18 87 9 SER A 2 ? ? -159.37 -64.27 88 9 VAL A 5 ? ? 57.25 128.98 89 9 GLU A 16 ? ? -170.30 70.39 90 9 MET A 23 ? ? 57.65 18.40 91 9 LYS A 25 ? ? -129.37 -156.19 92 9 GLU A 38 ? ? 71.51 46.56 93 9 PHE A 41 ? ? -93.01 59.46 94 9 CYS A 55 ? ? -57.40 173.92 95 9 PHE A 63 ? ? -154.30 -85.11 96 10 SER A 2 ? ? 53.34 98.35 97 10 MET A 3 ? ? -62.45 -138.69 98 10 VAL A 5 ? ? 57.28 129.80 99 10 GLU A 16 ? ? -159.21 59.38 100 10 MET A 23 ? ? 57.52 16.39 101 10 LYS A 25 ? ? -125.75 -154.67 102 10 ALA A 35 ? ? -91.50 30.48 103 10 LYS A 36 ? ? -139.65 -31.01 104 10 GLU A 38 ? ? 74.38 45.89 105 10 PHE A 41 ? ? -93.28 55.69 106 10 HIS A 44 ? ? -115.69 -164.52 107 10 PHE A 63 ? ? -160.37 -79.44 108 11 SER A 2 ? ? 52.12 85.19 109 11 GLU A 16 ? ? -167.73 69.06 110 11 MET A 23 ? ? 57.84 17.77 111 11 LYS A 25 ? ? -124.25 -156.06 112 11 LYS A 36 ? ? -134.21 -42.04 113 11 GLU A 38 ? ? 72.68 47.54 114 11 PHE A 41 ? ? -95.46 59.97 115 11 LYS A 50 ? ? 42.39 24.75 116 11 CYS A 55 ? ? -59.38 174.02 117 11 PHE A 63 ? ? -160.14 -83.36 118 12 GLU A 16 ? ? -166.30 67.96 119 12 MET A 23 ? ? 58.34 16.26 120 12 LYS A 25 ? ? -130.56 -154.56 121 12 LYS A 36 ? ? -139.80 -31.29 122 12 PHE A 41 ? ? -95.93 57.85 123 12 HIS A 44 ? ? -114.36 -158.51 124 12 CYS A 55 ? ? -56.85 178.31 125 12 PHE A 63 ? ? -158.60 -84.06 126 13 SER A 2 ? ? -173.94 -173.87 127 13 GLU A 16 ? ? -160.73 61.68 128 13 MET A 23 ? ? 58.74 17.02 129 13 LYS A 25 ? ? -133.89 -154.41 130 13 LYS A 36 ? ? -132.63 -30.68 131 13 CYS A 55 ? ? -57.22 174.67 132 13 PHE A 63 ? ? -154.74 -84.91 133 13 ASP A 65 ? ? -173.11 88.65 134 14 SER A 2 ? ? -65.06 -157.50 135 14 VAL A 5 ? ? 57.50 122.87 136 14 GLU A 16 ? ? -160.73 61.92 137 14 MET A 23 ? ? 58.74 14.52 138 14 LYS A 25 ? ? -125.08 -154.36 139 14 ALA A 35 ? ? -91.22 32.03 140 14 LYS A 36 ? ? -140.25 -41.55 141 14 GLU A 38 ? ? 75.51 48.04 142 14 PHE A 41 ? ? -96.14 56.98 143 14 HIS A 44 ? ? -115.23 -163.27 144 14 CYS A 55 ? ? -56.80 -179.82 145 14 PHE A 63 ? ? -158.52 -81.06 146 15 SER A 2 ? ? -170.22 96.71 147 15 MET A 3 ? ? -63.97 75.51 148 15 VAL A 5 ? ? 57.09 116.22 149 15 GLU A 16 ? ? -159.38 59.73 150 15 MET A 23 ? ? 58.26 16.39 151 15 LYS A 25 ? ? -135.86 -154.45 152 15 LYS A 36 ? ? -135.83 -32.15 153 15 LYS A 50 ? ? 37.45 25.40 154 15 CYS A 55 ? ? -56.16 178.43 155 15 PHE A 63 ? ? -152.78 -84.17 156 15 ASP A 65 ? ? 168.40 -92.10 157 16 SER A 2 ? ? -175.28 42.23 158 16 GLU A 16 ? ? -161.29 61.38 159 16 MET A 23 ? ? 58.79 16.83 160 16 LYS A 25 ? ? -131.71 -154.47 161 16 LYS A 36 ? ? -134.19 -33.43 162 16 GLU A 38 ? ? 76.22 46.50 163 16 PHE A 41 ? ? -95.93 57.86 164 16 CYS A 55 ? ? -57.61 176.75 165 16 PHE A 63 ? ? -158.59 -80.46 166 17 SER A 2 ? ? -173.07 6.41 167 17 MET A 3 ? ? -152.73 63.98 168 17 GLU A 16 ? ? -169.25 69.88 169 17 MET A 23 ? ? 58.02 19.36 170 17 LYS A 25 ? ? -118.95 -156.76 171 17 LYS A 36 ? ? -135.44 -31.34 172 17 GLU A 38 ? ? 72.75 47.58 173 17 PHE A 41 ? ? -96.05 57.93 174 17 CYS A 55 ? ? -58.00 176.58 175 17 PHE A 63 ? ? -155.34 -87.61 176 17 ASP A 65 ? ? -173.43 89.51 177 18 MET A 3 ? ? -176.17 67.27 178 18 VAL A 5 ? ? 57.21 119.71 179 18 GLU A 16 ? ? -168.62 69.18 180 18 MET A 23 ? ? 57.50 14.71 181 18 LYS A 25 ? ? -115.24 -155.55 182 18 LYS A 36 ? ? -137.80 -31.07 183 18 GLU A 38 ? ? 72.20 48.18 184 18 PHE A 41 ? ? -95.90 58.07 185 18 HIS A 44 ? ? -115.85 -163.82 186 18 LYS A 50 ? ? 45.15 23.12 187 18 CYS A 55 ? ? -56.12 -179.47 188 18 PHE A 63 ? ? -162.59 -86.50 189 19 SER A 2 ? ? -178.95 115.45 190 19 MET A 3 ? ? -64.11 -128.07 191 19 VAL A 5 ? ? 57.18 117.06 192 19 GLU A 16 ? ? -161.33 63.57 193 19 MET A 23 ? ? 58.16 17.52 194 19 LYS A 25 ? ? -120.37 -155.96 195 19 LYS A 36 ? ? -138.87 -32.06 196 19 GLU A 38 ? ? 73.43 47.31 197 19 PHE A 41 ? ? -96.34 58.83 198 19 CYS A 55 ? ? -57.36 175.04 199 19 PHE A 63 ? ? -155.03 -81.82 200 19 ASP A 65 ? ? 52.10 79.57 201 20 SER A 2 ? ? -165.50 -16.52 202 20 MET A 3 ? ? -56.28 -176.44 203 20 GLU A 16 ? ? -160.91 62.73 204 20 MET A 23 ? ? 58.12 16.44 205 20 LYS A 25 ? ? -123.44 -153.97 206 20 LYS A 36 ? ? -138.55 -31.68 207 20 GLU A 38 ? ? 75.26 47.28 208 20 PHE A 41 ? ? -96.15 58.46 209 20 CYS A 55 ? ? -57.34 176.70 210 20 PHE A 63 ? ? -160.08 -83.59 211 20 ASP A 65 ? ? -179.43 -93.94 # _pdbx_nmr_ensemble.entry_id 1NYP _pdbx_nmr_ensemble.conformers_calculated_total_number 60 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1NYP _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.7 mM U-15N,13C-LIM4; 95% H2O, 5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.13 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type 3D-15N,13C-edited-NOESY # _pdbx_nmr_refine.entry_id 1NYP _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;SA protocol without Zn cofactors starting from linear protein structure, followed by addition of Zn into structures and minimization ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe ? processing ? 1 PIPP ? 'data analysis' ? 2 X-PLOR ? 'structure solution' ? 3 X-PLOR ? refinement ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model UNITYPLUS _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 1NYP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_