data_1NZ9 # _entry.id 1NZ9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1NZ9 pdb_00001nz9 10.2210/pdb1nz9/pdb RCSB RCSB018378 ? ? WWPDB D_1000018378 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-04-06 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NZ9 _pdbx_database_status.recvd_initial_deposition_date 2003-02-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1NZ8 'N-terminal (NGN) domain' unspecified TargetDB ttk003000790.2 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Reay, P.' 1 'Yamasaki, K.' 2 'Terada, T.' 3 'Kuramitsu, S.' 4 'Shirouzu, M.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title ;Structural and sequence comparisons arising from the solution structure of the transcription elongation factor NusG from Thermus thermophilus ; _citation.journal_abbrev Proteins _citation.journal_volume 56 _citation.page_first 40 _citation.page_last 51 _citation.year 2004 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15162485 _citation.pdbx_database_id_DOI 10.1002/prot.20054 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Reay, P.' 1 ? primary 'Yamasaki, K.' 2 ? primary 'Terada, T.' 3 ? primary 'Kuramitsu, S.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TRANSCRIPTION ANTITERMINATION PROTEIN NUSG' _entity.formula_weight 6361.215 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-TERMINAL (NGC) DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'N-UTILIZATION SUBSTANCE G' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AQVAFREGDQVRVVSGPFADFTGTVTEINPERGKVKVMVTIFGRETPVELDFSQVVKA _entity_poly.pdbx_seq_one_letter_code_can AQVAFREGDQVRVVSGPFADFTGTVTEINPERGKVKVMVTIFGRETPVELDFSQVVKA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ttk003000790.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLN n 1 3 VAL n 1 4 ALA n 1 5 PHE n 1 6 ARG n 1 7 GLU n 1 8 GLY n 1 9 ASP n 1 10 GLN n 1 11 VAL n 1 12 ARG n 1 13 VAL n 1 14 VAL n 1 15 SER n 1 16 GLY n 1 17 PRO n 1 18 PHE n 1 19 ALA n 1 20 ASP n 1 21 PHE n 1 22 THR n 1 23 GLY n 1 24 THR n 1 25 VAL n 1 26 THR n 1 27 GLU n 1 28 ILE n 1 29 ASN n 1 30 PRO n 1 31 GLU n 1 32 ARG n 1 33 GLY n 1 34 LYS n 1 35 VAL n 1 36 LYS n 1 37 VAL n 1 38 MET n 1 39 VAL n 1 40 THR n 1 41 ILE n 1 42 PHE n 1 43 GLY n 1 44 ARG n 1 45 GLU n 1 46 THR n 1 47 PRO n 1 48 VAL n 1 49 GLU n 1 50 LEU n 1 51 ASP n 1 52 PHE n 1 53 SER n 1 54 GLN n 1 55 VAL n 1 56 VAL n 1 57 LYS n 1 58 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermus _entity_src_gen.pdbx_gene_src_gene NusG _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 127 127 ALA ALA A . n A 1 2 GLN 2 128 128 GLN GLN A . n A 1 3 VAL 3 129 129 VAL VAL A . n A 1 4 ALA 4 130 130 ALA ALA A . n A 1 5 PHE 5 131 131 PHE PHE A . n A 1 6 ARG 6 132 132 ARG ARG A . n A 1 7 GLU 7 133 133 GLU GLU A . n A 1 8 GLY 8 134 134 GLY GLY A . n A 1 9 ASP 9 135 135 ASP ASP A . n A 1 10 GLN 10 136 136 GLN GLN A . n A 1 11 VAL 11 137 137 VAL VAL A . n A 1 12 ARG 12 138 138 ARG ARG A . n A 1 13 VAL 13 139 139 VAL VAL A . n A 1 14 VAL 14 140 140 VAL VAL A . n A 1 15 SER 15 141 141 SER SER A . n A 1 16 GLY 16 142 142 GLY GLY A . n A 1 17 PRO 17 143 143 PRO PRO A . n A 1 18 PHE 18 144 144 PHE PHE A . n A 1 19 ALA 19 145 145 ALA ALA A . n A 1 20 ASP 20 146 146 ASP ASP A . n A 1 21 PHE 21 147 147 PHE PHE A . n A 1 22 THR 22 148 148 THR THR A . n A 1 23 GLY 23 149 149 GLY GLY A . n A 1 24 THR 24 150 150 THR THR A . n A 1 25 VAL 25 151 151 VAL VAL A . n A 1 26 THR 26 152 152 THR THR A . n A 1 27 GLU 27 153 153 GLU GLU A . n A 1 28 ILE 28 154 154 ILE ILE A . n A 1 29 ASN 29 155 155 ASN ASN A . n A 1 30 PRO 30 156 156 PRO PRO A . n A 1 31 GLU 31 157 157 GLU GLU A . n A 1 32 ARG 32 158 158 ARG ARG A . n A 1 33 GLY 33 159 159 GLY GLY A . n A 1 34 LYS 34 160 160 LYS LYS A . n A 1 35 VAL 35 161 161 VAL VAL A . n A 1 36 LYS 36 162 162 LYS LYS A . n A 1 37 VAL 37 163 163 VAL VAL A . n A 1 38 MET 38 164 164 MET MET A . n A 1 39 VAL 39 165 165 VAL VAL A . n A 1 40 THR 40 166 166 THR THR A . n A 1 41 ILE 41 167 167 ILE ILE A . n A 1 42 PHE 42 168 168 PHE PHE A . n A 1 43 GLY 43 169 169 GLY GLY A . n A 1 44 ARG 44 170 170 ARG ARG A . n A 1 45 GLU 45 171 171 GLU GLU A . n A 1 46 THR 46 172 172 THR THR A . n A 1 47 PRO 47 173 173 PRO PRO A . n A 1 48 VAL 48 174 174 VAL VAL A . n A 1 49 GLU 49 175 175 GLU GLU A . n A 1 50 LEU 50 176 176 LEU LEU A . n A 1 51 ASP 51 177 177 ASP ASP A . n A 1 52 PHE 52 178 178 PHE PHE A . n A 1 53 SER 53 179 179 SER SER A . n A 1 54 GLN 54 180 180 GLN GLN A . n A 1 55 VAL 55 181 181 VAL VAL A . n A 1 56 VAL 56 182 182 VAL VAL A . n A 1 57 LYS 57 183 183 LYS LYS A . n A 1 58 ALA 58 184 184 ALA ALA A . n # _exptl.entry_id 1NZ9 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1NZ9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1NZ9 _struct.title 'Solution Structure of the N-utilization substance G (NusG) C-terminal (NGC) domain from Thermus thermophilus' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NZ9 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;TRANSCRIPTION ELONGATION, TERMINATION, ANTITERMINATION, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSCRIPTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NUSG_THET8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AQVAFREGDQVRVVSGPFADFTGTVTEINPERGKVKVMVTIFGRETPVELDFSQVVKA _struct_ref.pdbx_align_begin 127 _struct_ref.pdbx_db_accession P35872 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NZ9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 58 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P35872 _struct_ref_seq.db_align_beg 127 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 184 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 127 _struct_ref_seq.pdbx_auth_seq_align_end 184 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PHE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 52 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 54 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PHE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 178 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 180 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 45 ? LEU A 50 ? GLU A 171 LEU A 176 A 2 LYS A 34 ? THR A 40 ? LYS A 160 THR A 166 A 3 THR A 22 ? ASN A 29 ? THR A 148 ASN A 155 A 4 GLN A 10 ? VAL A 13 ? GLN A 136 VAL A 139 A 5 VAL A 55 ? LYS A 57 ? VAL A 181 LYS A 183 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 50 ? O LEU A 176 N VAL A 35 ? N VAL A 161 A 2 3 O LYS A 36 ? O LYS A 162 N GLU A 27 ? N GLU A 153 A 3 4 O GLY A 23 ? O GLY A 149 N VAL A 11 ? N VAL A 137 A 4 5 N ARG A 12 ? N ARG A 138 O VAL A 56 ? O VAL A 182 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASP 177 ? ? H A GLN 180 ? ? 1.59 2 6 O A ASP 177 ? ? H A GLN 180 ? ? 1.58 3 7 O A ASP 177 ? ? H A GLN 180 ? ? 1.59 4 10 O A ASP 177 ? ? H A GLN 180 ? ? 1.59 5 14 O A ASP 177 ? ? H A GLN 180 ? ? 1.59 6 19 O A ASP 177 ? ? H A GLN 180 ? ? 1.59 7 22 O A ASP 177 ? ? H A GLN 180 ? ? 1.60 8 29 O A ASP 177 ? ? H A GLN 180 ? ? 1.60 9 30 O A ASP 177 ? ? H A GLN 180 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 141 ? ? -160.43 -164.18 2 1 ALA A 145 ? ? -79.14 39.69 3 1 ASP A 146 ? ? -160.70 34.87 4 1 THR A 172 ? ? -160.02 91.17 5 2 GLN A 128 ? ? 60.51 158.81 6 2 SER A 141 ? ? -160.44 -164.69 7 2 ALA A 145 ? ? -82.38 35.67 8 2 ASP A 146 ? ? -160.96 35.63 9 2 THR A 152 ? ? -105.22 -60.47 10 2 ARG A 158 ? ? -160.08 -50.10 11 2 PHE A 168 ? ? 43.52 79.43 12 2 ARG A 170 ? ? -160.13 109.21 13 3 SER A 141 ? ? -160.11 -165.14 14 3 ALA A 145 ? ? -77.48 36.87 15 3 ASP A 146 ? ? -161.05 34.41 16 3 ARG A 158 ? ? -160.07 -44.16 17 4 GLN A 128 ? ? 60.07 74.57 18 4 ALA A 145 ? ? -69.63 50.71 19 4 ASP A 146 ? ? -160.61 31.37 20 4 ARG A 158 ? ? -159.96 -45.25 21 4 PHE A 168 ? ? 65.86 -72.49 22 4 THR A 172 ? ? -159.99 81.30 23 4 LEU A 176 ? ? -124.27 -158.96 24 5 ALA A 145 ? ? -80.42 39.22 25 5 ASP A 146 ? ? -160.78 31.57 26 5 THR A 152 ? ? -137.55 -55.54 27 5 PHE A 168 ? ? -166.37 76.86 28 5 THR A 172 ? ? -159.74 84.21 29 6 GLN A 128 ? ? 63.44 140.86 30 6 SER A 141 ? ? -160.22 -165.42 31 6 ALA A 145 ? ? -80.53 38.44 32 6 ASP A 146 ? ? -161.03 36.98 33 6 VAL A 151 ? ? -56.98 105.95 34 7 VAL A 129 ? ? -98.64 31.12 35 7 ASP A 135 ? ? -57.91 -176.08 36 7 SER A 141 ? ? -160.50 -163.50 37 7 ALA A 145 ? ? -79.53 37.68 38 7 ASP A 146 ? ? -160.91 32.05 39 7 ARG A 158 ? ? -159.86 -45.17 40 7 LEU A 176 ? ? -137.54 -159.18 41 8 ALA A 145 ? ? -69.82 46.93 42 8 ASP A 146 ? ? -160.71 32.19 43 8 ILE A 167 ? ? -136.29 -66.83 44 8 PHE A 168 ? ? -91.46 55.57 45 8 PRO A 173 ? ? -66.77 83.37 46 9 ALA A 145 ? ? -67.82 39.49 47 9 ASP A 146 ? ? -160.89 31.23 48 9 ARG A 158 ? ? -103.80 -60.16 49 10 GLN A 128 ? ? -166.32 97.81 50 10 ALA A 145 ? ? -69.65 47.63 51 10 ASP A 146 ? ? -160.79 32.34 52 10 ARG A 158 ? ? -97.37 -67.21 53 10 PRO A 173 ? ? -56.23 90.16 54 11 SER A 141 ? ? -160.02 -166.40 55 11 ALA A 145 ? ? -75.30 36.48 56 11 ASP A 146 ? ? -161.16 34.13 57 11 THR A 172 ? ? -157.14 88.41 58 11 LEU A 176 ? ? -126.94 -160.41 59 12 GLN A 128 ? ? 60.49 162.59 60 12 ALA A 145 ? ? -70.06 46.58 61 12 ASP A 146 ? ? -160.56 30.82 62 12 THR A 152 ? ? -100.74 -68.92 63 12 ARG A 158 ? ? -158.60 -44.25 64 12 ILE A 167 ? ? -102.69 53.47 65 12 PHE A 168 ? ? 65.67 96.49 66 12 ARG A 170 ? ? -154.44 86.07 67 12 THR A 172 ? ? -160.00 93.30 68 13 ALA A 145 ? ? -70.02 45.21 69 13 ASP A 146 ? ? -160.69 31.74 70 13 PHE A 168 ? ? 62.29 70.39 71 13 THR A 172 ? ? -160.09 97.80 72 14 GLN A 128 ? ? -98.91 30.71 73 14 SER A 141 ? ? -160.18 -167.85 74 14 ALA A 145 ? ? -80.69 38.22 75 14 ASP A 146 ? ? -160.84 32.63 76 14 ARG A 158 ? ? -98.49 -62.42 77 14 PRO A 173 ? ? -66.88 87.18 78 15 SER A 141 ? ? -160.13 -165.52 79 15 ALA A 145 ? ? -81.13 38.91 80 15 ASP A 146 ? ? -160.97 36.49 81 15 PHE A 168 ? ? -171.18 86.15 82 16 GLN A 128 ? ? -159.34 -57.92 83 16 VAL A 129 ? ? -158.09 -43.58 84 16 ALA A 130 ? ? -55.93 -172.26 85 16 SER A 141 ? ? -160.35 -165.13 86 16 ALA A 145 ? ? -78.75 38.06 87 16 ASP A 146 ? ? -160.89 36.60 88 17 GLN A 128 ? ? -97.98 51.84 89 17 SER A 141 ? ? -160.11 -164.57 90 17 ALA A 145 ? ? -78.86 37.85 91 17 ASP A 146 ? ? -161.08 36.00 92 17 GLU A 157 ? ? -58.70 -73.30 93 17 LEU A 176 ? ? -137.33 -159.52 94 18 GLN A 128 ? ? 60.65 172.23 95 18 ASP A 135 ? ? -55.48 -178.85 96 18 ALA A 145 ? ? -70.31 49.68 97 18 ASP A 146 ? ? -160.69 32.63 98 18 PHE A 168 ? ? 64.97 -77.71 99 18 THR A 172 ? ? -160.06 113.80 100 19 SER A 141 ? ? -160.45 -164.10 101 19 ALA A 145 ? ? -80.58 39.44 102 19 ASP A 146 ? ? -160.74 34.69 103 19 VAL A 151 ? ? -60.20 99.84 104 19 LEU A 176 ? ? -137.16 -159.76 105 20 GLN A 128 ? ? -169.54 95.18 106 20 SER A 141 ? ? -160.42 -163.55 107 20 ALA A 145 ? ? -82.49 39.85 108 20 ASP A 146 ? ? -160.81 35.97 109 20 ILE A 167 ? ? -91.80 -67.00 110 20 THR A 172 ? ? -160.11 112.39 111 20 LEU A 176 ? ? -137.45 -159.87 112 21 ASP A 135 ? ? -58.00 -168.59 113 21 SER A 141 ? ? -160.24 -164.43 114 21 ALA A 145 ? ? -80.53 37.51 115 21 ASP A 146 ? ? -161.08 35.60 116 21 ILE A 167 ? ? -102.85 -62.73 117 21 PHE A 168 ? ? -146.30 59.51 118 21 VAL A 182 ? ? -133.34 -150.58 119 22 ASP A 146 ? ? -160.68 32.21 120 22 PHE A 168 ? ? 63.99 99.18 121 23 GLN A 128 ? ? -162.57 37.13 122 23 SER A 141 ? ? -160.23 -164.57 123 23 ALA A 145 ? ? -78.48 37.26 124 23 ASP A 146 ? ? -161.11 32.80 125 24 ALA A 130 ? ? -62.04 -70.65 126 24 SER A 141 ? ? -160.40 -164.15 127 24 ALA A 145 ? ? -82.60 39.87 128 24 ASP A 146 ? ? -160.77 36.22 129 24 PHE A 168 ? ? 62.82 -79.91 130 25 SER A 141 ? ? -160.44 -163.48 131 25 ALA A 145 ? ? -83.29 38.95 132 25 ASP A 146 ? ? -160.80 36.50 133 25 PRO A 173 ? ? -58.74 104.27 134 26 ALA A 145 ? ? -70.36 48.99 135 26 ASP A 146 ? ? -160.44 29.91 136 26 ILE A 167 ? ? -159.78 -46.29 137 26 PHE A 168 ? ? -97.58 35.25 138 27 ALA A 145 ? ? -70.11 48.39 139 27 ASP A 146 ? ? -160.72 32.39 140 27 ARG A 158 ? ? -138.07 -46.01 141 27 THR A 172 ? ? -150.66 89.68 142 28 ALA A 130 ? ? -61.96 -172.55 143 28 ALA A 145 ? ? -68.52 41.84 144 28 ASP A 146 ? ? -160.95 32.78 145 28 ARG A 158 ? ? -160.00 -45.06 146 28 PHE A 168 ? ? -172.82 78.54 147 28 THR A 172 ? ? -160.08 89.84 148 29 ASP A 135 ? ? -56.26 174.07 149 29 ALA A 145 ? ? -69.81 45.21 150 29 ASP A 146 ? ? -160.69 32.19 151 29 VAL A 151 ? ? -68.65 96.84 152 30 GLN A 128 ? ? 60.99 101.26 153 30 VAL A 140 ? ? -80.02 -71.49 154 30 SER A 141 ? ? -160.50 -163.52 155 30 ALA A 145 ? ? -90.15 31.52 156 30 ASP A 146 ? ? -161.26 38.69 157 30 PHE A 168 ? ? -178.23 38.92 158 31 GLN A 128 ? ? 61.62 116.95 159 31 SER A 141 ? ? -160.83 -163.98 160 31 ALA A 145 ? ? -82.05 40.40 161 31 ASP A 146 ? ? -161.40 35.60 162 31 LEU A 176 ? ? -125.02 -162.46 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # _pdbx_nmr_ensemble.entry_id 1NZ9 _pdbx_nmr_ensemble.conformers_calculated_total_number 90 _pdbx_nmr_ensemble.conformers_submitted_total_number 31 _pdbx_nmr_ensemble.conformer_selection_criteria ;structures with the lowest energy, NONE WITH DISTANCE VIOLATIONS > 0.2 ANGSTROMS, NONE WITH DIHEDRAL ANGLE RESTRAINT VIOLATIONS > 2 DEGREES ; _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1NZ9 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2mM NusG C-domain, 50mM phosphate buffer, 100mM KCL, 95% H2O, 5% D2O' '95% H2O/5% D2O' 2 '2mM 15N NusG C-domain, 50mM phosphate buffer, 100mM KCL, 95% H2O, 5% D2O' '95% H2O/5% D2O' 3 '2mM 15N NusG C-domain, 50mM phosphate buffer, 100mM KCL, 100% D2O' '100% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 318 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM phospahte, 100mM KCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 3 1 HSQC 3 2 1 HMQC-J # _pdbx_nmr_details.entry_id 1NZ9 _pdbx_nmr_details.text 'Model 31 is the minimized average structure' # _pdbx_nmr_refine.entry_id 1NZ9 _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics, torsion angle dynamics' _pdbx_nmr_refine.details ;566 UNAMBIGUOUS NOE DISTANCE RESTRAINTS, 52 HYDROGEN BOND RESTRAINTS, 46 HN-N DIPOLAR COUPLINGS, NO RESONANCES WERE ASSIGNED FOR ALA 127 ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 processing Bruker 1 ANSIG 3.3 'data analysis' Kraulis 2 CNS 1.1 'structure solution' Brunger 3 CNS 1.1 refinement ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 PRO N N N N 235 PRO CA C N S 236 PRO C C N N 237 PRO O O N N 238 PRO CB C N N 239 PRO CG C N N 240 PRO CD C N N 241 PRO OXT O N N 242 PRO H H N N 243 PRO HA H N N 244 PRO HB2 H N N 245 PRO HB3 H N N 246 PRO HG2 H N N 247 PRO HG3 H N N 248 PRO HD2 H N N 249 PRO HD3 H N N 250 PRO HXT H N N 251 SER N N N N 252 SER CA C N S 253 SER C C N N 254 SER O O N N 255 SER CB C N N 256 SER OG O N N 257 SER OXT O N N 258 SER H H N N 259 SER H2 H N N 260 SER HA H N N 261 SER HB2 H N N 262 SER HB3 H N N 263 SER HG H N N 264 SER HXT H N N 265 THR N N N N 266 THR CA C N S 267 THR C C N N 268 THR O O N N 269 THR CB C N R 270 THR OG1 O N N 271 THR CG2 C N N 272 THR OXT O N N 273 THR H H N N 274 THR H2 H N N 275 THR HA H N N 276 THR HB H N N 277 THR HG1 H N N 278 THR HG21 H N N 279 THR HG22 H N N 280 THR HG23 H N N 281 THR HXT H N N 282 VAL N N N N 283 VAL CA C N S 284 VAL C C N N 285 VAL O O N N 286 VAL CB C N N 287 VAL CG1 C N N 288 VAL CG2 C N N 289 VAL OXT O N N 290 VAL H H N N 291 VAL H2 H N N 292 VAL HA H N N 293 VAL HB H N N 294 VAL HG11 H N N 295 VAL HG12 H N N 296 VAL HG13 H N N 297 VAL HG21 H N N 298 VAL HG22 H N N 299 VAL HG23 H N N 300 VAL HXT H N N 301 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 VAL N CA sing N N 270 VAL N H sing N N 271 VAL N H2 sing N N 272 VAL CA C sing N N 273 VAL CA CB sing N N 274 VAL CA HA sing N N 275 VAL C O doub N N 276 VAL C OXT sing N N 277 VAL CB CG1 sing N N 278 VAL CB CG2 sing N N 279 VAL CB HB sing N N 280 VAL CG1 HG11 sing N N 281 VAL CG1 HG12 sing N N 282 VAL CG1 HG13 sing N N 283 VAL CG2 HG21 sing N N 284 VAL CG2 HG22 sing N N 285 VAL CG2 HG23 sing N N 286 VAL OXT HXT sing N N 287 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 500 2 ? Bruker DMX 750 # _atom_sites.entry_id 1NZ9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_