data_1O0P # _entry.id 1O0P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1O0P pdb_00001o0p 10.2210/pdb1o0p/pdb RCSB RCSB018428 ? ? WWPDB D_1000018428 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1O0P _pdbx_database_status.recvd_initial_deposition_date 2003-02-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Selenko, P.' 1 'Gregorovic, G.' 2 'Sprangers, R.' 3 'Stier, G.' 4 'Rhani, Z.' 5 'Kramer, A.' 6 'Sattler, M.' 7 # _citation.id primary _citation.title 'Structural Basis for the molecular recognition between human splicing factors U2AF65 and SF1/mBBP' _citation.journal_abbrev Mol.Cell _citation.journal_volume 11 _citation.page_first 965 _citation.page_last 976 _citation.year 2003 _citation.journal_id_ASTM MOCEFL _citation.country US _citation.journal_id_ISSN 1097-2765 _citation.journal_id_CSD 2168 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12718882 _citation.pdbx_database_id_DOI '10.1016/S1097-2765(03)00115-1' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Selenko, P.' 1 ? primary 'Gregorovic, G.' 2 ? primary 'Sprangers, R.' 3 ? primary 'Stier, G.' 4 ? primary 'Rhani, Z.' 5 ? primary 'Kramer, A.' 6 ? primary 'Sattler, M.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Splicing factor U2AF 65 kDa subunit' 11976.615 1 ? ? 'C-terminal RRM domain' ? 2 polymer syn 'Splicing Factor SF1' 1691.936 1 ? ? 'N-terminal peptide' ? # _entity_name_com.entity_id 1 _entity_name_com.name 'U2 auxiliary factor 65 kDa subunit, U2 snRNP auxiliary factor large subunit, hU2AF(65)' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTG RKFANRVVVTKYCDPDSYHRRDFW ; ;GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTG RKFANRVVVTKYCDPDSYHRRDFW ; A ? 2 'polypeptide(L)' no no PSKKRKRSRWNQD PSKKRKRSRWNQD B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 PRO n 1 4 THR n 1 5 GLU n 1 6 VAL n 1 7 LEU n 1 8 CYS n 1 9 LEU n 1 10 MET n 1 11 ASN n 1 12 MET n 1 13 VAL n 1 14 LEU n 1 15 PRO n 1 16 GLU n 1 17 GLU n 1 18 LEU n 1 19 LEU n 1 20 ASP n 1 21 ASP n 1 22 GLU n 1 23 GLU n 1 24 TYR n 1 25 GLU n 1 26 GLU n 1 27 ILE n 1 28 VAL n 1 29 GLU n 1 30 ASP n 1 31 VAL n 1 32 ARG n 1 33 ASP n 1 34 GLU n 1 35 CYS n 1 36 SER n 1 37 LYS n 1 38 TYR n 1 39 GLY n 1 40 LEU n 1 41 VAL n 1 42 LYS n 1 43 SER n 1 44 ILE n 1 45 GLU n 1 46 ILE n 1 47 PRO n 1 48 ARG n 1 49 PRO n 1 50 VAL n 1 51 ASP n 1 52 GLY n 1 53 VAL n 1 54 GLU n 1 55 VAL n 1 56 PRO n 1 57 GLY n 1 58 CYS n 1 59 GLY n 1 60 LYS n 1 61 ILE n 1 62 PHE n 1 63 VAL n 1 64 GLU n 1 65 PHE n 1 66 THR n 1 67 SER n 1 68 VAL n 1 69 PHE n 1 70 ASP n 1 71 CYS n 1 72 GLN n 1 73 LYS n 1 74 ALA n 1 75 MET n 1 76 GLN n 1 77 GLY n 1 78 LEU n 1 79 THR n 1 80 GLY n 1 81 ARG n 1 82 LYS n 1 83 PHE n 1 84 ALA n 1 85 ASN n 1 86 ARG n 1 87 VAL n 1 88 VAL n 1 89 VAL n 1 90 THR n 1 91 LYS n 1 92 TYR n 1 93 CYS n 1 94 ASP n 1 95 PRO n 1 96 ASP n 1 97 SER n 1 98 TYR n 1 99 HIS n 1 100 ARG n 1 101 ARG n 1 102 ASP n 1 103 PHE n 1 104 TRP n 2 1 PRO n 2 2 SER n 2 3 LYS n 2 4 LYS n 2 5 ARG n 2 6 LYS n 2 7 ARG n 2 8 SER n 2 9 ARG n 2 10 TRP n 2 11 ASN n 2 12 GLN n 2 13 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'modified pET24d' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;THE PEPTIDE WAS CHEMICALLY SYNTHESIZED AND DERIVED FROM THE N-TERMINUS OF SF1. THE SEQUENCE OF THE PEPTIDE IS NATURALLY FOUND IN HOMO SAPIENS (HUMAN). ; # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP U2AF2_HUMAN 1 ;GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTG RKFANRVVVTKYCDPDSYHRRDFW ; 372 P26368 ? 2 GB CAA03883 2 PSKKRKRSRWNQD 13 2463198 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1O0P A 1 ? 104 ? P26368 372 ? 475 ? 372 475 2 2 1O0P B 1 ? 13 ? 2463198 13 ? 25 ? 13 25 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 2 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 2 1 3D_13C/15N-edited/filtered_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 295 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM salt' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM 15N,13C U2AF65-RRM3 + 1mM unlabeled SF1_10-25, 30mM phosphate buffer, 20mM NaCL, 3mM DTT' '90% H2O/10% D2O' 2 '1mM 15N,13C U2AF65-RRM3 + 1mM unlabeled SF1_10-25, 30mM phosphate buffer, 20mM NaCL, 3mM DTT' '100% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 600 2 ? Bruker DRX 500 3 ? Bruker DRX 800 # _pdbx_nmr_refine.entry_id 1O0P _pdbx_nmr_refine.method 'Restrained molecular dynamics using CNS and ARIA for ambiguous distance restraints' _pdbx_nmr_refine.details ;THE EXPERIMENTALLY DETERMINED DISTANCE (3232 NOEs, INCLUDING 258 FOR THE SF1 PEPTIDE, 64 INTERMOLECULAR, AND 2*35 FOR HYDROGEN BONDS) AND DIHEDRAL ANGLE RESTRAINTS (99) WERE APPLIED IN A MIXED TORSION AND CARTESIAN ANGLE DYNAMICS/SIMULATED ANNEALING PROTOCOL. STRUCTURAL QUALITY WAS ASSESED WITH PROCHECK. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1O0P _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1O0P _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 2.1 processing DELAGIO 1 XEASY ? 'data analysis' BARTELS 2 ARIA 1.2 'structure solution' NILGES 3 CNS 1.1 'structure solution' BRUNGER 4 CNS 1.1 refinement BRUNGER 5 # _exptl.entry_id 1O0P _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1O0P _struct.title 'Solution Structure of the third RNA Recognition Motif (RRM) of U2AF65 in complex with an N-terminal SF1 peptide' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1O0P _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text ;NON-CANONICAL RNA RECOGNITION MOTIF, 4-STRANDED ANTI-PARALLEL BETA-SHEET, 2 ALPHA HELICES additionally extended by a third helix C, RNA BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 20 ? SER A 36 ? ASP A 391 SER A 407 1 ? 17 HELX_P HELX_P2 2 SER A 67 ? THR A 79 ? SER A 438 THR A 450 1 ? 13 HELX_P HELX_P3 3 ASP A 94 ? ARG A 101 ? ASP A 465 ARG A 472 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 41 ? GLU A 45 ? VAL A 412 GLU A 416 A 2 LYS A 60 ? PHE A 65 ? LYS A 431 PHE A 436 A 3 VAL A 6 ? MET A 10 ? VAL A 377 MET A 381 A 4 VAL A 89 ? CYS A 93 ? VAL A 460 CYS A 464 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 43 ? N SER A 414 O GLU A 64 ? O GLU A 435 A 2 3 O VAL A 63 ? O VAL A 434 N LEU A 7 ? N LEU A 378 A 3 4 N MET A 10 ? N MET A 381 O VAL A 89 ? O VAL A 460 # _database_PDB_matrix.entry_id 1O0P _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1O0P _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 372 372 GLY GLY A . n A 1 2 HIS 2 373 373 HIS HIS A . n A 1 3 PRO 3 374 374 PRO PRO A . n A 1 4 THR 4 375 375 THR THR A . n A 1 5 GLU 5 376 376 GLU GLU A . n A 1 6 VAL 6 377 377 VAL VAL A . n A 1 7 LEU 7 378 378 LEU LEU A . n A 1 8 CYS 8 379 379 CYS CYS A . n A 1 9 LEU 9 380 380 LEU LEU A . n A 1 10 MET 10 381 381 MET MET A . n A 1 11 ASN 11 382 382 ASN ASN A . n A 1 12 MET 12 383 383 MET MET A . n A 1 13 VAL 13 384 384 VAL VAL A . n A 1 14 LEU 14 385 385 LEU LEU A . n A 1 15 PRO 15 386 386 PRO PRO A . n A 1 16 GLU 16 387 387 GLU GLU A . n A 1 17 GLU 17 388 388 GLU GLU A . n A 1 18 LEU 18 389 389 LEU LEU A . n A 1 19 LEU 19 390 390 LEU LEU A . n A 1 20 ASP 20 391 391 ASP ASP A . n A 1 21 ASP 21 392 392 ASP ASP A . n A 1 22 GLU 22 393 393 GLU GLU A . n A 1 23 GLU 23 394 394 GLU GLU A . n A 1 24 TYR 24 395 395 TYR TYR A . n A 1 25 GLU 25 396 396 GLU GLU A . n A 1 26 GLU 26 397 397 GLU GLU A . n A 1 27 ILE 27 398 398 ILE ILE A . n A 1 28 VAL 28 399 399 VAL VAL A . n A 1 29 GLU 29 400 400 GLU GLU A . n A 1 30 ASP 30 401 401 ASP ASP A . n A 1 31 VAL 31 402 402 VAL VAL A . n A 1 32 ARG 32 403 403 ARG ARG A . n A 1 33 ASP 33 404 404 ASP ASP A . n A 1 34 GLU 34 405 405 GLU GLU A . n A 1 35 CYS 35 406 406 CYS CYS A . n A 1 36 SER 36 407 407 SER SER A . n A 1 37 LYS 37 408 408 LYS LYS A . n A 1 38 TYR 38 409 409 TYR TYR A . n A 1 39 GLY 39 410 410 GLY GLY A . n A 1 40 LEU 40 411 411 LEU LEU A . n A 1 41 VAL 41 412 412 VAL VAL A . n A 1 42 LYS 42 413 413 LYS LYS A . n A 1 43 SER 43 414 414 SER SER A . n A 1 44 ILE 44 415 415 ILE ILE A . n A 1 45 GLU 45 416 416 GLU GLU A . n A 1 46 ILE 46 417 417 ILE ILE A . n A 1 47 PRO 47 418 418 PRO PRO A . n A 1 48 ARG 48 419 419 ARG ARG A . n A 1 49 PRO 49 420 420 PRO PRO A . n A 1 50 VAL 50 421 421 VAL VAL A . n A 1 51 ASP 51 422 422 ASP ASP A . n A 1 52 GLY 52 423 423 GLY GLY A . n A 1 53 VAL 53 424 424 VAL VAL A . n A 1 54 GLU 54 425 425 GLU GLU A . n A 1 55 VAL 55 426 426 VAL VAL A . n A 1 56 PRO 56 427 427 PRO PRO A . n A 1 57 GLY 57 428 428 GLY GLY A . n A 1 58 CYS 58 429 429 CYS CYS A . n A 1 59 GLY 59 430 430 GLY GLY A . n A 1 60 LYS 60 431 431 LYS LYS A . n A 1 61 ILE 61 432 432 ILE ILE A . n A 1 62 PHE 62 433 433 PHE PHE A . n A 1 63 VAL 63 434 434 VAL VAL A . n A 1 64 GLU 64 435 435 GLU GLU A . n A 1 65 PHE 65 436 436 PHE PHE A . n A 1 66 THR 66 437 437 THR THR A . n A 1 67 SER 67 438 438 SER SER A . n A 1 68 VAL 68 439 439 VAL VAL A . n A 1 69 PHE 69 440 440 PHE PHE A . n A 1 70 ASP 70 441 441 ASP ASP A . n A 1 71 CYS 71 442 442 CYS CYS A . n A 1 72 GLN 72 443 443 GLN GLN A . n A 1 73 LYS 73 444 444 LYS LYS A . n A 1 74 ALA 74 445 445 ALA ALA A . n A 1 75 MET 75 446 446 MET MET A . n A 1 76 GLN 76 447 447 GLN GLN A . n A 1 77 GLY 77 448 448 GLY GLY A . n A 1 78 LEU 78 449 449 LEU LEU A . n A 1 79 THR 79 450 450 THR THR A . n A 1 80 GLY 80 451 451 GLY GLY A . n A 1 81 ARG 81 452 452 ARG ARG A . n A 1 82 LYS 82 453 453 LYS LYS A . n A 1 83 PHE 83 454 454 PHE PHE A . n A 1 84 ALA 84 455 455 ALA ALA A . n A 1 85 ASN 85 456 456 ASN ASN A . n A 1 86 ARG 86 457 457 ARG ARG A . n A 1 87 VAL 87 458 458 VAL VAL A . n A 1 88 VAL 88 459 459 VAL VAL A . n A 1 89 VAL 89 460 460 VAL VAL A . n A 1 90 THR 90 461 461 THR THR A . n A 1 91 LYS 91 462 462 LYS LYS A . n A 1 92 TYR 92 463 463 TYR TYR A . n A 1 93 CYS 93 464 464 CYS CYS A . n A 1 94 ASP 94 465 465 ASP ASP A . n A 1 95 PRO 95 466 466 PRO PRO A . n A 1 96 ASP 96 467 467 ASP ASP A . n A 1 97 SER 97 468 468 SER SER A . n A 1 98 TYR 98 469 469 TYR TYR A . n A 1 99 HIS 99 470 470 HIS HIS A . n A 1 100 ARG 100 471 471 ARG ARG A . n A 1 101 ARG 101 472 472 ARG ARG A . n A 1 102 ASP 102 473 473 ASP ASP A . n A 1 103 PHE 103 474 474 PHE PHE A . n A 1 104 TRP 104 475 475 TRP TRP A . n B 2 1 PRO 1 13 13 PRO PRO B . n B 2 2 SER 2 14 14 SER SER B . n B 2 3 LYS 3 15 15 LYS LYS B . n B 2 4 LYS 4 16 16 LYS LYS B . n B 2 5 ARG 5 17 17 ARG ARG B . n B 2 6 LYS 6 18 18 LYS LYS B . n B 2 7 ARG 7 19 19 ARG ARG B . n B 2 8 SER 8 20 20 SER SER B . n B 2 9 ARG 9 21 21 ARG ARG B . n B 2 10 TRP 10 22 22 TRP TRP B . n B 2 11 ASN 11 23 23 ASN ASN B . n B 2 12 GLN 12 24 24 GLN GLN B . n B 2 13 ASP 13 25 25 ASP ASP B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-05-06 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 373 ? ? -172.47 122.05 2 1 THR A 375 ? ? -120.79 -72.62 3 1 GLU A 376 ? ? -177.75 -38.02 4 1 LEU A 389 ? ? -85.30 34.05 5 1 PRO A 427 ? ? -47.63 92.12 6 1 ARG A 452 ? ? -75.53 -141.48 7 1 ALA A 455 ? ? -162.62 -52.11 8 1 ASN A 456 ? ? -163.64 13.68 9 1 ASP A 467 ? ? -64.63 -77.52 10 1 PHE A 474 ? ? -89.61 -79.35 11 1 SER B 14 ? ? 59.51 -173.50 12 1 LYS B 15 ? ? -161.29 -35.95 13 1 LYS B 16 ? ? -135.24 -51.68 14 1 SER B 20 ? ? -147.12 49.89 15 1 TRP B 22 ? ? 53.82 87.48 16 1 GLN B 24 ? ? -167.59 -44.85 17 2 HIS A 373 ? ? -176.69 109.59 18 2 THR A 375 ? ? -141.13 -67.94 19 2 GLU A 376 ? ? -173.09 -47.24 20 2 ASP A 422 ? ? 56.67 19.65 21 2 PRO A 427 ? ? -94.28 38.01 22 2 ALA A 455 ? ? -152.25 -46.19 23 2 ASN A 456 ? ? -162.39 13.79 24 2 ASP A 467 ? ? -64.54 -71.74 25 2 PHE A 474 ? ? -63.91 -75.92 26 2 LYS B 15 ? ? -141.41 55.99 27 2 ARG B 17 ? ? 56.84 86.29 28 2 LYS B 18 ? ? -163.18 -48.04 29 2 SER B 20 ? ? -102.30 56.63 30 2 ARG B 21 ? ? 59.91 -175.48 31 2 ASN B 23 ? ? -64.98 -79.54 32 2 GLN B 24 ? ? 64.41 127.24 33 3 HIS A 373 ? ? 65.16 90.04 34 3 THR A 375 ? ? -108.22 -69.53 35 3 GLU A 376 ? ? -176.39 -45.62 36 3 MET A 383 ? ? -167.35 -28.81 37 3 LEU A 389 ? ? -86.22 38.22 38 3 VAL A 421 ? ? -68.65 96.18 39 3 GLU A 425 ? ? -81.13 35.67 40 3 PRO A 427 ? ? -66.09 79.59 41 3 ARG A 452 ? ? -77.85 -160.56 42 3 ALA A 455 ? ? -166.18 -41.08 43 3 ASN A 456 ? ? -167.31 26.76 44 3 ASP A 467 ? ? -59.93 -73.70 45 3 SER B 14 ? ? -70.58 -164.70 46 3 LYS B 15 ? ? -102.42 -73.16 47 3 LYS B 16 ? ? -156.92 -37.44 48 3 GLN B 24 ? ? 65.61 132.13 49 4 HIS A 373 ? ? -172.91 134.50 50 4 THR A 375 ? ? -120.50 -69.86 51 4 GLU A 376 ? ? -174.53 -43.07 52 4 MET A 383 ? ? -140.36 -3.05 53 4 LEU A 389 ? ? -84.99 40.90 54 4 SER A 407 ? ? -90.18 32.20 55 4 GLU A 425 ? ? -82.78 36.20 56 4 PRO A 427 ? ? -63.19 84.01 57 4 ARG A 452 ? ? -121.50 -119.49 58 4 LYS A 453 ? ? 178.58 97.42 59 4 ALA A 455 ? ? 77.46 -27.13 60 4 ASN A 456 ? ? -178.42 -41.19 61 4 ASP A 467 ? ? -59.70 -80.11 62 4 LYS B 16 ? ? -159.55 -8.51 63 4 ARG B 21 ? ? -98.25 33.58 64 4 ASN B 23 ? ? -72.73 -158.76 65 4 GLN B 24 ? ? 72.64 -22.54 66 5 HIS A 373 ? ? -176.58 99.71 67 5 THR A 375 ? ? -114.09 -73.60 68 5 GLU A 376 ? ? -175.49 -42.31 69 5 MET A 383 ? ? -166.31 15.70 70 5 VAL A 421 ? ? -65.74 92.09 71 5 ASP A 422 ? ? 57.77 17.51 72 5 VAL A 424 ? ? -101.09 -80.92 73 5 VAL A 426 ? ? -116.62 73.62 74 5 ALA A 455 ? ? -167.35 -51.08 75 5 ASN A 456 ? ? -162.37 31.82 76 5 LYS A 462 ? ? -119.09 -164.56 77 5 ASP A 467 ? ? -58.42 -77.23 78 5 PHE A 474 ? ? -93.96 -74.72 79 5 ARG B 17 ? ? 54.68 -162.02 80 5 LYS B 18 ? ? 62.52 -86.80 81 5 SER B 20 ? ? 59.23 -178.16 82 5 ARG B 21 ? ? 60.35 103.34 83 5 TRP B 22 ? ? 56.88 85.66 84 5 GLN B 24 ? ? 65.25 125.91 85 6 HIS A 373 ? ? -168.78 118.77 86 6 THR A 375 ? ? -136.60 -71.35 87 6 GLU A 376 ? ? -175.27 -43.98 88 6 ASN A 382 ? ? 60.97 62.18 89 6 MET A 383 ? ? -167.08 16.80 90 6 LEU A 389 ? ? -85.50 38.10 91 6 SER A 407 ? ? -90.21 32.58 92 6 VAL A 421 ? ? -61.76 95.15 93 6 VAL A 424 ? ? -96.82 -77.53 94 6 PRO A 427 ? ? -94.12 51.84 95 6 ALA A 455 ? ? -158.69 -61.88 96 6 ASN A 456 ? ? -158.93 17.28 97 6 LYS B 16 ? ? -152.74 -16.53 98 6 LYS B 18 ? ? 66.41 138.62 99 6 ARG B 21 ? ? 64.81 120.13 100 6 GLN B 24 ? ? -175.45 80.68 101 7 PRO A 374 ? ? -37.70 111.07 102 7 MET A 383 ? ? -144.88 11.30 103 7 LEU A 389 ? ? -86.00 40.86 104 7 PRO A 420 ? ? -49.67 109.60 105 7 ASP A 422 ? ? 57.35 19.27 106 7 VAL A 424 ? ? -101.63 -66.60 107 7 VAL A 426 ? ? 36.63 101.33 108 7 PRO A 427 ? ? -68.73 22.43 109 7 CYS A 429 ? ? -48.77 159.85 110 7 THR A 450 ? ? -62.33 -70.58 111 7 LYS A 453 ? ? -38.25 99.65 112 7 ALA A 455 ? ? -142.18 -55.47 113 7 ASN A 456 ? ? -172.75 39.81 114 7 VAL A 458 ? ? -48.43 97.55 115 7 ASP A 467 ? ? -63.35 -79.71 116 7 PHE A 474 ? ? -108.74 -60.77 117 7 LYS B 15 ? ? -155.35 59.65 118 7 TRP B 22 ? ? 63.24 110.09 119 7 ASN B 23 ? ? 38.18 88.68 120 8 HIS A 373 ? ? -170.62 120.26 121 8 THR A 375 ? ? -119.68 -72.12 122 8 GLU A 376 ? ? -175.32 -43.91 123 8 LEU A 389 ? ? -82.82 40.63 124 8 VAL A 421 ? ? -69.10 97.21 125 8 GLU A 425 ? ? -79.63 35.03 126 8 PRO A 427 ? ? -65.82 79.27 127 8 ARG A 452 ? ? -118.95 -165.04 128 8 ALA A 455 ? ? -165.25 -45.97 129 8 ASN A 456 ? ? -173.12 33.73 130 8 ARG A 472 ? ? 76.53 -48.83 131 8 PHE A 474 ? ? -122.65 -71.75 132 8 SER B 14 ? ? -108.56 -61.29 133 8 LYS B 16 ? ? -137.57 -54.21 134 8 ARG B 17 ? ? -150.99 11.37 135 8 SER B 20 ? ? -76.53 -155.90 136 8 ARG B 21 ? ? 65.91 150.94 137 8 TRP B 22 ? ? 61.42 89.40 138 8 ASN B 23 ? ? 62.13 126.99 139 9 GLU A 376 ? ? -175.90 -46.05 140 9 MET A 383 ? ? -142.33 -25.72 141 9 SER A 407 ? ? -90.07 30.89 142 9 PRO A 420 ? ? -48.45 166.21 143 9 GLU A 425 ? ? -67.45 -125.84 144 9 PRO A 427 ? ? -94.55 34.83 145 9 CYS A 429 ? ? -56.24 178.42 146 9 ARG A 452 ? ? -71.28 -159.86 147 9 ALA A 455 ? ? -168.96 -38.52 148 9 ASN A 456 ? ? -161.17 23.05 149 9 ASP A 467 ? ? -64.24 -71.48 150 9 PHE A 474 ? ? -102.12 -76.48 151 9 LYS B 15 ? ? -76.08 -72.23 152 9 LYS B 16 ? ? -129.80 -50.76 153 9 TRP B 22 ? ? -143.45 46.10 154 9 ASN B 23 ? ? -72.29 -164.04 155 9 GLN B 24 ? ? -175.04 -37.35 156 10 HIS A 373 ? ? -173.66 122.87 157 10 GLU A 376 ? ? -174.53 -44.15 158 10 MET A 383 ? ? -150.81 26.46 159 10 VAL A 384 ? ? -151.22 -69.47 160 10 LEU A 385 ? ? 72.47 142.68 161 10 LEU A 389 ? ? -86.77 31.86 162 10 PRO A 420 ? ? -28.33 95.18 163 10 GLU A 425 ? ? 1.53 84.69 164 10 VAL A 426 ? ? -151.44 -62.24 165 10 PRO A 427 ? ? -64.66 83.31 166 10 ARG A 452 ? ? -77.78 -130.60 167 10 LYS A 453 ? ? -169.18 117.41 168 10 ALA A 455 ? ? -164.65 -41.95 169 10 ASN A 456 ? ? -160.82 14.02 170 10 ASP A 467 ? ? -64.22 -73.97 171 10 LYS B 15 ? ? -162.33 -47.38 172 10 LYS B 16 ? ? -144.43 -54.86 173 10 TRP B 22 ? ? -140.86 49.66 174 10 ASN B 23 ? ? -68.06 91.82 175 10 GLN B 24 ? ? -168.56 114.45 #