data_1O16 # _entry.id 1O16 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1O16 pdb_00001o16 10.2210/pdb1o16/pdb RCSB RCSB001673 ? ? WWPDB D_1000001673 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1LUE _pdbx_database_related.details 'RECOMBINANT SPERM WHALE MYOGLOBIN H64D/V68A/D122N MUTANT (MET)' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1O16 _pdbx_database_status.recvd_initial_deposition_date 2002-10-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Phillips Jr., G.N.' _audit_author.pdbx_ordinal 1 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Molecular engineering of myoglobin: influence of residue 68 on the rate and the enantioselectivity of oxidation reactions catalyzed by H64D/V68X myoglobin ; Biochemistry 42 10174 10181 2003 BICHAW US 0006-2960 0033 ? 12939145 10.1021/bi034605u 1 'ASYMMETRIC SULFOXIDATION AND AMINE BINDING BY H64D/V68A AND H64D/V68S MB: MECHANISTIC INSIGHT INTO THE CHIRAL DISCRIMINATION STEP' J.AM.CHEM.SOC. 124 8506 8507 2002 JACSAT US 0002-7863 0004 ? ? 10.1021/ja0256414 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, H.J.' 1 ? primary 'Matsui, T.' 2 ? primary 'Ozaki, S.' 3 ? primary 'Kato, S.' 4 ? primary 'Ueno, T.' 5 ? primary 'Phillips Jr., G.N.' 6 ? primary 'Fukuzumi, S.' 7 ? primary 'Watanabe, Y.' 8 ? 1 'Kato, S.' 9 ? 1 'Yang, H.J.' 10 ? 1 'Ueno, T.' 11 ? 1 'Ozaki, S.' 12 ? 1 'Phillips Jr., G.N.' 13 ? 1 'Fukuzumi, S.' 14 ? 1 'Watanabe, Y.' 15 ? # _cell.entry_id 1O16 _cell.length_a 91.200 _cell.length_b 91.200 _cell.length_c 45.850 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1O16 _symmetry.space_group_name_H-M 'P 6' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 168 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man MYOGLOBIN 17330.051 1 ? H64D,V68S,D122N ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 4 water nat water 18.015 219 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKDGVTSLTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_seq_one_letter_code_can ;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKDGVTSLTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 LEU n 1 4 SER n 1 5 GLU n 1 6 GLY n 1 7 GLU n 1 8 TRP n 1 9 GLN n 1 10 LEU n 1 11 VAL n 1 12 LEU n 1 13 HIS n 1 14 VAL n 1 15 TRP n 1 16 ALA n 1 17 LYS n 1 18 VAL n 1 19 GLU n 1 20 ALA n 1 21 ASP n 1 22 VAL n 1 23 ALA n 1 24 GLY n 1 25 HIS n 1 26 GLY n 1 27 GLN n 1 28 ASP n 1 29 ILE n 1 30 LEU n 1 31 ILE n 1 32 ARG n 1 33 LEU n 1 34 PHE n 1 35 LYS n 1 36 SER n 1 37 HIS n 1 38 PRO n 1 39 GLU n 1 40 THR n 1 41 LEU n 1 42 GLU n 1 43 LYS n 1 44 PHE n 1 45 ASP n 1 46 ARG n 1 47 PHE n 1 48 LYS n 1 49 HIS n 1 50 LEU n 1 51 LYS n 1 52 THR n 1 53 GLU n 1 54 ALA n 1 55 GLU n 1 56 MET n 1 57 LYS n 1 58 ALA n 1 59 SER n 1 60 GLU n 1 61 ASP n 1 62 LEU n 1 63 LYS n 1 64 LYS n 1 65 ASP n 1 66 GLY n 1 67 VAL n 1 68 THR n 1 69 SER n 1 70 LEU n 1 71 THR n 1 72 ALA n 1 73 LEU n 1 74 GLY n 1 75 ALA n 1 76 ILE n 1 77 LEU n 1 78 LYS n 1 79 LYS n 1 80 LYS n 1 81 GLY n 1 82 HIS n 1 83 HIS n 1 84 GLU n 1 85 ALA n 1 86 GLU n 1 87 LEU n 1 88 LYS n 1 89 PRO n 1 90 LEU n 1 91 ALA n 1 92 GLN n 1 93 SER n 1 94 HIS n 1 95 ALA n 1 96 THR n 1 97 LYS n 1 98 HIS n 1 99 LYS n 1 100 ILE n 1 101 PRO n 1 102 ILE n 1 103 LYS n 1 104 TYR n 1 105 LEU n 1 106 GLU n 1 107 PHE n 1 108 ILE n 1 109 SER n 1 110 GLU n 1 111 ALA n 1 112 ILE n 1 113 ILE n 1 114 HIS n 1 115 VAL n 1 116 LEU n 1 117 HIS n 1 118 SER n 1 119 ARG n 1 120 HIS n 1 121 PRO n 1 122 GLY n 1 123 ASN n 1 124 PHE n 1 125 GLY n 1 126 ALA n 1 127 ASP n 1 128 ALA n 1 129 GLN n 1 130 GLY n 1 131 ALA n 1 132 MET n 1 133 ASN n 1 134 LYS n 1 135 ALA n 1 136 LEU n 1 137 GLU n 1 138 LEU n 1 139 PHE n 1 140 ARG n 1 141 LYS n 1 142 ASP n 1 143 ILE n 1 144 ALA n 1 145 ALA n 1 146 LYS n 1 147 TYR n 1 148 LYS n 1 149 GLU n 1 150 LEU n 1 151 GLY n 1 152 TYR n 1 153 GLN n 1 154 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'sperm whale' _entity_src_gen.gene_src_genus Physeter _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Physeter catodon' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9755 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYG_PHYCA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P02185 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1O16 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 154 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02185 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 153 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 153 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1O16 MET A 1 ? UNP P02185 ? ? 'initiating methionine' 0 1 1 1O16 ASP A 65 ? UNP P02185 HIS 64 'engineered mutation' 64 2 1 1O16 SER A 69 ? UNP P02185 VAL 68 'engineered mutation' 68 3 1 1O16 ASN A 123 ? UNP P02185 ASP 122 'engineered mutation' 122 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1O16 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.18 _exptl_crystal.density_percent_sol 61.27 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 9.00 _exptl_crystal_grow.pdbx_details 'pH 9.00' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 298.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.type 'SIEMENS HI-STAR' _diffrn_detector.pdbx_collection_date 2000-11-07 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'LONG SUPPER MIRRORS' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1O16 _reflns.observed_criterion_sigma_I 0.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 19.00 _reflns.d_resolution_high 1.95 _reflns.number_obs 14391 _reflns.number_all ? _reflns.percent_possible_obs 89.5 _reflns.pdbx_Rmerge_I_obs 0.063 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 12.0000 _reflns.B_iso_Wilson_estimate 9.9 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.95 _reflns_shell.d_res_low 2.08 _reflns_shell.percent_possible_all 80.9 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1O16 _refine.ls_number_reflns_obs 14391 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 18.18 _refine.ls_d_res_high 1.95 _refine.ls_percent_reflns_obs 89.7 _refine.ls_R_factor_obs 0.16 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.16 _refine.ls_R_factor_R_free 0.19 _refine.ls_R_factor_R_free_error .005 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.2 _refine.ls_number_reflns_R_free 1465 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 19.5 _refine.aniso_B[1][1] 1.08 _refine.aniso_B[2][2] 1.08 _refine.aniso_B[3][3] -2.15 _refine.aniso_B[1][2] 1.62 _refine.aniso_B[1][3] .00 _refine.aniso_B[2][3] .00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol .639318 _refine.solvent_model_param_bsol 143.411 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'ISOMORPHIC WITH WILD-TYPE' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1O16 _refine_analyze.Luzzati_coordinate_error_obs ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free .20 _refine_analyze.Luzzati_sigma_a_free .18 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1222 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 49 _refine_hist.number_atoms_solvent 218 _refine_hist.number_atoms_total 1489 _refine_hist.d_res_high 1.95 _refine_hist.d_res_low 18.18 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d .010 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.5 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 17.0 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d .72 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.72 2.00 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.36 3.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 3.58 3.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 5.30 4.00 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.95 _refine_ls_shell.d_res_low 2.07 _refine_ls_shell.number_reflns_R_work 1273 _refine_ls_shell.R_factor_R_work 0.215 _refine_ls_shell.percent_reflns_obs 54.3 _refine_ls_shell.R_factor_R_free 0.239 _refine_ls_shell.R_factor_R_free_error .018 _refine_ls_shell.percent_reflns_R_free 12.1 _refine_ls_shell.number_reflns_R_free 175 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 HEME.PARAM HEME.TOP 'X-RAY DIFFRACTION' 3 ION.PARAM ION.TOP 'X-RAY DIFFRACTION' 4 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1O16 _struct.title 'RECOMBINANT SPERM WHALE MYOGLOBIN H64D/V68S/D122N MUTANT (MET)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1O16 _struct_keywords.pdbx_keywords 'OXYGEN STORAGE/TRANSPORT' _struct_keywords.text 'MYOGLOBIN, ENZYME, SULFOXIDATION, OXYGEN STORAGE-TRANSPORT COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 4 ? GLU A 19 ? SER A 3 GLU A 18 1 ? 16 HELX_P HELX_P2 2 ASP A 21 ? HIS A 37 ? ASP A 20 HIS A 36 1 ? 17 HELX_P HELX_P3 3 PRO A 38 ? PHE A 44 ? PRO A 37 PHE A 43 5 ? 7 HELX_P HELX_P4 4 THR A 52 ? SER A 59 ? THR A 51 SER A 58 1 ? 8 HELX_P HELX_P5 5 SER A 59 ? LYS A 78 ? SER A 58 LYS A 77 1 ? 20 HELX_P HELX_P6 6 HIS A 83 ? LYS A 97 ? HIS A 82 LYS A 96 1 ? 15 HELX_P HELX_P7 7 PRO A 101 ? HIS A 120 ? PRO A 100 HIS A 119 1 ? 20 HELX_P HELX_P8 8 PRO A 121 ? PHE A 124 ? PRO A 120 PHE A 123 5 ? 4 HELX_P HELX_P9 9 GLY A 125 ? LEU A 150 ? GLY A 124 LEU A 149 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 94 NE2 ? ? ? 1_555 C HEM . FE ? ? A HIS 93 A HEM 154 1_555 ? ? ? ? ? ? ? 2.111 ? ? metalc2 metalc ? ? C HEM . FE ? ? ? 1_555 D HOH . O ? ? A HEM 154 A HOH 155 1_555 ? ? ? ? ? ? ? 2.117 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 156 ? 10 'BINDING SITE FOR RESIDUE SO4 A 156' AC2 Software A HEM 154 ? 18 'BINDING SITE FOR RESIDUE HEM A 154' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 SER A 4 ? SER A 3 . ? 1_556 ? 2 AC1 10 GLU A 5 ? GLU A 4 . ? 1_556 ? 3 AC1 10 THR A 52 ? THR A 51 . ? 1_555 ? 4 AC1 10 GLU A 53 ? GLU A 52 . ? 1_555 ? 5 AC1 10 HOH D . ? HOH A 236 . ? 1_555 ? 6 AC1 10 HOH D . ? HOH A 273 . ? 1_555 ? 7 AC1 10 HOH D . ? HOH A 274 . ? 1_555 ? 8 AC1 10 HOH D . ? HOH A 374 . ? 1_556 ? 9 AC1 10 HOH D . ? HOH A 402 . ? 1_555 ? 10 AC1 10 HOH D . ? HOH A 412 . ? 1_555 ? 11 AC2 18 LYS A 43 ? LYS A 42 . ? 1_555 ? 12 AC2 18 PHE A 44 ? PHE A 43 . ? 1_555 ? 13 AC2 18 THR A 68 ? THR A 67 . ? 1_555 ? 14 AC2 18 SER A 69 ? SER A 68 . ? 1_555 ? 15 AC2 18 ALA A 72 ? ALA A 71 . ? 1_555 ? 16 AC2 18 LEU A 90 ? LEU A 89 . ? 1_555 ? 17 AC2 18 SER A 93 ? SER A 92 . ? 1_555 ? 18 AC2 18 HIS A 94 ? HIS A 93 . ? 1_555 ? 19 AC2 18 HIS A 98 ? HIS A 97 . ? 1_555 ? 20 AC2 18 ILE A 100 ? ILE A 99 . ? 1_555 ? 21 AC2 18 TYR A 104 ? TYR A 103 . ? 1_555 ? 22 AC2 18 HOH D . ? HOH A 155 . ? 1_555 ? 23 AC2 18 HOH D . ? HOH A 202 . ? 1_555 ? 24 AC2 18 HOH D . ? HOH A 203 . ? 1_555 ? 25 AC2 18 HOH D . ? HOH A 225 . ? 1_555 ? 26 AC2 18 HOH D . ? HOH A 263 . ? 1_555 ? 27 AC2 18 HOH D . ? HOH A 364 . ? 1_555 ? 28 AC2 18 HOH D . ? HOH A 366 . ? 1_555 ? # _database_PDB_matrix.entry_id 1O16 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] .000000 _database_PDB_matrix.origx[1][3] .000000 _database_PDB_matrix.origx[2][1] .000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] .000000 _database_PDB_matrix.origx[3][1] .000000 _database_PDB_matrix.origx[3][2] .000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] .00000 _database_PDB_matrix.origx_vector[2] .00000 _database_PDB_matrix.origx_vector[3] .00000 # _atom_sites.entry_id 1O16 _atom_sites.fract_transf_matrix[1][1] .010965 _atom_sites.fract_transf_matrix[1][2] .006331 _atom_sites.fract_transf_matrix[1][3] .000000 _atom_sites.fract_transf_matrix[2][1] .000000 _atom_sites.fract_transf_matrix[2][2] .012661 _atom_sites.fract_transf_matrix[2][3] .000000 _atom_sites.fract_transf_matrix[3][1] .000000 _atom_sites.fract_transf_matrix[3][2] .000000 _atom_sites.fract_transf_matrix[3][3] .021810 _atom_sites.fract_transf_vector[1] .00000 _atom_sites.fract_transf_vector[2] .00000 _atom_sites.fract_transf_vector[3] .00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 VAL 2 1 1 VAL VAL A . n A 1 3 LEU 3 2 2 LEU LEU A . n A 1 4 SER 4 3 3 SER SER A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 GLY 6 5 5 GLY GLY A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 TRP 8 7 7 TRP TRP A . n A 1 9 GLN 9 8 8 GLN GLN A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 VAL 11 10 10 VAL VAL A . n A 1 12 LEU 12 11 11 LEU LEU A . n A 1 13 HIS 13 12 12 HIS HIS A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 TRP 15 14 14 TRP TRP A . n A 1 16 ALA 16 15 15 ALA ALA A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 VAL 18 17 17 VAL VAL A . n A 1 19 GLU 19 18 18 GLU GLU A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 ASP 21 20 20 ASP ASP A . n A 1 22 VAL 22 21 21 VAL VAL A . n A 1 23 ALA 23 22 22 ALA ALA A . n A 1 24 GLY 24 23 23 GLY GLY A . n A 1 25 HIS 25 24 24 HIS HIS A . n A 1 26 GLY 26 25 25 GLY GLY A . n A 1 27 GLN 27 26 26 GLN GLN A . n A 1 28 ASP 28 27 27 ASP ASP A . n A 1 29 ILE 29 28 28 ILE ILE A . n A 1 30 LEU 30 29 29 LEU LEU A . n A 1 31 ILE 31 30 30 ILE ILE A . n A 1 32 ARG 32 31 31 ARG ARG A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 PHE 34 33 33 PHE PHE A . n A 1 35 LYS 35 34 34 LYS LYS A . n A 1 36 SER 36 35 35 SER SER A . n A 1 37 HIS 37 36 36 HIS HIS A . n A 1 38 PRO 38 37 37 PRO PRO A . n A 1 39 GLU 39 38 38 GLU GLU A . n A 1 40 THR 40 39 39 THR THR A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 GLU 42 41 41 GLU GLU A . n A 1 43 LYS 43 42 42 LYS LYS A . n A 1 44 PHE 44 43 43 PHE PHE A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ARG 46 45 45 ARG ARG A . n A 1 47 PHE 47 46 46 PHE PHE A . n A 1 48 LYS 48 47 47 LYS LYS A . n A 1 49 HIS 49 48 48 HIS HIS A . n A 1 50 LEU 50 49 49 LEU LEU A . n A 1 51 LYS 51 50 50 LYS LYS A . n A 1 52 THR 52 51 51 THR THR A . n A 1 53 GLU 53 52 52 GLU GLU A . n A 1 54 ALA 54 53 53 ALA ALA A . n A 1 55 GLU 55 54 54 GLU GLU A . n A 1 56 MET 56 55 55 MET MET A . n A 1 57 LYS 57 56 56 LYS LYS A . n A 1 58 ALA 58 57 57 ALA ALA A . n A 1 59 SER 59 58 58 SER SER A . n A 1 60 GLU 60 59 59 GLU GLU A . n A 1 61 ASP 61 60 60 ASP ASP A . n A 1 62 LEU 62 61 61 LEU LEU A . n A 1 63 LYS 63 62 62 LYS LYS A . n A 1 64 LYS 64 63 63 LYS LYS A . n A 1 65 ASP 65 64 64 ASP ASP A . n A 1 66 GLY 66 65 65 GLY GLY A . n A 1 67 VAL 67 66 66 VAL VAL A . n A 1 68 THR 68 67 67 THR THR A . n A 1 69 SER 69 68 68 SER SER A . n A 1 70 LEU 70 69 69 LEU LEU A . n A 1 71 THR 71 70 70 THR THR A . n A 1 72 ALA 72 71 71 ALA ALA A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 GLY 74 73 73 GLY GLY A . n A 1 75 ALA 75 74 74 ALA ALA A . n A 1 76 ILE 76 75 75 ILE ILE A . n A 1 77 LEU 77 76 76 LEU LEU A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 LYS 79 78 78 LYS LYS A . n A 1 80 LYS 80 79 79 LYS LYS A . n A 1 81 GLY 81 80 80 GLY GLY A . n A 1 82 HIS 82 81 81 HIS HIS A . n A 1 83 HIS 83 82 82 HIS HIS A . n A 1 84 GLU 84 83 83 GLU GLU A . n A 1 85 ALA 85 84 84 ALA ALA A . n A 1 86 GLU 86 85 85 GLU GLU A . n A 1 87 LEU 87 86 86 LEU LEU A . n A 1 88 LYS 88 87 87 LYS LYS A . n A 1 89 PRO 89 88 88 PRO PRO A . n A 1 90 LEU 90 89 89 LEU LEU A . n A 1 91 ALA 91 90 90 ALA ALA A . n A 1 92 GLN 92 91 91 GLN GLN A . n A 1 93 SER 93 92 92 SER SER A . n A 1 94 HIS 94 93 93 HIS HIS A . n A 1 95 ALA 95 94 94 ALA ALA A . n A 1 96 THR 96 95 95 THR THR A . n A 1 97 LYS 97 96 96 LYS LYS A . n A 1 98 HIS 98 97 97 HIS HIS A . n A 1 99 LYS 99 98 98 LYS LYS A . n A 1 100 ILE 100 99 99 ILE ILE A . n A 1 101 PRO 101 100 100 PRO PRO A . n A 1 102 ILE 102 101 101 ILE ILE A . n A 1 103 LYS 103 102 102 LYS LYS A . n A 1 104 TYR 104 103 103 TYR TYR A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 GLU 106 105 105 GLU GLU A . n A 1 107 PHE 107 106 106 PHE PHE A . n A 1 108 ILE 108 107 107 ILE ILE A . n A 1 109 SER 109 108 108 SER SER A . n A 1 110 GLU 110 109 109 GLU GLU A . n A 1 111 ALA 111 110 110 ALA ALA A . n A 1 112 ILE 112 111 111 ILE ILE A . n A 1 113 ILE 113 112 112 ILE ILE A . n A 1 114 HIS 114 113 113 HIS HIS A . n A 1 115 VAL 115 114 114 VAL VAL A . n A 1 116 LEU 116 115 115 LEU LEU A . n A 1 117 HIS 117 116 116 HIS HIS A . n A 1 118 SER 118 117 117 SER SER A . n A 1 119 ARG 119 118 118 ARG ARG A . n A 1 120 HIS 120 119 119 HIS HIS A . n A 1 121 PRO 121 120 120 PRO PRO A . n A 1 122 GLY 122 121 121 GLY GLY A . n A 1 123 ASN 123 122 122 ASN ASN A . n A 1 124 PHE 124 123 123 PHE PHE A . n A 1 125 GLY 125 124 124 GLY GLY A . n A 1 126 ALA 126 125 125 ALA ALA A . n A 1 127 ASP 127 126 126 ASP ASP A . n A 1 128 ALA 128 127 127 ALA ALA A . n A 1 129 GLN 129 128 128 GLN GLN A . n A 1 130 GLY 130 129 129 GLY GLY A . n A 1 131 ALA 131 130 130 ALA ALA A . n A 1 132 MET 132 131 131 MET MET A . n A 1 133 ASN 133 132 132 ASN ASN A . n A 1 134 LYS 134 133 133 LYS LYS A . n A 1 135 ALA 135 134 134 ALA ALA A . n A 1 136 LEU 136 135 135 LEU LEU A . n A 1 137 GLU 137 136 136 GLU GLU A . n A 1 138 LEU 138 137 137 LEU LEU A . n A 1 139 PHE 139 138 138 PHE PHE A . n A 1 140 ARG 140 139 139 ARG ARG A . n A 1 141 LYS 141 140 140 LYS LYS A . n A 1 142 ASP 142 141 141 ASP ASP A . n A 1 143 ILE 143 142 142 ILE ILE A . n A 1 144 ALA 144 143 143 ALA ALA A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 LYS 146 145 145 LYS LYS A . n A 1 147 TYR 147 146 146 TYR TYR A . n A 1 148 LYS 148 147 147 LYS LYS A . n A 1 149 GLU 149 148 148 GLU GLU A . n A 1 150 LEU 150 149 149 LEU LEU A . n A 1 151 GLY 151 150 150 GLY GLY A . n A 1 152 TYR 152 151 151 TYR TYR A . n A 1 153 GLN 153 152 152 GLN GLN A . n A 1 154 GLY 154 153 153 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 156 156 SO4 SO4 A . C 3 HEM 1 154 154 HEM HEM A . D 4 HOH 1 155 155 HOH MTO A . D 4 HOH 2 199 199 HOH TIP A . D 4 HOH 3 200 200 HOH TIP A . D 4 HOH 4 201 201 HOH TIP A . D 4 HOH 5 202 202 HOH TIP A . D 4 HOH 6 203 203 HOH TIP A . D 4 HOH 7 204 204 HOH TIP A . D 4 HOH 8 205 205 HOH TIP A . D 4 HOH 9 206 206 HOH TIP A . D 4 HOH 10 207 207 HOH TIP A . D 4 HOH 11 208 208 HOH TIP A . D 4 HOH 12 209 209 HOH TIP A . D 4 HOH 13 210 210 HOH TIP A . D 4 HOH 14 211 211 HOH TIP A . D 4 HOH 15 212 212 HOH TIP A . D 4 HOH 16 213 213 HOH TIP A . D 4 HOH 17 214 214 HOH TIP A . D 4 HOH 18 215 215 HOH TIP A . D 4 HOH 19 216 216 HOH TIP A . D 4 HOH 20 217 217 HOH TIP A . D 4 HOH 21 218 218 HOH TIP A . D 4 HOH 22 219 219 HOH TIP A . D 4 HOH 23 220 220 HOH TIP A . D 4 HOH 24 221 221 HOH TIP A . D 4 HOH 25 222 222 HOH TIP A . D 4 HOH 26 223 223 HOH TIP A . D 4 HOH 27 224 224 HOH TIP A . D 4 HOH 28 225 225 HOH TIP A . D 4 HOH 29 226 226 HOH TIP A . D 4 HOH 30 227 227 HOH TIP A . D 4 HOH 31 228 228 HOH TIP A . D 4 HOH 32 229 229 HOH TIP A . D 4 HOH 33 230 230 HOH TIP A . D 4 HOH 34 231 231 HOH TIP A . D 4 HOH 35 232 232 HOH TIP A . D 4 HOH 36 233 233 HOH TIP A . D 4 HOH 37 234 234 HOH TIP A . D 4 HOH 38 235 235 HOH TIP A . D 4 HOH 39 236 236 HOH TIP A . D 4 HOH 40 237 237 HOH TIP A . D 4 HOH 41 238 238 HOH TIP A . D 4 HOH 42 239 239 HOH TIP A . D 4 HOH 43 240 240 HOH TIP A . D 4 HOH 44 241 241 HOH TIP A . D 4 HOH 45 242 242 HOH TIP A . D 4 HOH 46 243 243 HOH TIP A . D 4 HOH 47 244 244 HOH TIP A . D 4 HOH 48 245 245 HOH TIP A . D 4 HOH 49 246 246 HOH TIP A . D 4 HOH 50 247 247 HOH TIP A . D 4 HOH 51 248 248 HOH TIP A . D 4 HOH 52 249 249 HOH TIP A . D 4 HOH 53 250 250 HOH TIP A . D 4 HOH 54 251 251 HOH TIP A . D 4 HOH 55 252 252 HOH TIP A . D 4 HOH 56 253 253 HOH TIP A . D 4 HOH 57 254 254 HOH TIP A . D 4 HOH 58 255 255 HOH TIP A . D 4 HOH 59 256 256 HOH TIP A . D 4 HOH 60 257 257 HOH TIP A . D 4 HOH 61 258 258 HOH TIP A . D 4 HOH 62 259 259 HOH TIP A . D 4 HOH 63 260 260 HOH TIP A . D 4 HOH 64 261 261 HOH TIP A . D 4 HOH 65 262 262 HOH TIP A . D 4 HOH 66 263 263 HOH TIP A . D 4 HOH 67 264 264 HOH TIP A . D 4 HOH 68 265 265 HOH TIP A . D 4 HOH 69 266 266 HOH TIP A . D 4 HOH 70 267 267 HOH TIP A . D 4 HOH 71 268 268 HOH TIP A . D 4 HOH 72 269 269 HOH TIP A . D 4 HOH 73 270 270 HOH TIP A . D 4 HOH 74 271 271 HOH TIP A . D 4 HOH 75 272 272 HOH TIP A . D 4 HOH 76 273 273 HOH TIP A . D 4 HOH 77 274 274 HOH TIP A . D 4 HOH 78 275 275 HOH TIP A . D 4 HOH 79 276 276 HOH TIP A . D 4 HOH 80 277 277 HOH TIP A . D 4 HOH 81 278 278 HOH TIP A . D 4 HOH 82 279 279 HOH TIP A . D 4 HOH 83 280 280 HOH TIP A . D 4 HOH 84 281 281 HOH TIP A . D 4 HOH 85 282 282 HOH TIP A . D 4 HOH 86 283 283 HOH TIP A . D 4 HOH 87 284 284 HOH TIP A . D 4 HOH 88 285 285 HOH TIP A . D 4 HOH 89 286 286 HOH TIP A . D 4 HOH 90 287 287 HOH TIP A . D 4 HOH 91 288 288 HOH TIP A . D 4 HOH 92 289 289 HOH TIP A . D 4 HOH 93 290 290 HOH TIP A . D 4 HOH 94 291 291 HOH TIP A . D 4 HOH 95 292 292 HOH TIP A . D 4 HOH 96 293 293 HOH TIP A . D 4 HOH 97 294 294 HOH TIP A . D 4 HOH 98 295 295 HOH TIP A . D 4 HOH 99 296 296 HOH TIP A . D 4 HOH 100 297 297 HOH TIP A . D 4 HOH 101 298 298 HOH TIP A . D 4 HOH 102 299 299 HOH TIP A . D 4 HOH 103 300 300 HOH TIP A . D 4 HOH 104 301 301 HOH TIP A . D 4 HOH 105 302 302 HOH TIP A . D 4 HOH 106 303 303 HOH TIP A . D 4 HOH 107 304 304 HOH TIP A . D 4 HOH 108 305 305 HOH TIP A . D 4 HOH 109 306 306 HOH TIP A . D 4 HOH 110 307 307 HOH TIP A . D 4 HOH 111 308 308 HOH TIP A . D 4 HOH 112 309 309 HOH TIP A . D 4 HOH 113 310 310 HOH TIP A . D 4 HOH 114 311 311 HOH TIP A . D 4 HOH 115 312 312 HOH TIP A . D 4 HOH 116 313 313 HOH TIP A . D 4 HOH 117 314 314 HOH TIP A . D 4 HOH 118 315 315 HOH TIP A . D 4 HOH 119 316 316 HOH TIP A . D 4 HOH 120 317 317 HOH TIP A . D 4 HOH 121 318 318 HOH TIP A . D 4 HOH 122 319 319 HOH TIP A . D 4 HOH 123 320 320 HOH TIP A . D 4 HOH 124 321 321 HOH TIP A . D 4 HOH 125 322 322 HOH TIP A . D 4 HOH 126 323 323 HOH TIP A . D 4 HOH 127 324 324 HOH TIP A . D 4 HOH 128 325 325 HOH TIP A . D 4 HOH 129 326 326 HOH TIP A . D 4 HOH 130 327 327 HOH TIP A . D 4 HOH 131 328 328 HOH TIP A . D 4 HOH 132 329 329 HOH TIP A . D 4 HOH 133 330 330 HOH TIP A . D 4 HOH 134 331 331 HOH TIP A . D 4 HOH 135 332 332 HOH TIP A . D 4 HOH 136 333 333 HOH TIP A . D 4 HOH 137 334 334 HOH TIP A . D 4 HOH 138 335 335 HOH TIP A . D 4 HOH 139 336 336 HOH TIP A . D 4 HOH 140 337 337 HOH TIP A . D 4 HOH 141 338 338 HOH TIP A . D 4 HOH 142 339 339 HOH TIP A . D 4 HOH 143 340 340 HOH TIP A . D 4 HOH 144 341 341 HOH TIP A . D 4 HOH 145 342 342 HOH TIP A . D 4 HOH 146 343 343 HOH TIP A . D 4 HOH 147 344 344 HOH TIP A . D 4 HOH 148 345 345 HOH TIP A . D 4 HOH 149 346 346 HOH TIP A . D 4 HOH 150 347 347 HOH TIP A . D 4 HOH 151 348 348 HOH TIP A . D 4 HOH 152 349 349 HOH TIP A . D 4 HOH 153 350 350 HOH TIP A . D 4 HOH 154 351 351 HOH TIP A . D 4 HOH 155 352 352 HOH TIP A . D 4 HOH 156 353 353 HOH TIP A . D 4 HOH 157 354 354 HOH TIP A . D 4 HOH 158 355 355 HOH TIP A . D 4 HOH 159 356 356 HOH TIP A . D 4 HOH 160 357 357 HOH TIP A . D 4 HOH 161 358 358 HOH TIP A . D 4 HOH 162 359 359 HOH TIP A . D 4 HOH 163 360 360 HOH TIP A . D 4 HOH 164 361 361 HOH TIP A . D 4 HOH 165 362 362 HOH TIP A . D 4 HOH 166 363 363 HOH TIP A . D 4 HOH 167 364 364 HOH TIP A . D 4 HOH 168 365 365 HOH TIP A . D 4 HOH 169 366 366 HOH TIP A . D 4 HOH 170 367 367 HOH TIP A . D 4 HOH 171 368 368 HOH TIP A . D 4 HOH 172 369 369 HOH TIP A . D 4 HOH 173 371 371 HOH TIP A . D 4 HOH 174 372 372 HOH TIP A . D 4 HOH 175 373 373 HOH TIP A . D 4 HOH 176 374 374 HOH TIP A . D 4 HOH 177 375 375 HOH TIP A . D 4 HOH 178 376 376 HOH TIP A . D 4 HOH 179 377 377 HOH TIP A . D 4 HOH 180 378 378 HOH TIP A . D 4 HOH 181 379 379 HOH TIP A . D 4 HOH 182 380 380 HOH TIP A . D 4 HOH 183 381 381 HOH TIP A . D 4 HOH 184 382 382 HOH TIP A . D 4 HOH 185 383 383 HOH TIP A . D 4 HOH 186 384 384 HOH TIP A . D 4 HOH 187 385 385 HOH TIP A . D 4 HOH 188 386 386 HOH TIP A . D 4 HOH 189 387 387 HOH TIP A . D 4 HOH 190 388 388 HOH TIP A . D 4 HOH 191 389 389 HOH TIP A . D 4 HOH 192 390 390 HOH TIP A . D 4 HOH 193 391 391 HOH TIP A . D 4 HOH 194 392 392 HOH TIP A . D 4 HOH 195 393 393 HOH TIP A . D 4 HOH 196 395 395 HOH TIP A . D 4 HOH 197 397 397 HOH TIP A . D 4 HOH 198 400 400 HOH TIP A . D 4 HOH 199 401 401 HOH TIP A . D 4 HOH 200 402 402 HOH TIP A . D 4 HOH 201 404 404 HOH TIP A . D 4 HOH 202 405 405 HOH TIP A . D 4 HOH 203 407 407 HOH TIP A . D 4 HOH 204 408 408 HOH TIP A . D 4 HOH 205 409 409 HOH TIP A . D 4 HOH 206 410 410 HOH TIP A . D 4 HOH 207 411 411 HOH TIP A . D 4 HOH 208 412 412 HOH TIP A . D 4 HOH 209 413 413 HOH TIP A . D 4 HOH 210 414 414 HOH TIP A . D 4 HOH 211 416 416 HOH TIP A . D 4 HOH 212 417 417 HOH TIP A . D 4 HOH 213 420 420 HOH TIP A . D 4 HOH 214 423 423 HOH TIP A . D 4 HOH 215 424 424 HOH TIP A . D 4 HOH 216 425 425 HOH TIP A . D 4 HOH 217 428 428 HOH TIP A . D 4 HOH 218 435 435 HOH TIP A . D 4 HOH 219 438 438 HOH TIP A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 NA ? C HEM . ? A HEM 154 ? 1_555 88.5 ? 2 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 NB ? C HEM . ? A HEM 154 ? 1_555 88.8 ? 3 NA ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 NB ? C HEM . ? A HEM 154 ? 1_555 90.1 ? 4 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 NC ? C HEM . ? A HEM 154 ? 1_555 96.4 ? 5 NA ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 NC ? C HEM . ? A HEM 154 ? 1_555 175.1 ? 6 NB ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 NC ? C HEM . ? A HEM 154 ? 1_555 90.0 ? 7 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 ND ? C HEM . ? A HEM 154 ? 1_555 93.0 ? 8 NA ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 ND ? C HEM . ? A HEM 154 ? 1_555 89.8 ? 9 NB ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 ND ? C HEM . ? A HEM 154 ? 1_555 178.3 ? 10 NC ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 ND ? C HEM . ? A HEM 154 ? 1_555 90.0 ? 11 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 O ? D HOH . ? A HOH 155 ? 1_555 175.0 ? 12 NA ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 O ? D HOH . ? A HOH 155 ? 1_555 87.2 ? 13 NB ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 O ? D HOH . ? A HOH 155 ? 1_555 88.6 ? 14 NC ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 O ? D HOH . ? A HOH 155 ? 1_555 87.9 ? 15 ND ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 O ? D HOH . ? A HOH 155 ? 1_555 89.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-11-04 2 'Structure model' 1 1 2008-04-26 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_ref_seq_dif 3 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SAINT 'data scaling' . ? 1 XDS 'data reduction' . ? 2 CNS refinement . ? 3 SAINT 'data reduction' . ? 4 XDS 'data scaling' . ? 5 CNS phasing . ? 6 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 355 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 355 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_655 _pdbx_validate_symm_contact.dist 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 20 ? ? -153.30 73.75 2 1 TYR A 151 ? ? -102.70 -67.37 3 1 GLN A 152 ? ? 38.32 94.26 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'PROTOPORPHYRIN IX CONTAINING FE' HEM 4 water HOH #