data_1OAJ # _entry.id 1OAJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.305 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1OAJ PDBE EBI-11961 WWPDB D_1290011961 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1BZO unspecified 'THREE-DIMENSIONAL STRUCTURE OF PROKARYOTIC CU, ZN SUPEROXIDE DISMUTASE FROM P.LEIOGNATHI, SOLVED BY X-RAY CRYSTALLOGRAPHY.' PDB 1IB5 unspecified 'X-RAY 3D STRUCTURE OF P.LEIOGNATHI CU,ZN SOD MUTANT W83Y' PDB 1IBB unspecified 'X-RAY 3D STRUCTURE OF P.LEIOGNATHI CU,ZN SOD MUTANT W83F' PDB 1IBD unspecified 'X-RAY 3D STRUCTURE OF P.LEIOGNATHI CU,ZN SOD MUTANT V29A' PDB 1IBF unspecified 'X-RAY 3D STRUCTURE OF P.LEIOGNATHI CU,ZN SOD MUTANT V29G' PDB 1IBH unspecified 'X-RAY 3D STRUCTURE OF P.LEIOGNATHI CU,ZN SOD MUTANT M41I' PDB 1YAI unspecified 'X-RAY STRUCTURE OF A BACTERIAL COPPER,ZINC SUPEROXIDE DISMUTASE' PDB 1OAL unspecified 'ACTIVE SITE COPPER AND ZINC IONS MODULATE THE QUATERNARY STRUCTURE OF PROKARYOTIC CU, ZN SUPEROXIDE DISMUTASE' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1OAJ _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2003-01-14 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cioni, P.' 1 ? 'Pesce, A.' 2 ? 'Rocca, B.M.D.' 3 ? 'Castelli, S.' 4 ? 'Falconi, M.' 5 ? 'Parrilli, L.' 6 ? 'Bolognesi, M.' 7 ? 'Strambini, G.' 8 ? 'Desideri, A.' 9 ? # _citation.id primary _citation.title 'Active-Site Copper and Zinc Ions Modulate the Quaternary Structure of Prokaryotic Cu,Zn Superoxide Dismutase' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 326 _citation.page_first 1351 _citation.page_last ? _citation.year 2003 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12595249 _citation.pdbx_database_id_DOI '10.1016/S0022-2836(03)00047-0' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cioni, P.' 1 ? primary 'Pesce, A.' 2 ? primary 'Morozzo Della Rocca, B.' 3 ? primary 'Castelli, S.' 4 ? primary 'Falconi, M.' 5 ? primary 'Parrilli, L.' 6 ? primary 'Bolognesi, M.' 7 ? primary 'Strambini, G.' 8 ? primary 'Desideri, A.' 9 ? # _cell.entry_id 1OAJ _cell.length_a 85.900 _cell.length_b 85.900 _cell.length_c 98.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1OAJ _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SUPEROXIDE DISMUTASE' 15799.761 1 1.15.1.1 YES ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 4 water nat water 18.015 91 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QDLTVKMTDLQTGKPVGTIELSQNDYGVVFIPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHG FPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ ; _entity_poly.pdbx_seq_one_letter_code_can ;QDLTVKMTDLQTGKPVGTIELSQNDYGVVFIPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHG FPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 ASP n 1 3 LEU n 1 4 THR n 1 5 VAL n 1 6 LYS n 1 7 MET n 1 8 THR n 1 9 ASP n 1 10 LEU n 1 11 GLN n 1 12 THR n 1 13 GLY n 1 14 LYS n 1 15 PRO n 1 16 VAL n 1 17 GLY n 1 18 THR n 1 19 ILE n 1 20 GLU n 1 21 LEU n 1 22 SER n 1 23 GLN n 1 24 ASN n 1 25 ASP n 1 26 TYR n 1 27 GLY n 1 28 VAL n 1 29 VAL n 1 30 PHE n 1 31 ILE n 1 32 PRO n 1 33 GLU n 1 34 LEU n 1 35 ALA n 1 36 ASP n 1 37 LEU n 1 38 THR n 1 39 PRO n 1 40 GLY n 1 41 MET n 1 42 HIS n 1 43 GLY n 1 44 PHE n 1 45 HIS n 1 46 ILE n 1 47 HIS n 1 48 GLN n 1 49 ASN n 1 50 GLY n 1 51 SER n 1 52 CYS n 1 53 ALA n 1 54 SER n 1 55 SER n 1 56 GLU n 1 57 LYS n 1 58 ASP n 1 59 GLY n 1 60 LYS n 1 61 VAL n 1 62 VAL n 1 63 LEU n 1 64 GLY n 1 65 GLY n 1 66 ALA n 1 67 ALA n 1 68 GLY n 1 69 GLY n 1 70 HIS n 1 71 TYR n 1 72 ASP n 1 73 PRO n 1 74 GLU n 1 75 HIS n 1 76 THR n 1 77 ASN n 1 78 LYS n 1 79 HIS n 1 80 GLY n 1 81 PHE n 1 82 PRO n 1 83 TRP n 1 84 THR n 1 85 ASP n 1 86 ASP n 1 87 ASN n 1 88 HIS n 1 89 LYS n 1 90 GLY n 1 91 ASP n 1 92 LEU n 1 93 PRO n 1 94 ALA n 1 95 LEU n 1 96 PHE n 1 97 VAL n 1 98 SER n 1 99 ALA n 1 100 ASN n 1 101 GLY n 1 102 LEU n 1 103 ALA n 1 104 THR n 1 105 ASN n 1 106 PRO n 1 107 VAL n 1 108 LEU n 1 109 ALA n 1 110 PRO n 1 111 ARG n 1 112 LEU n 1 113 THR n 1 114 LEU n 1 115 LYS n 1 116 GLU n 1 117 LEU n 1 118 LYS n 1 119 GLY n 1 120 HIS n 1 121 ALA n 1 122 ILE n 1 123 MET n 1 124 ILE n 1 125 HIS n 1 126 ALA n 1 127 GLY n 1 128 GLY n 1 129 ASP n 1 130 ASN n 1 131 HIS n 1 132 SER n 1 133 ASP n 1 134 MET n 1 135 PRO n 1 136 LYS n 1 137 ALA n 1 138 LEU n 1 139 GLY n 1 140 GLY n 1 141 GLY n 1 142 GLY n 1 143 ALA n 1 144 ARG n 1 145 VAL n 1 146 ALA n 1 147 CYS n 1 148 GLY n 1 149 VAL n 1 150 ILE n 1 151 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'PHOTOBACTERIUM LEIOGNATHI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 658 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 71/18 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PEMBL18 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SODC_PHOLE _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P00446 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1OAJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 151 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00446 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 173 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 151 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1OAJ ASP A 25 ? UNP P00446 LYS 47 'engineered mutation' 25 1 1 1OAJ ILE A 31 ? UNP P00446 THR 53 conflict 31 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1OAJ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.40 _exptl_crystal.density_percent_sol 64 _exptl_crystal.description ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 301 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.00 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'PEG 8,000 25%, NACL 100 MM, SODIUM ACETATE 50 MM, PH 4, TEMPERATURE 28C' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2001-04-28 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-3' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-3 _diffrn_source.pdbx_wavelength 1.0 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1OAJ _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.000 _reflns.d_resolution_high 1.730 _reflns.number_obs 14997 _reflns.number_all ? _reflns.percent_possible_obs 97.5 _reflns.pdbx_Rmerge_I_obs 0.03700 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 20.0000 _reflns.B_iso_Wilson_estimate 18 _reflns.pdbx_redundancy 2.500 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.73 _reflns_shell.d_res_low 1.76 _reflns_shell.percent_possible_all 75.8 _reflns_shell.Rmerge_I_obs 0.17800 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.000 _reflns_shell.pdbx_redundancy ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1OAJ _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 14997 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.0 _refine.ls_d_res_high 1.73 _refine.ls_percent_reflns_obs 97.5 _refine.ls_R_factor_obs 0.191 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.183 _refine.ls_R_factor_R_free 0.231 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.0 _refine.ls_number_reflns_R_free 1499 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 19 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.13 _refine.pdbx_overall_ESU_R_Free 0.131 _refine.overall_SU_ML 0.085 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1108 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 91 _refine_hist.number_atoms_total 1201 _refine_hist.d_res_high 1.73 _refine_hist.d_res_low 30.0 # _struct.entry_id 1OAJ _struct.title 'Active site copper and zinc ions modulate the quaternary structure of prokaryotic Cu,Zn superoxide dismutase' _struct.pdbx_descriptor 'SUPEROXIDE DISMUTASE (E.C.1.15.1.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1OAJ _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'OXIDOREDUCTASE, PROKARIOTIC CU, ZN SUPEROXIDE DISMUTASE, SUBUNIT INTERACTION RECOGNITION, PROTEIN ELECTROSTATIC' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 64 ? GLY A 68 ? GLY A 64 GLY A 68 5 ? 5 HELX_P HELX_P2 2 THR A 113 ? LYS A 118 ? THR A 113 LYS A 118 1 ? 6 HELX_P HELX_P3 3 LYS A 136 ? GLY A 141 ? LYS A 136 GLY A 141 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 52 SG ? ? ? 1_555 A CYS 147 SG ? ? A CYS 52 A CYS 147 1_555 ? ? ? ? ? ? ? 2.184 ? metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 88 ND1 ? ? A ZN 1152 A HIS 88 1_555 ? ? ? ? ? ? ? 1.993 ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A ASP 91 OD1 ? ? A ZN 1152 A ASP 91 1_555 ? ? ? ? ? ? ? 1.924 ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 70 ND1 ? ? A ZN 1152 A HIS 70 1_555 ? ? ? ? ? ? ? 1.957 ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 79 ND1 ? ? A ZN 1152 A HIS 79 1_555 ? ? ? ? ? ? ? 2.084 ? metalc5 metalc ? ? C CU . CU ? ? ? 1_555 A HIS 45 ND1 ? ? A CU 1153 A HIS 45 1_555 ? ? ? ? ? ? ? 2.046 ? metalc6 metalc ? ? C CU . CU ? ? ? 1_555 A HIS 125 NE2 ? ? A CU 1153 A HIS 125 1_555 ? ? ? ? ? ? ? 2.070 ? metalc7 metalc ? ? C CU . CU ? ? ? 1_555 A HIS 47 NE2 ? ? A CU 1153 A HIS 47 1_555 ? ? ? ? ? ? ? 1.933 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 134 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 134 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 135 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 135 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.45 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 7 ? AB ? 2 ? AC ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AA 5 6 ? anti-parallel AA 6 7 ? anti-parallel AB 1 2 ? anti-parallel AC 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 PHE A 44 ? HIS A 47 ? PHE A 44 HIS A 47 AA 2 ALA A 121 ? HIS A 125 ? ALA A 121 HIS A 125 AA 3 ARG A 144 ? VAL A 149 ? ARG A 144 VAL A 149 AA 4 ASP A 2 ? ASP A 9 ? ASP A 2 ASP A 9 AA 5 PRO A 15 ? ASN A 24 ? PRO A 15 ASN A 24 AA 6 GLY A 27 ? LEU A 34 ? GLY A 27 LEU A 34 AA 7 VAL A 107 ? ALA A 109 ? VAL A 107 ALA A 109 AB 1 GLY A 40 ? HIS A 42 ? GLY A 40 HIS A 42 AB 2 LEU A 95 ? VAL A 97 ? LEU A 95 VAL A 97 AC 1 SER A 55 ? LYS A 57 ? SER A 55 LYS A 57 AC 2 LYS A 60 ? VAL A 62 ? LYS A 60 VAL A 62 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N HIS A 47 ? N HIS A 47 O ALA A 121 ? O ALA A 121 AA 2 3 O ILE A 124 ? O ILE A 124 N VAL A 145 ? N VAL A 145 AA 3 4 N CYS A 147 ? N CYS A 147 O THR A 8 ? O THR A 8 AA 4 5 O MET A 7 ? O MET A 7 N VAL A 16 ? N VAL A 16 AA 5 6 N ASN A 24 ? N ASN A 24 O GLY A 27 ? O GLY A 27 AA 6 7 N PHE A 30 ? N PHE A 30 O VAL A 107 ? O VAL A 107 AB 1 2 N HIS A 42 ? N HIS A 42 O LEU A 95 ? O LEU A 95 AC 1 2 N LYS A 57 ? N LYS A 57 O LYS A 60 ? O LYS A 60 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A1152' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CU A1153' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 70 ? HIS A 70 . ? 1_555 ? 2 AC1 4 HIS A 79 ? HIS A 79 . ? 1_555 ? 3 AC1 4 HIS A 88 ? HIS A 88 . ? 1_555 ? 4 AC1 4 ASP A 91 ? ASP A 91 . ? 1_555 ? 5 AC2 4 HIS A 45 ? HIS A 45 . ? 1_555 ? 6 AC2 4 HIS A 47 ? HIS A 47 . ? 1_555 ? 7 AC2 4 HIS A 70 ? HIS A 70 . ? 1_555 ? 8 AC2 4 HIS A 125 ? HIS A 125 . ? 1_555 ? # _database_PDB_matrix.entry_id 1OAJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1OAJ _atom_sites.fract_transf_matrix[1][1] 0.011641 _atom_sites.fract_transf_matrix[1][2] 0.006721 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013442 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010204 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 1 GLN GLN A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 TRP 83 83 83 TRP TRP A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 MET 123 123 123 MET MET A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 CYS 147 147 147 CYS CYS A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 GLN 151 151 151 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 1152 1152 ZN ZN A . C 3 CU 1 1153 1153 CU CU A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . D 4 HOH 66 2066 2066 HOH HOH A . D 4 HOH 67 2067 2067 HOH HOH A . D 4 HOH 68 2068 2068 HOH HOH A . D 4 HOH 69 2069 2069 HOH HOH A . D 4 HOH 70 2070 2070 HOH HOH A . D 4 HOH 71 2071 2071 HOH HOH A . D 4 HOH 72 2072 2072 HOH HOH A . D 4 HOH 73 2073 2073 HOH HOH A . D 4 HOH 74 2074 2074 HOH HOH A . D 4 HOH 75 2075 2075 HOH HOH A . D 4 HOH 76 2076 2076 HOH HOH A . D 4 HOH 77 2077 2077 HOH HOH A . D 4 HOH 78 2078 2078 HOH HOH A . D 4 HOH 79 2079 2079 HOH HOH A . D 4 HOH 80 2080 2080 HOH HOH A . D 4 HOH 81 2081 2081 HOH HOH A . D 4 HOH 82 2082 2082 HOH HOH A . D 4 HOH 83 2083 2083 HOH HOH A . D 4 HOH 84 2084 2084 HOH HOH A . D 4 HOH 85 2085 2085 HOH HOH A . D 4 HOH 86 2086 2086 HOH HOH A . D 4 HOH 87 2087 2087 HOH HOH A . D 4 HOH 88 2088 2088 HOH HOH A . D 4 HOH 89 2089 2089 HOH HOH A . D 4 HOH 90 2090 2090 HOH HOH A . D 4 HOH 91 2091 2091 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 11_565 x-y+2/3,-y+4/3,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 99.1887762468 0.0000000000 0.0000000000 -1.0000000000 32.6666666667 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2021 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 88 ? A HIS 88 ? 1_555 ZN ? B ZN . ? A ZN 1152 ? 1_555 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 117.9 ? 2 ND1 ? A HIS 88 ? A HIS 88 ? 1_555 ZN ? B ZN . ? A ZN 1152 ? 1_555 ND1 ? A HIS 70 ? A HIS 70 ? 1_555 102.6 ? 3 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 ZN ? B ZN . ? A ZN 1152 ? 1_555 ND1 ? A HIS 70 ? A HIS 70 ? 1_555 107.8 ? 4 ND1 ? A HIS 88 ? A HIS 88 ? 1_555 ZN ? B ZN . ? A ZN 1152 ? 1_555 ND1 ? A HIS 79 ? A HIS 79 ? 1_555 124.5 ? 5 OD1 ? A ASP 91 ? A ASP 91 ? 1_555 ZN ? B ZN . ? A ZN 1152 ? 1_555 ND1 ? A HIS 79 ? A HIS 79 ? 1_555 97.1 ? 6 ND1 ? A HIS 70 ? A HIS 70 ? 1_555 ZN ? B ZN . ? A ZN 1152 ? 1_555 ND1 ? A HIS 79 ? A HIS 79 ? 1_555 106.0 ? 7 ND1 ? A HIS 45 ? A HIS 45 ? 1_555 CU ? C CU . ? A CU 1153 ? 1_555 NE2 ? A HIS 125 ? A HIS 125 ? 1_555 102.5 ? 8 ND1 ? A HIS 45 ? A HIS 45 ? 1_555 CU ? C CU . ? A CU 1153 ? 1_555 NE2 ? A HIS 47 ? A HIS 47 ? 1_555 142.5 ? 9 NE2 ? A HIS 125 ? A HIS 125 ? 1_555 CU ? C CU . ? A CU 1153 ? 1_555 NE2 ? A HIS 47 ? A HIS 47 ? 1_555 113.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-02-27 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2019-03-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' Advisory 4 4 'Structure model' 'Atomic model' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Experimental preparation' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' exptl_crystal_grow 3 4 'Structure model' pdbx_database_proc 4 4 'Structure model' pdbx_database_status 5 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 6 4 'Structure model' pdbx_unobs_or_zero_occ_residues 7 4 'Structure model' struct_biol # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.occupancy' 2 4 'Structure model' '_exptl_crystal_grow.method' 3 4 'Structure model' '_exptl_crystal_grow.temp' 4 4 'Structure model' '_pdbx_database_status.recvd_author_approval' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language REFMAC refinement . ? 1 ? ? ? ? DENZO 'data reduction' . ? 2 ? ? ? ? SCALEPACK 'data scaling' . ? 3 ? ? ? ? CCP4 phasing . ? 4 ? ? ? ? # _pdbx_entry_details.entry_id 1OAJ _pdbx_entry_details.compound_details 'MUTATED RESIDUES: LYS 25 ASP' _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE PROTEIN USED IS A TRUNCATED FORM, WITHOUT THE FIRST 22 RESIDUES SIGNAL SEQUENCE ; # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 2003 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 2004 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 0.78 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 2077 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 2077 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_555 _pdbx_validate_symm_contact.dist 0.42 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 72 ? ? -155.19 63.11 2 1 ASP A 86 ? ? -91.20 55.27 3 1 ALA A 143 ? ? -48.63 151.44 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'COPPER (II) ION' CU 4 water HOH #