data_1ODP # _entry.id 1ODP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ODP pdb_00001odp 10.2210/pdb1odp/pdb WWPDB D_1000175436 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-06-10 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ODP _pdbx_database_status.recvd_initial_deposition_date 1996-03-02 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1ODQ . ensemble PDB 1ODR . ensemble # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, G.' 1 'Treleaven, W.D.' 2 'Cushley, R.J.' 3 # _citation.id primary _citation.title ;Conformation of human serum apolipoprotein A-I(166-185) in the presence of sodium dodecyl sulfate or dodecylphosphocholine by 1H-NMR and CD. Evidence for specific peptide-SDS interactions. ; _citation.journal_abbrev Biochim.Biophys.Acta _citation.journal_volume 1301 _citation.page_first 174 _citation.page_last 184 _citation.year 1996 _citation.journal_id_ASTM BBACAQ _citation.country NE _citation.journal_id_ISSN 0006-3002 _citation.journal_id_CSD 0113 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 8664326 _citation.pdbx_database_id_DOI '10.1016/0005-2760(96)00037-9' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, G.' 1 ? primary 'Treleaven, W.D.' 2 ? primary 'Cushley, R.J.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'APOA-I PEPTIDE' _entity.formula_weight 2336.605 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RESIDUES 166 - 185' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'APOA-I (166 - 185), APOLIPOPROTEIN A-I (166 - 185)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code YSDELRQRLAARLEALKENG _entity_poly.pdbx_seq_one_letter_code_can YSDELRQRLAARLEALKENG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 SER n 1 3 ASP n 1 4 GLU n 1 5 LEU n 1 6 ARG n 1 7 GLN n 1 8 ARG n 1 9 LEU n 1 10 ALA n 1 11 ALA n 1 12 ARG n 1 13 LEU n 1 14 GLU n 1 15 ALA n 1 16 LEU n 1 17 LYS n 1 18 GLU n 1 19 ASN n 1 20 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 1 1 TYR TYR A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 GLY 20 20 20 GLY GLY A . n # _cell.entry_id 1ODP _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ODP _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1ODP _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1ODP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1ODP _struct.title 'PEPTIDE OF HUMAN APOA-I RESIDUES 166-185. NMR, 5 STRUCTURES AT PH 6.6, 37 DEGREES CELSIUS AND PEPTIDE:SDS MOLE RATIO OF 1:40' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ODP _struct_keywords.pdbx_keywords 'LIPID TRANSPORT' _struct_keywords.text 'APOLIPOPROTEIN A-I, COFACTOR FOR LCAT ACTIVATION, LIPID TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code APOA1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02647 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTST FSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHE LQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ GLLPVLESFKVSFLSALEEYTKKLNTQ ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ODP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 20 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02647 _struct_ref_seq.db_align_beg 190 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 209 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 20 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 3 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 17 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 3 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 17 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.362 1.252 0.110 0.011 N 2 1 CD A GLU 14 ? ? OE2 A GLU 14 ? ? 1.362 1.252 0.110 0.011 N 3 1 CD A GLU 18 ? ? OE1 A GLU 18 ? ? 1.362 1.252 0.110 0.011 N 4 2 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.363 1.252 0.111 0.011 N 5 2 CD A GLU 14 ? ? OE2 A GLU 14 ? ? 1.361 1.252 0.109 0.011 N 6 2 CD A GLU 18 ? ? OE2 A GLU 18 ? ? 1.361 1.252 0.109 0.011 N 7 3 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.363 1.252 0.111 0.011 N 8 3 CD A GLU 14 ? ? OE2 A GLU 14 ? ? 1.361 1.252 0.109 0.011 N 9 3 CD A GLU 18 ? ? OE2 A GLU 18 ? ? 1.362 1.252 0.110 0.011 N 10 4 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.361 1.252 0.109 0.011 N 11 4 CD A GLU 14 ? ? OE2 A GLU 14 ? ? 1.363 1.252 0.111 0.011 N 12 4 CD A GLU 18 ? ? OE1 A GLU 18 ? ? 1.362 1.252 0.110 0.011 N 13 5 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.362 1.252 0.110 0.011 N 14 5 CD A GLU 14 ? ? OE2 A GLU 14 ? ? 1.362 1.252 0.110 0.011 N 15 5 CD A GLU 18 ? ? OE1 A GLU 18 ? ? 1.363 1.252 0.111 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 3 ? ? CG A ASP 3 ? ? OD2 A ASP 3 ? ? 112.87 118.30 -5.43 0.90 N 2 1 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 124.34 120.30 4.04 0.50 N 3 1 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 124.39 120.30 4.09 0.50 N 4 1 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.33 120.30 4.03 0.50 N 5 2 CB A ASP 3 ? ? CG A ASP 3 ? ? OD1 A ASP 3 ? ? 112.88 118.30 -5.42 0.90 N 6 2 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 124.39 120.30 4.09 0.50 N 7 2 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 124.41 120.30 4.11 0.50 N 8 2 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.36 120.30 4.06 0.50 N 9 3 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 124.34 120.30 4.04 0.50 N 10 3 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 124.41 120.30 4.11 0.50 N 11 3 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.27 120.30 3.97 0.50 N 12 4 CB A ASP 3 ? ? CG A ASP 3 ? ? OD2 A ASP 3 ? ? 112.83 118.30 -5.47 0.90 N 13 4 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 124.31 120.30 4.01 0.50 N 14 4 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 124.33 120.30 4.03 0.50 N 15 4 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.37 120.30 4.07 0.50 N 16 5 CB A ASP 3 ? ? CG A ASP 3 ? ? OD2 A ASP 3 ? ? 112.86 118.30 -5.44 0.90 N 17 5 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 124.31 120.30 4.01 0.50 N 18 5 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 124.41 120.30 4.11 0.50 N 19 5 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.34 120.30 4.04 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? 70.54 123.92 2 1 GLU A 18 ? ? -43.50 -81.83 3 1 ASN A 19 ? ? -57.20 -75.15 4 2 SER A 2 ? ? 75.25 34.67 5 2 ASP A 3 ? ? 51.84 -90.46 6 2 GLU A 18 ? ? -90.54 55.73 7 2 ASN A 19 ? ? -167.27 -62.52 8 3 ASP A 3 ? ? -27.59 -61.09 9 3 GLU A 18 ? ? -46.59 -82.52 10 4 SER A 2 ? ? -166.64 50.86 11 4 ASP A 3 ? ? 90.54 -75.90 12 4 ASN A 19 ? ? -151.25 -74.40 13 5 SER A 2 ? ? 70.21 109.61 14 5 GLU A 18 ? ? -46.64 -82.43 # _pdbx_nmr_ensemble.entry_id 1ODP _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 5 _pdbx_nmr_ensemble.conformer_selection_criteria 'MOST CLOSELY RESEMBLING THE AVERAGE STRUCTURE OF OF A CALCULATED SET OF 20 CONFORMERS' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DGII ? HAVEL 1 refinement Discover ? 'BIOSYM TECHNOLOGIES, INC.' 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 LEU N N N N 123 LEU CA C N S 124 LEU C C N N 125 LEU O O N N 126 LEU CB C N N 127 LEU CG C N N 128 LEU CD1 C N N 129 LEU CD2 C N N 130 LEU OXT O N N 131 LEU H H N N 132 LEU H2 H N N 133 LEU HA H N N 134 LEU HB2 H N N 135 LEU HB3 H N N 136 LEU HG H N N 137 LEU HD11 H N N 138 LEU HD12 H N N 139 LEU HD13 H N N 140 LEU HD21 H N N 141 LEU HD22 H N N 142 LEU HD23 H N N 143 LEU HXT H N N 144 LYS N N N N 145 LYS CA C N S 146 LYS C C N N 147 LYS O O N N 148 LYS CB C N N 149 LYS CG C N N 150 LYS CD C N N 151 LYS CE C N N 152 LYS NZ N N N 153 LYS OXT O N N 154 LYS H H N N 155 LYS H2 H N N 156 LYS HA H N N 157 LYS HB2 H N N 158 LYS HB3 H N N 159 LYS HG2 H N N 160 LYS HG3 H N N 161 LYS HD2 H N N 162 LYS HD3 H N N 163 LYS HE2 H N N 164 LYS HE3 H N N 165 LYS HZ1 H N N 166 LYS HZ2 H N N 167 LYS HZ3 H N N 168 LYS HXT H N N 169 SER N N N N 170 SER CA C N S 171 SER C C N N 172 SER O O N N 173 SER CB C N N 174 SER OG O N N 175 SER OXT O N N 176 SER H H N N 177 SER H2 H N N 178 SER HA H N N 179 SER HB2 H N N 180 SER HB3 H N N 181 SER HG H N N 182 SER HXT H N N 183 TYR N N N N 184 TYR CA C N S 185 TYR C C N N 186 TYR O O N N 187 TYR CB C N N 188 TYR CG C Y N 189 TYR CD1 C Y N 190 TYR CD2 C Y N 191 TYR CE1 C Y N 192 TYR CE2 C Y N 193 TYR CZ C Y N 194 TYR OH O N N 195 TYR OXT O N N 196 TYR H H N N 197 TYR H2 H N N 198 TYR HA H N N 199 TYR HB2 H N N 200 TYR HB3 H N N 201 TYR HD1 H N N 202 TYR HD2 H N N 203 TYR HE1 H N N 204 TYR HE2 H N N 205 TYR HH H N N 206 TYR HXT H N N 207 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 LEU N CA sing N N 116 LEU N H sing N N 117 LEU N H2 sing N N 118 LEU CA C sing N N 119 LEU CA CB sing N N 120 LEU CA HA sing N N 121 LEU C O doub N N 122 LEU C OXT sing N N 123 LEU CB CG sing N N 124 LEU CB HB2 sing N N 125 LEU CB HB3 sing N N 126 LEU CG CD1 sing N N 127 LEU CG CD2 sing N N 128 LEU CG HG sing N N 129 LEU CD1 HD11 sing N N 130 LEU CD1 HD12 sing N N 131 LEU CD1 HD13 sing N N 132 LEU CD2 HD21 sing N N 133 LEU CD2 HD22 sing N N 134 LEU CD2 HD23 sing N N 135 LEU OXT HXT sing N N 136 LYS N CA sing N N 137 LYS N H sing N N 138 LYS N H2 sing N N 139 LYS CA C sing N N 140 LYS CA CB sing N N 141 LYS CA HA sing N N 142 LYS C O doub N N 143 LYS C OXT sing N N 144 LYS CB CG sing N N 145 LYS CB HB2 sing N N 146 LYS CB HB3 sing N N 147 LYS CG CD sing N N 148 LYS CG HG2 sing N N 149 LYS CG HG3 sing N N 150 LYS CD CE sing N N 151 LYS CD HD2 sing N N 152 LYS CD HD3 sing N N 153 LYS CE NZ sing N N 154 LYS CE HE2 sing N N 155 LYS CE HE3 sing N N 156 LYS NZ HZ1 sing N N 157 LYS NZ HZ2 sing N N 158 LYS NZ HZ3 sing N N 159 LYS OXT HXT sing N N 160 SER N CA sing N N 161 SER N H sing N N 162 SER N H2 sing N N 163 SER CA C sing N N 164 SER CA CB sing N N 165 SER CA HA sing N N 166 SER C O doub N N 167 SER C OXT sing N N 168 SER CB OG sing N N 169 SER CB HB2 sing N N 170 SER CB HB3 sing N N 171 SER OG HG sing N N 172 SER OXT HXT sing N N 173 TYR N CA sing N N 174 TYR N H sing N N 175 TYR N H2 sing N N 176 TYR CA C sing N N 177 TYR CA CB sing N N 178 TYR CA HA sing N N 179 TYR C O doub N N 180 TYR C OXT sing N N 181 TYR CB CG sing N N 182 TYR CB HB2 sing N N 183 TYR CB HB3 sing N N 184 TYR CG CD1 doub Y N 185 TYR CG CD2 sing Y N 186 TYR CD1 CE1 sing Y N 187 TYR CD1 HD1 sing N N 188 TYR CD2 CE2 doub Y N 189 TYR CD2 HD2 sing N N 190 TYR CE1 CZ doub Y N 191 TYR CE1 HE1 sing N N 192 TYR CE2 CZ sing Y N 193 TYR CE2 HE2 sing N N 194 TYR CZ OH sing N N 195 TYR OH HH sing N N 196 TYR OXT HXT sing N N 197 # _atom_sites.entry_id 1ODP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_