data_1OEK # _entry.id 1OEK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1OEK PDBE EBI-12472 WWPDB D_1290012472 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1OEK _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2003-03-28 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'David, G.' 1 'Blondeau, K.' 2 'Renouard, M.' 3 'Penel, S.' 4 'Lewit-Bentley, A.' 5 # _citation.id primary _citation.title 'Yoda from Escherichia Coli is a Metal-Binding, Lipocalin-Like Protein' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 278 _citation.page_first 43728 _citation.page_last ? _citation.year 2003 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12909634 _citation.pdbx_database_id_DOI 10.1074/JBC.M304484200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'David, G.' 1 primary 'Blondeau, K.' 2 primary 'Schiltz, M.' 3 primary 'Penel, S.' 4 primary 'Lewit-Bentley, A.' 5 # _cell.entry_id 1OEK _cell.length_a 58.600 _cell.length_b 58.600 _cell.length_c 152.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1OEK _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'METAL-BINDING PROTEIN ZINT' 22373.879 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 4 ? ? ? ? 3 water nat water 18.015 28 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CADMIUM-INDUCED PROTEIN ZINT' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HGHHSHGKPLTEVEQKAANGVFDDANVQNRTLSDWDGVWQSVYPLLQSGKLDPVFQKKADADKTKTFAEIKDYYHKGYAT DIEMIGIEDGIVEFHRNNETTSCKYDYDGYKILTYKSGKKGVRYLFECKDPESKAPKYIQFSDHIIAPRKSSHFHIFMGN DSQQSLLNEMENWPTYYPYQLSSEEVVEEMMSH ; _entity_poly.pdbx_seq_one_letter_code_can ;HGHHSHGKPLTEVEQKAANGVFDDANVQNRTLSDWDGVWQSVYPLLQSGKLDPVFQKKADADKTKTFAEIKDYYHKGYAT DIEMIGIEDGIVEFHRNNETTSCKYDYDGYKILTYKSGKKGVRYLFECKDPESKAPKYIQFSDHIIAPRKSSHFHIFMGN DSQQSLLNEMENWPTYYPYQLSSEEVVEEMMSH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 SER n 1 6 HIS n 1 7 GLY n 1 8 LYS n 1 9 PRO n 1 10 LEU n 1 11 THR n 1 12 GLU n 1 13 VAL n 1 14 GLU n 1 15 GLN n 1 16 LYS n 1 17 ALA n 1 18 ALA n 1 19 ASN n 1 20 GLY n 1 21 VAL n 1 22 PHE n 1 23 ASP n 1 24 ASP n 1 25 ALA n 1 26 ASN n 1 27 VAL n 1 28 GLN n 1 29 ASN n 1 30 ARG n 1 31 THR n 1 32 LEU n 1 33 SER n 1 34 ASP n 1 35 TRP n 1 36 ASP n 1 37 GLY n 1 38 VAL n 1 39 TRP n 1 40 GLN n 1 41 SER n 1 42 VAL n 1 43 TYR n 1 44 PRO n 1 45 LEU n 1 46 LEU n 1 47 GLN n 1 48 SER n 1 49 GLY n 1 50 LYS n 1 51 LEU n 1 52 ASP n 1 53 PRO n 1 54 VAL n 1 55 PHE n 1 56 GLN n 1 57 LYS n 1 58 LYS n 1 59 ALA n 1 60 ASP n 1 61 ALA n 1 62 ASP n 1 63 LYS n 1 64 THR n 1 65 LYS n 1 66 THR n 1 67 PHE n 1 68 ALA n 1 69 GLU n 1 70 ILE n 1 71 LYS n 1 72 ASP n 1 73 TYR n 1 74 TYR n 1 75 HIS n 1 76 LYS n 1 77 GLY n 1 78 TYR n 1 79 ALA n 1 80 THR n 1 81 ASP n 1 82 ILE n 1 83 GLU n 1 84 MET n 1 85 ILE n 1 86 GLY n 1 87 ILE n 1 88 GLU n 1 89 ASP n 1 90 GLY n 1 91 ILE n 1 92 VAL n 1 93 GLU n 1 94 PHE n 1 95 HIS n 1 96 ARG n 1 97 ASN n 1 98 ASN n 1 99 GLU n 1 100 THR n 1 101 THR n 1 102 SER n 1 103 CYS n 1 104 LYS n 1 105 TYR n 1 106 ASP n 1 107 TYR n 1 108 ASP n 1 109 GLY n 1 110 TYR n 1 111 LYS n 1 112 ILE n 1 113 LEU n 1 114 THR n 1 115 TYR n 1 116 LYS n 1 117 SER n 1 118 GLY n 1 119 LYS n 1 120 LYS n 1 121 GLY n 1 122 VAL n 1 123 ARG n 1 124 TYR n 1 125 LEU n 1 126 PHE n 1 127 GLU n 1 128 CYS n 1 129 LYS n 1 130 ASP n 1 131 PRO n 1 132 GLU n 1 133 SER n 1 134 LYS n 1 135 ALA n 1 136 PRO n 1 137 LYS n 1 138 TYR n 1 139 ILE n 1 140 GLN n 1 141 PHE n 1 142 SER n 1 143 ASP n 1 144 HIS n 1 145 ILE n 1 146 ILE n 1 147 ALA n 1 148 PRO n 1 149 ARG n 1 150 LYS n 1 151 SER n 1 152 SER n 1 153 HIS n 1 154 PHE n 1 155 HIS n 1 156 ILE n 1 157 PHE n 1 158 MET n 1 159 GLY n 1 160 ASN n 1 161 ASP n 1 162 SER n 1 163 GLN n 1 164 GLN n 1 165 SER n 1 166 LEU n 1 167 LEU n 1 168 ASN n 1 169 GLU n 1 170 MET n 1 171 GLU n 1 172 ASN n 1 173 TRP n 1 174 PRO n 1 175 THR n 1 176 TYR n 1 177 TYR n 1 178 PRO n 1 179 TYR n 1 180 GLN n 1 181 LEU n 1 182 SER n 1 183 SER n 1 184 GLU n 1 185 GLU n 1 186 VAL n 1 187 VAL n 1 188 GLU n 1 189 GLU n 1 190 MET n 1 191 MET n 1 192 SER n 1 193 HIS n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'ESCHERICHIA COLI' _entity_src_nat.pdbx_ncbi_taxonomy_id 562 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YODA_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P76344 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1OEK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 193 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P76344 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 216 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 193 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1OEK _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.91 _exptl_crystal.density_percent_sol 54.1 _exptl_crystal.description ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.50 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '10 MG/ML PROTEIN, 10% PEG 10000, 100 MM SODIUM CACODYLATE, PH = 6.5 200 MM ZINC SULPHATE, 10% GLYCEROL' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2001-10-15 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI 111' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.953 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'LURE BEAMLINE DW32' _diffrn_source.pdbx_synchrotron_site LURE _diffrn_source.pdbx_synchrotron_beamline DW32 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.953 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1OEK _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 55.050 _reflns.d_resolution_high 2.200 _reflns.number_obs 14176 _reflns.number_all ? _reflns.percent_possible_obs 98.6 _reflns.pdbx_Rmerge_I_obs 0.08600 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 16.6000 _reflns.B_iso_Wilson_estimate 53.38 _reflns.pdbx_redundancy 16.200 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.27 _reflns_shell.percent_possible_all 92.1 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 14.20 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1OEK _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 10445 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 55.05 _refine.ls_d_res_high 2.4 _refine.ls_percent_reflns_obs 99.53 _refine.ls_R_factor_obs 0.273 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2693 _refine.ls_R_factor_R_free 0.35057 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 525 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 67.190 _refine.aniso_B[1][1] 4.99 _refine.aniso_B[2][2] 4.99 _refine.aniso_B[3][3] -9.98 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.THE FIRST 8 RESIDUES AT THE N-TERMINUS ARE DISORDERED' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.329 _refine.overall_SU_ML 0.318 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 14.926 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1514 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 28 _refine_hist.number_atoms_total 1546 _refine_hist.d_res_high 2.4 _refine_hist.d_res_low 55.05 # _struct.entry_id 1OEK _struct.title 'YodA from Escherichia coli crystallised with zinc ions' _struct.pdbx_descriptor 'METAL-BINDING PROTEIN ZINT' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1OEK _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'METAL BINDING PROTEIN, STRESS PROTEIN, LIPOCALIN, YODA' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 11 ? ASN A 19 ? THR A 11 ASN A 19 1 ? 9 HELX_P HELX_P2 2 ASP A 23 ? VAL A 27 ? ASP A 23 VAL A 27 5 ? 5 HELX_P HELX_P3 3 THR A 31 ? TRP A 35 ? THR A 31 TRP A 35 5 ? 5 HELX_P HELX_P4 4 VAL A 42 ? SER A 48 ? VAL A 42 SER A 48 1 ? 7 HELX_P HELX_P5 5 LEU A 51 ? ASP A 60 ? LEU A 51 ASP A 60 1 ? 10 HELX_P HELX_P6 6 THR A 66 ? ALA A 79 ? THR A 66 ALA A 79 1 ? 14 HELX_P HELX_P7 7 SER A 162 ? GLU A 169 ? SER A 162 GLU A 169 1 ? 8 HELX_P HELX_P8 8 SER A 182 ? SER A 192 ? SER A 182 SER A 192 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 103 SG ? ? ? 1_555 A CYS 128 SG ? ? A CYS 103 A CYS 128 1_555 ? ? ? ? ? ? ? 2.050 ? metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 155 NE2 ? ? A ZN 1194 A HIS 155 1_555 ? ? ? ? ? ? ? 2.216 ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 144 NE2 ? ? A ZN 1194 A HIS 144 1_555 ? ? ? ? ? ? ? 1.951 ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 1194 A HOH 2025 1_555 ? ? ? ? ? ? ? 2.404 ? metalc4 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 193 NE2 ? ? A ZN 1195 A HIS 193 1_555 ? ? ? ? ? ? ? 1.974 ? metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 153 NE2 ? ? A ZN 1195 A HIS 153 1_555 ? ? ? ? ? ? ? 2.238 ? metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 A GLU 189 OE1 ? ? A ZN 1195 A GLU 189 1_555 ? ? ? ? ? ? ? 2.166 ? metalc7 metalc ? ? C ZN . ZN ? ? ? 1_555 A GLU 189 OE2 ? ? A ZN 1195 A GLU 189 1_555 ? ? ? ? ? ? ? 2.070 ? metalc8 metalc ? ? D ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 1196 A HOH 2026 1_555 ? ? ? ? ? ? ? 2.537 ? metalc9 metalc ? ? D ZN . ZN ? ? ? 1_555 A GLU 93 OE2 ? ? A ZN 1196 A GLU 93 8_666 ? ? ? ? ? ? ? 2.155 ? metalc10 metalc ? ? D ZN . ZN ? ? ? 1_555 A HIS 95 ND1 ? ? A ZN 1196 A HIS 95 1_555 ? ? ? ? ? ? ? 2.387 ? metalc11 metalc ? ? E ZN . ZN ? ? ? 1_555 A ASP 24 OD1 ? ? A ZN 1197 A ASP 24 1_555 ? ? ? ? ? ? ? 2.122 ? metalc12 metalc ? ? E ZN . ZN ? ? ? 1_555 A HIS 75 NE2 ? ? A ZN 1197 A HIS 75 4_454 ? ? ? ? ? ? ? 2.583 ? metalc13 metalc ? ? E ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 1197 A HOH 2027 1_555 ? ? ? ? ? ? ? 2.383 ? metalc14 metalc ? ? E ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 1197 A HOH 2028 1_555 ? ? ? ? ? ? ? 2.597 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AA 5 6 ? anti-parallel AA 6 7 ? anti-parallel AA 7 8 ? anti-parallel AA 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 THR A 100 ? LYS A 104 ? THR A 100 LYS A 104 AA 2 ILE A 91 ? HIS A 95 ? ILE A 91 HIS A 95 AA 3 MET A 84 ? GLU A 88 ? MET A 84 GLU A 88 AA 4 GLY A 37 ? SER A 41 ? GLY A 37 SER A 41 AA 5 THR A 175 ? PRO A 178 ? THR A 175 PRO A 178 AA 6 PHE A 154 ? GLY A 159 ? PHE A 154 GLY A 159 AA 7 TYR A 138 ? SER A 142 ? TYR A 138 SER A 142 AA 8 LYS A 120 ? GLU A 127 ? LYS A 120 GLU A 127 AA 9 ASP A 106 ? THR A 114 ? ASP A 106 THR A 114 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N CYS A 103 ? N CYS A 103 O VAL A 92 ? O VAL A 92 AA 2 3 N HIS A 95 ? N HIS A 95 O MET A 84 ? O MET A 84 AA 3 4 N ILE A 87 ? N ILE A 87 O GLY A 37 ? O GLY A 37 AA 4 5 N GLN A 40 ? N GLN A 40 O TYR A 177 ? O TYR A 177 AA 5 6 N TYR A 176 ? N TYR A 176 O PHE A 154 ? O PHE A 154 AA 6 7 N GLY A 159 ? N GLY A 159 O TYR A 138 ? O TYR A 138 AA 7 8 N PHE A 141 ? N PHE A 141 O TYR A 124 ? O TYR A 124 AA 8 9 N GLU A 127 ? N GLU A 127 O ASP A 106 ? O ASP A 106 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1194' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1195' AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ZN A 1196' AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 1197' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 144 ? HIS A 144 . ? 1_555 ? 2 AC1 4 HIS A 155 ? HIS A 155 . ? 1_555 ? 3 AC1 4 HOH F . ? HOH A 2023 . ? 1_555 ? 4 AC1 4 HOH F . ? HOH A 2025 . ? 1_555 ? 5 AC2 4 HIS A 153 ? HIS A 153 . ? 1_555 ? 6 AC2 4 TYR A 177 ? TYR A 177 . ? 1_555 ? 7 AC2 4 GLU A 189 ? GLU A 189 . ? 1_555 ? 8 AC2 4 HIS A 193 ? HIS A 193 . ? 1_555 ? 9 AC3 3 GLU A 93 ? GLU A 93 . ? 8_666 ? 10 AC3 3 HIS A 95 ? HIS A 95 . ? 1_555 ? 11 AC3 3 HOH F . ? HOH A 2026 . ? 1_555 ? 12 AC4 5 ASP A 24 ? ASP A 24 . ? 1_555 ? 13 AC4 5 GLN A 47 ? GLN A 47 . ? 4_454 ? 14 AC4 5 HIS A 75 ? HIS A 75 . ? 4_454 ? 15 AC4 5 HOH F . ? HOH A 2027 . ? 1_555 ? 16 AC4 5 HOH F . ? HOH A 2028 . ? 1_555 ? # _database_PDB_matrix.entry_id 1OEK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1OEK _atom_sites.fract_transf_matrix[1][1] 0.017065 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017065 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006579 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 LYS 8 8 ? ? ? A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 CYS 103 103 103 CYS CYS A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 CYS 128 128 128 CYS CYS A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 HIS 144 144 144 HIS HIS A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 HIS 153 153 153 HIS HIS A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 MET 158 158 158 MET MET A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 ASN 160 160 160 ASN ASN A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 ASN 168 168 168 ASN ASN A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 MET 170 170 170 MET MET A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 ASN 172 172 172 ASN ASN A . n A 1 173 TRP 173 173 173 TRP TRP A . n A 1 174 PRO 174 174 174 PRO PRO A . n A 1 175 THR 175 175 175 THR THR A . n A 1 176 TYR 176 176 176 TYR TYR A . n A 1 177 TYR 177 177 177 TYR TYR A . n A 1 178 PRO 178 178 178 PRO PRO A . n A 1 179 TYR 179 179 179 TYR TYR A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 VAL 187 187 187 VAL VAL A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 MET 190 190 190 MET MET A . n A 1 191 MET 191 191 191 MET MET A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 HIS 193 193 193 HIS HIS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 1194 1194 ZN ZN A . C 2 ZN 1 1195 1195 ZN ZN A . D 2 ZN 1 1196 1196 ZN ZN A . E 2 ZN 1 1197 1197 ZN ZN A . F 3 HOH 1 2001 2001 HOH HOH A . F 3 HOH 2 2002 2002 HOH HOH A . F 3 HOH 3 2003 2003 HOH HOH A . F 3 HOH 4 2004 2004 HOH HOH A . F 3 HOH 5 2005 2005 HOH HOH A . F 3 HOH 6 2006 2006 HOH HOH A . F 3 HOH 7 2007 2007 HOH HOH A . F 3 HOH 8 2008 2008 HOH HOH A . F 3 HOH 9 2009 2009 HOH HOH A . F 3 HOH 10 2010 2010 HOH HOH A . F 3 HOH 11 2011 2011 HOH HOH A . F 3 HOH 12 2012 2012 HOH HOH A . F 3 HOH 13 2013 2013 HOH HOH A . F 3 HOH 14 2014 2014 HOH HOH A . F 3 HOH 15 2015 2015 HOH HOH A . F 3 HOH 16 2016 2016 HOH HOH A . F 3 HOH 17 2017 2017 HOH HOH A . F 3 HOH 18 2018 2018 HOH HOH A . F 3 HOH 19 2019 2019 HOH HOH A . F 3 HOH 20 2020 2020 HOH HOH A . F 3 HOH 21 2021 2021 HOH HOH A . F 3 HOH 22 2022 2022 HOH HOH A . F 3 HOH 23 2023 2023 HOH HOH A . F 3 HOH 24 2024 2024 HOH HOH A . F 3 HOH 25 2025 2025 HOH HOH A . F 3 HOH 26 2026 2026 HOH HOH A . F 3 HOH 27 2027 2027 HOH HOH A . F 3 HOH 28 2028 2028 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 155 ? A HIS 155 ? 1_555 ZN ? B ZN . ? A ZN 1194 ? 1_555 NE2 ? A HIS 144 ? A HIS 144 ? 1_555 101.4 ? 2 NE2 ? A HIS 155 ? A HIS 155 ? 1_555 ZN ? B ZN . ? A ZN 1194 ? 1_555 O ? F HOH . ? A HOH 2025 ? 1_555 101.3 ? 3 NE2 ? A HIS 144 ? A HIS 144 ? 1_555 ZN ? B ZN . ? A ZN 1194 ? 1_555 O ? F HOH . ? A HOH 2025 ? 1_555 70.1 ? 4 NE2 ? A HIS 193 ? A HIS 193 ? 1_555 ZN ? C ZN . ? A ZN 1195 ? 1_555 NE2 ? A HIS 153 ? A HIS 153 ? 1_555 92.1 ? 5 NE2 ? A HIS 193 ? A HIS 193 ? 1_555 ZN ? C ZN . ? A ZN 1195 ? 1_555 OE1 ? A GLU 189 ? A GLU 189 ? 1_555 138.2 ? 6 NE2 ? A HIS 153 ? A HIS 153 ? 1_555 ZN ? C ZN . ? A ZN 1195 ? 1_555 OE1 ? A GLU 189 ? A GLU 189 ? 1_555 123.7 ? 7 NE2 ? A HIS 193 ? A HIS 193 ? 1_555 ZN ? C ZN . ? A ZN 1195 ? 1_555 OE2 ? A GLU 189 ? A GLU 189 ? 1_555 122.7 ? 8 NE2 ? A HIS 153 ? A HIS 153 ? 1_555 ZN ? C ZN . ? A ZN 1195 ? 1_555 OE2 ? A GLU 189 ? A GLU 189 ? 1_555 113.9 ? 9 OE1 ? A GLU 189 ? A GLU 189 ? 1_555 ZN ? C ZN . ? A ZN 1195 ? 1_555 OE2 ? A GLU 189 ? A GLU 189 ? 1_555 65.4 ? 10 O ? F HOH . ? A HOH 2026 ? 1_555 ZN ? D ZN . ? A ZN 1196 ? 1_555 OE2 ? A GLU 93 ? A GLU 93 ? 8_666 128.8 ? 11 O ? F HOH . ? A HOH 2026 ? 1_555 ZN ? D ZN . ? A ZN 1196 ? 1_555 ND1 ? A HIS 95 ? A HIS 95 ? 1_555 123.8 ? 12 OE2 ? A GLU 93 ? A GLU 93 ? 8_666 ZN ? D ZN . ? A ZN 1196 ? 1_555 ND1 ? A HIS 95 ? A HIS 95 ? 1_555 61.4 ? 13 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 ZN ? E ZN . ? A ZN 1197 ? 1_555 NE2 ? A HIS 75 ? A HIS 75 ? 4_454 70.5 ? 14 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 ZN ? E ZN . ? A ZN 1197 ? 1_555 O ? F HOH . ? A HOH 2027 ? 1_555 90.5 ? 15 NE2 ? A HIS 75 ? A HIS 75 ? 4_454 ZN ? E ZN . ? A ZN 1197 ? 1_555 O ? F HOH . ? A HOH 2027 ? 1_555 97.7 ? 16 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 ZN ? E ZN . ? A ZN 1197 ? 1_555 O ? F HOH . ? A HOH 2028 ? 1_555 84.6 ? 17 NE2 ? A HIS 75 ? A HIS 75 ? 4_454 ZN ? E ZN . ? A ZN 1197 ? 1_555 O ? F HOH . ? A HOH 2028 ? 1_555 101.2 ? 18 O ? F HOH . ? A HOH 2027 ? 1_555 ZN ? E ZN . ? A ZN 1197 ? 1_555 O ? F HOH . ? A HOH 2028 ? 1_555 157.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-08-15 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' Advisory 4 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn 2 4 'Structure model' diffrn_detector 3 4 'Structure model' diffrn_source 4 4 'Structure model' pdbx_unobs_or_zero_occ_atoms # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language REFMAC refinement . ? 1 ? ? ? ? DENZO 'data reduction' . ? 2 ? ? ? ? SCALEPACK 'data scaling' . ? 3 ? ? ? ? SHARP phasing . ? 4 ? ? ? ? # _pdbx_entry_details.entry_id 1OEK _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE SEQUENCE: MAIRLYKLAVALGVFIVSAPAFS THAT IS INCLUDED THE SWISPROT RECORD UPSTREAM OF THE SEQUENCE CRYSTALLISED, CORRESPONDS TO A SIGNAL SEQUENCE THAT IS CLEAVED IN THE MATURE PROTEIN. ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CB A GLN 180 ? ? O A HOH 2020 ? ? 1.90 2 1 OE1 A GLU 169 ? ? O A HOH 2014 ? ? 2.07 3 1 OD2 A ASP 143 ? ? OG A SER 151 ? ? 2.08 4 1 OH A TYR 179 ? ? O A HOH 2018 ? ? 2.17 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A GLN 15 ? ? N A LYS 16 ? ? 1.160 1.336 -0.176 0.023 Y 2 1 N A LYS 16 ? ? CA A LYS 16 ? ? 1.660 1.459 0.201 0.020 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A GLN 15 ? ? C A GLN 15 ? ? N A LYS 16 ? ? 143.52 117.20 26.32 2.20 Y 2 1 O A GLN 15 ? ? C A GLN 15 ? ? N A LYS 16 ? ? 92.43 122.70 -30.27 1.60 Y 3 1 N A LYS 16 ? ? CA A LYS 16 ? ? CB A LYS 16 ? ? 87.63 110.60 -22.97 1.80 N 4 1 N A LYS 16 ? ? CA A LYS 16 ? ? C A LYS 16 ? ? 93.22 111.00 -17.78 2.70 N 5 1 CB A ASP 24 ? ? CA A ASP 24 ? ? C A ASP 24 ? ? 126.70 110.40 16.30 2.00 N 6 1 CB A ASP 24 ? ? CG A ASP 24 ? ? OD2 A ASP 24 ? ? 128.43 118.30 10.13 0.90 N 7 1 CB A ASP 34 ? ? CG A ASP 34 ? ? OD2 A ASP 34 ? ? 123.98 118.30 5.68 0.90 N 8 1 CB A ASP 36 ? ? CG A ASP 36 ? ? OD2 A ASP 36 ? ? 124.21 118.30 5.91 0.90 N 9 1 CB A ASP 89 ? ? CG A ASP 89 ? ? OD1 A ASP 89 ? ? 124.56 118.30 6.26 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 10 ? ? -0.21 118.20 2 1 PRO A 53 ? ? -36.76 -35.80 3 1 ALA A 68 ? ? -47.61 -70.26 4 1 GLU A 83 ? ? -37.49 -31.49 5 1 GLU A 88 ? ? -171.91 139.57 6 1 ASN A 97 ? ? -141.92 55.65 7 1 ASN A 98 ? ? 71.83 32.69 8 1 LYS A 116 ? ? -46.29 -12.96 9 1 ARG A 149 ? ? 165.33 139.85 10 1 HIS A 153 ? ? 172.35 158.43 11 1 ASP A 161 ? ? -63.39 -100.23 12 1 TRP A 173 ? ? -150.93 78.77 13 1 GLN A 180 ? ? -29.39 -55.66 14 1 SER A 192 ? ? -69.60 66.55 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id GLN _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 15 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -17.78 # _pdbx_validate_polymer_linkage.id 1 _pdbx_validate_polymer_linkage.PDB_model_num 1 _pdbx_validate_polymer_linkage.auth_atom_id_1 C _pdbx_validate_polymer_linkage.auth_asym_id_1 A _pdbx_validate_polymer_linkage.auth_comp_id_1 GLN _pdbx_validate_polymer_linkage.auth_seq_id_1 15 _pdbx_validate_polymer_linkage.PDB_ins_code_1 ? _pdbx_validate_polymer_linkage.label_alt_id_1 ? _pdbx_validate_polymer_linkage.auth_atom_id_2 N _pdbx_validate_polymer_linkage.auth_asym_id_2 A _pdbx_validate_polymer_linkage.auth_comp_id_2 LYS _pdbx_validate_polymer_linkage.auth_seq_id_2 16 _pdbx_validate_polymer_linkage.PDB_ins_code_2 ? _pdbx_validate_polymer_linkage.label_alt_id_2 ? _pdbx_validate_polymer_linkage.dist 1.16 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 1 ? A HIS 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A LYS 8 ? A LYS 8 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH #