data_1OGL # _entry.id 1OGL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1OGL PDBE EBI-12607 WWPDB D_1290012607 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1OGK _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'THE CRYSTAL STRUCTURE OF TRYPANOSOMA CRUZI DUTPASE IN COMPLEX WITH DUDP' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1OGL _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2003-05-07 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Harkiolaki, M.' 1 'Dodson, E.J.' 2 'Bernier-Villamor, V.' 3 'Turkenburg, J.P.' 4 'Gonzalez-Pacanowska, D.' 5 'Wilson, K.S.' 6 # _citation.id primary _citation.title 'The Crystal Structure of Trypanosoma Cruzi Dutpase Reveals a Novel Dutp/Dudp Binding Fold' _citation.journal_abbrev Structure _citation.journal_volume 12 _citation.page_first 41 _citation.page_last ? _citation.year 2004 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14725764 _citation.pdbx_database_id_DOI 10.1016/J.STR.2003.11.016 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Harkiolaki, M.' 1 primary 'Dodson, E.J.' 2 primary 'Bernier-Villamor, V.' 3 primary 'Turkenburg, J.P.' 4 primary 'Gonzalez-Pacanowska, D.' 5 primary 'Wilson, K.S.' 6 # _cell.entry_id 1OGL _cell.length_a 136.434 _cell.length_b 136.434 _cell.length_c 68.705 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1OGL _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DEOXYURIDINE TRIPHOSPHATASE' 32104.342 1 3.6.1.23 ? ? ? 2 water nat water 18.015 34 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name DUTPASE # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNRVQSGFRVPARVLNSLAHLQDGLNIFMDPDWRQIRHVDDWALAITMESAELIDSYPWKWWKNVKAQTDMHNVRIEIAD ILHFSLSGEIQKRTQDEKGADDVALKSLKEMGFFCRPPAHAKSTAASGQRTNGGDGDGDDELLELMFFPLTEVASAVATF RNIIQLASIYRFDLITKGLLLAAQDLDFNLVGYYVAKYTLNQIRQLKGYKEGVYVKVREGVEDNELLHECVQSVSVEDVL NEGTYLKAWEKIACSVFDAFGMPEEERRHAYDWLKSAALDGKG ; _entity_poly.pdbx_seq_one_letter_code_can ;MNRVQSGFRVPARVLNSLAHLQDGLNIFMDPDWRQIRHVDDWALAITMESAELIDSYPWKWWKNVKAQTDMHNVRIEIAD ILHFSLSGEIQKRTQDEKGADDVALKSLKEMGFFCRPPAHAKSTAASGQRTNGGDGDGDDELLELMFFPLTEVASAVATF RNIIQLASIYRFDLITKGLLLAAQDLDFNLVGYYVAKYTLNQIRQLKGYKEGVYVKVREGVEDNELLHECVQSVSVEDVL NEGTYLKAWEKIACSVFDAFGMPEEERRHAYDWLKSAALDGKG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 ARG n 1 4 VAL n 1 5 GLN n 1 6 SER n 1 7 GLY n 1 8 PHE n 1 9 ARG n 1 10 VAL n 1 11 PRO n 1 12 ALA n 1 13 ARG n 1 14 VAL n 1 15 LEU n 1 16 ASN n 1 17 SER n 1 18 LEU n 1 19 ALA n 1 20 HIS n 1 21 LEU n 1 22 GLN n 1 23 ASP n 1 24 GLY n 1 25 LEU n 1 26 ASN n 1 27 ILE n 1 28 PHE n 1 29 MET n 1 30 ASP n 1 31 PRO n 1 32 ASP n 1 33 TRP n 1 34 ARG n 1 35 GLN n 1 36 ILE n 1 37 ARG n 1 38 HIS n 1 39 VAL n 1 40 ASP n 1 41 ASP n 1 42 TRP n 1 43 ALA n 1 44 LEU n 1 45 ALA n 1 46 ILE n 1 47 THR n 1 48 MET n 1 49 GLU n 1 50 SER n 1 51 ALA n 1 52 GLU n 1 53 LEU n 1 54 ILE n 1 55 ASP n 1 56 SER n 1 57 TYR n 1 58 PRO n 1 59 TRP n 1 60 LYS n 1 61 TRP n 1 62 TRP n 1 63 LYS n 1 64 ASN n 1 65 VAL n 1 66 LYS n 1 67 ALA n 1 68 GLN n 1 69 THR n 1 70 ASP n 1 71 MET n 1 72 HIS n 1 73 ASN n 1 74 VAL n 1 75 ARG n 1 76 ILE n 1 77 GLU n 1 78 ILE n 1 79 ALA n 1 80 ASP n 1 81 ILE n 1 82 LEU n 1 83 HIS n 1 84 PHE n 1 85 SER n 1 86 LEU n 1 87 SER n 1 88 GLY n 1 89 GLU n 1 90 ILE n 1 91 GLN n 1 92 LYS n 1 93 ARG n 1 94 THR n 1 95 GLN n 1 96 ASP n 1 97 GLU n 1 98 LYS n 1 99 GLY n 1 100 ALA n 1 101 ASP n 1 102 ASP n 1 103 VAL n 1 104 ALA n 1 105 LEU n 1 106 LYS n 1 107 SER n 1 108 LEU n 1 109 LYS n 1 110 GLU n 1 111 MET n 1 112 GLY n 1 113 PHE n 1 114 PHE n 1 115 CYS n 1 116 ARG n 1 117 PRO n 1 118 PRO n 1 119 ALA n 1 120 HIS n 1 121 ALA n 1 122 LYS n 1 123 SER n 1 124 THR n 1 125 ALA n 1 126 ALA n 1 127 SER n 1 128 GLY n 1 129 GLN n 1 130 ARG n 1 131 THR n 1 132 ASN n 1 133 GLY n 1 134 GLY n 1 135 ASP n 1 136 GLY n 1 137 ASP n 1 138 GLY n 1 139 ASP n 1 140 ASP n 1 141 GLU n 1 142 LEU n 1 143 LEU n 1 144 GLU n 1 145 LEU n 1 146 MET n 1 147 PHE n 1 148 PHE n 1 149 PRO n 1 150 LEU n 1 151 THR n 1 152 GLU n 1 153 VAL n 1 154 ALA n 1 155 SER n 1 156 ALA n 1 157 VAL n 1 158 ALA n 1 159 THR n 1 160 PHE n 1 161 ARG n 1 162 ASN n 1 163 ILE n 1 164 ILE n 1 165 GLN n 1 166 LEU n 1 167 ALA n 1 168 SER n 1 169 ILE n 1 170 TYR n 1 171 ARG n 1 172 PHE n 1 173 ASP n 1 174 LEU n 1 175 ILE n 1 176 THR n 1 177 LYS n 1 178 GLY n 1 179 LEU n 1 180 LEU n 1 181 LEU n 1 182 ALA n 1 183 ALA n 1 184 GLN n 1 185 ASP n 1 186 LEU n 1 187 ASP n 1 188 PHE n 1 189 ASN n 1 190 LEU n 1 191 VAL n 1 192 GLY n 1 193 TYR n 1 194 TYR n 1 195 VAL n 1 196 ALA n 1 197 LYS n 1 198 TYR n 1 199 THR n 1 200 LEU n 1 201 ASN n 1 202 GLN n 1 203 ILE n 1 204 ARG n 1 205 GLN n 1 206 LEU n 1 207 LYS n 1 208 GLY n 1 209 TYR n 1 210 LYS n 1 211 GLU n 1 212 GLY n 1 213 VAL n 1 214 TYR n 1 215 VAL n 1 216 LYS n 1 217 VAL n 1 218 ARG n 1 219 GLU n 1 220 GLY n 1 221 VAL n 1 222 GLU n 1 223 ASP n 1 224 ASN n 1 225 GLU n 1 226 LEU n 1 227 LEU n 1 228 HIS n 1 229 GLU n 1 230 CYS n 1 231 VAL n 1 232 GLN n 1 233 SER n 1 234 VAL n 1 235 SER n 1 236 VAL n 1 237 GLU n 1 238 ASP n 1 239 VAL n 1 240 LEU n 1 241 ASN n 1 242 GLU n 1 243 GLY n 1 244 THR n 1 245 TYR n 1 246 LEU n 1 247 LYS n 1 248 ALA n 1 249 TRP n 1 250 GLU n 1 251 LYS n 1 252 ILE n 1 253 ALA n 1 254 CYS n 1 255 SER n 1 256 VAL n 1 257 PHE n 1 258 ASP n 1 259 ALA n 1 260 PHE n 1 261 GLY n 1 262 MET n 1 263 PRO n 1 264 GLU n 1 265 GLU n 1 266 GLU n 1 267 ARG n 1 268 ARG n 1 269 HIS n 1 270 ALA n 1 271 TYR n 1 272 ASP n 1 273 TRP n 1 274 LEU n 1 275 LYS n 1 276 SER n 1 277 ALA n 1 278 ALA n 1 279 LEU n 1 280 ASP n 1 281 GLY n 1 282 LYS n 1 283 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Y _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'TRYPANOSOMA CRUZI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5693 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-11C _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O15923 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession O15923 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1OGL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 283 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15923 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 283 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 283 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1OGL _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.9 _exptl_crystal.density_percent_sol 57 _exptl_crystal.description 'ADDITIONAL PHASE INFORMATION PROVIDED THROUGH MERCURYL DERIVATIVE' # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.60 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '15% PEG 2000 MME, 0.1 M LISO4, 50 MM SODIUM CACODYLATE PH 6.6' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2000-03-15 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator SI111 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9688 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-4' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-4 _diffrn_source.pdbx_wavelength 0.9688 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1OGL _reflns.observed_criterion_sigma_I 0.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 12.000 _reflns.d_resolution_high 2.400 _reflns.number_obs 14827 _reflns.number_all ? _reflns.percent_possible_obs 97.5 _reflns.pdbx_Rmerge_I_obs 0.05000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 32.4000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.200 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.40 _reflns_shell.d_res_low 2.44 _reflns_shell.percent_possible_all 88.4 _reflns_shell.Rmerge_I_obs 0.41000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 4.100 _reflns_shell.pdbx_redundancy 6.50 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1OGL _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 14099 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.00 _refine.ls_d_res_high 2.40 _refine.ls_percent_reflns_obs 96.8 _refine.ls_R_factor_obs 0.206 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.203 _refine.ls_R_factor_R_free 0.263 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.900 _refine.ls_number_reflns_R_free 724 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.951 _refine.correlation_coeff_Fo_to_Fc_free 0.925 _refine.B_iso_mean 29.70 _refine.aniso_B[1][1] 0.00000 _refine.aniso_B[2][2] 0.00000 _refine.aniso_B[3][3] 0.00000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'LOW RESOLUTION MAD STRUCTURE' _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.292 _refine.pdbx_overall_ESU_R_Free 0.246 _refine.overall_SU_ML 0.179 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 7.775 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2003 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 2037 _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 30.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.017 0.021 ? 2047 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 1853 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.542 1.941 ? 2772 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.906 3.000 ? 4299 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.427 5.000 ? 243 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_chiral_restr 0.107 0.200 ? 305 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.020 ? 2256 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.002 0.020 ? 426 'X-RAY DIFFRACTION' ? r_nbd_refined 0.213 0.200 ? 452 'X-RAY DIFFRACTION' ? r_nbd_other 0.228 0.200 ? 2090 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other 0.096 0.200 ? 1205 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.203 0.200 ? 41 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.176 0.200 ? 11 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.235 0.200 ? 51 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.175 0.200 ? 5 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.856 1.500 ? 1224 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.648 2.000 ? 1969 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 2.369 3.000 ? 823 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 3.931 4.500 ? 803 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.40 _refine_ls_shell.d_res_low 2.46 _refine_ls_shell.number_reflns_R_work 970 _refine_ls_shell.R_factor_R_work 0.2730 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.3470 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 61 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 1OGL _struct.title 'The crystal structure of native Trypanosoma cruzi dUTPase' _struct.pdbx_descriptor 'DEOXYURIDINE TRIPHOSPHATASE (E.C.3.6.1.23)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1OGL _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'HYDROLASE, DUTPASE, TRYPANOSOMA CRUZI, NATIVE, DIMER' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 11 ? ASP A 30 ? PRO A 11 ASP A 30 1 ? 20 HELX_P HELX_P2 2 ASP A 32 ? ARG A 37 ? ASP A 32 ARG A 37 1 ? 6 HELX_P HELX_P3 3 HIS A 38 ? SER A 56 ? HIS A 38 SER A 56 1 ? 19 HELX_P HELX_P4 4 ASP A 70 ? THR A 94 ? ASP A 70 THR A 94 1 ? 25 HELX_P HELX_P5 5 ASP A 101 ? GLY A 112 ? ASP A 101 GLY A 112 1 ? 12 HELX_P HELX_P6 6 GLU A 152 ? ILE A 169 ? GLU A 152 ILE A 169 1 ? 18 HELX_P HELX_P7 7 ARG A 171 ? LEU A 186 ? ARG A 171 LEU A 186 1 ? 16 HELX_P HELX_P8 8 ASN A 189 ? LEU A 206 ? ASN A 189 LEU A 206 1 ? 18 HELX_P HELX_P9 9 LEU A 206 ? GLU A 211 ? LEU A 206 GLU A 211 1 ? 6 HELX_P HELX_P10 10 GLU A 222 ? GLN A 232 ? GLU A 222 GLN A 232 1 ? 11 HELX_P HELX_P11 11 THR A 244 ? PHE A 260 ? THR A 244 PHE A 260 1 ? 17 HELX_P HELX_P12 12 PRO A 263 ? GLU A 266 ? PRO A 263 GLU A 266 5 ? 4 HELX_P HELX_P13 13 ARG A 267 ? LYS A 275 ? ARG A 267 LYS A 275 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 148 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 148 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 149 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 149 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.54 # _database_PDB_matrix.entry_id 1OGL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1OGL _atom_sites.fract_transf_matrix[1][1] 0.007330 _atom_sites.fract_transf_matrix[1][2] 0.004232 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008463 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014555 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 GLN 5 5 ? ? ? A . n A 1 6 SER 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 PHE 8 8 ? ? ? A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 GLU 97 97 ? ? ? A . n A 1 98 LYS 98 98 ? ? ? A . n A 1 99 GLY 99 99 ? ? ? A . n A 1 100 ALA 100 100 ? ? ? A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 CYS 115 115 115 CYS CYS A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 HIS 120 120 ? ? ? A . n A 1 121 ALA 121 121 ? ? ? A . n A 1 122 LYS 122 122 ? ? ? A . n A 1 123 SER 123 123 ? ? ? A . n A 1 124 THR 124 124 ? ? ? A . n A 1 125 ALA 125 125 ? ? ? A . n A 1 126 ALA 126 126 ? ? ? A . n A 1 127 SER 127 127 ? ? ? A . n A 1 128 GLY 128 128 ? ? ? A . n A 1 129 GLN 129 129 ? ? ? A . n A 1 130 ARG 130 130 ? ? ? A . n A 1 131 THR 131 131 ? ? ? A . n A 1 132 ASN 132 132 ? ? ? A . n A 1 133 GLY 133 133 ? ? ? A . n A 1 134 GLY 134 134 ? ? ? A . n A 1 135 ASP 135 135 ? ? ? A . n A 1 136 GLY 136 136 ? ? ? A . n A 1 137 ASP 137 137 ? ? ? A . n A 1 138 GLY 138 138 ? ? ? A . n A 1 139 ASP 139 139 ? ? ? A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 MET 146 146 146 MET MET A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 PHE 160 160 160 PHE PHE A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 TYR 170 170 170 TYR TYR A . n A 1 171 ARG 171 171 171 ARG ARG A . n A 1 172 PHE 172 172 172 PHE PHE A . n A 1 173 ASP 173 173 173 ASP ASP A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 PHE 188 188 188 PHE PHE A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 TYR 193 193 193 TYR TYR A . n A 1 194 TYR 194 194 194 TYR TYR A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 TYR 198 198 198 TYR TYR A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 ASN 201 201 201 ASN ASN A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 GLN 205 205 205 GLN GLN A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 LYS 207 207 207 LYS LYS A . n A 1 208 GLY 208 208 208 GLY GLY A . n A 1 209 TYR 209 209 209 TYR TYR A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 TYR 214 214 214 TYR TYR A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 VAL 217 217 217 VAL VAL A . n A 1 218 ARG 218 218 218 ARG ARG A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 GLU 222 222 222 GLU GLU A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 GLU 225 225 225 GLU GLU A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 HIS 228 228 228 HIS HIS A . n A 1 229 GLU 229 229 229 GLU GLU A . n A 1 230 CYS 230 230 230 CYS CYS A . n A 1 231 VAL 231 231 231 VAL VAL A . n A 1 232 GLN 232 232 232 GLN GLN A . n A 1 233 SER 233 233 233 SER SER A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 SER 235 235 235 SER SER A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 ASP 238 238 238 ASP ASP A . n A 1 239 VAL 239 239 239 VAL VAL A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 ASN 241 241 241 ASN ASN A . n A 1 242 GLU 242 242 242 GLU GLU A . n A 1 243 GLY 243 243 243 GLY GLY A . n A 1 244 THR 244 244 244 THR THR A . n A 1 245 TYR 245 245 245 TYR TYR A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 LYS 247 247 247 LYS LYS A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 TRP 249 249 249 TRP TRP A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 LYS 251 251 251 LYS LYS A . n A 1 252 ILE 252 252 252 ILE ILE A . n A 1 253 ALA 253 253 253 ALA ALA A . n A 1 254 CYS 254 254 254 CYS CYS A . n A 1 255 SER 255 255 255 SER SER A . n A 1 256 VAL 256 256 256 VAL VAL A . n A 1 257 PHE 257 257 257 PHE PHE A . n A 1 258 ASP 258 258 258 ASP ASP A . n A 1 259 ALA 259 259 259 ALA ALA A . n A 1 260 PHE 260 260 260 PHE PHE A . n A 1 261 GLY 261 261 261 GLY GLY A . n A 1 262 MET 262 262 262 MET MET A . n A 1 263 PRO 263 263 263 PRO PRO A . n A 1 264 GLU 264 264 264 GLU GLU A . n A 1 265 GLU 265 265 265 GLU GLU A . n A 1 266 GLU 266 266 266 GLU GLU A . n A 1 267 ARG 267 267 267 ARG ARG A . n A 1 268 ARG 268 268 268 ARG ARG A . n A 1 269 HIS 269 269 269 HIS HIS A . n A 1 270 ALA 270 270 270 ALA ALA A . n A 1 271 TYR 271 271 271 TYR TYR A . n A 1 272 ASP 272 272 272 ASP ASP A . n A 1 273 TRP 273 273 273 TRP TRP A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 LYS 275 275 275 LYS LYS A . n A 1 276 SER 276 276 276 SER SER A . n A 1 277 ALA 277 277 277 ALA ALA A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 LEU 279 279 ? ? ? A . n A 1 280 ASP 280 280 ? ? ? A . n A 1 281 GLY 281 281 ? ? ? A . n A 1 282 LYS 282 282 ? ? ? A . n A 1 283 GLY 283 283 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 2001 2001 HOH HOH A . B 2 HOH 2 2002 2002 HOH HOH A . B 2 HOH 3 2003 2003 HOH HOH A . B 2 HOH 4 2004 2004 HOH HOH A . B 2 HOH 5 2005 2005 HOH HOH A . B 2 HOH 6 2006 2006 HOH HOH A . B 2 HOH 7 2007 2007 HOH HOH A . B 2 HOH 8 2008 2008 HOH HOH A . B 2 HOH 9 2009 2009 HOH HOH A . B 2 HOH 10 2010 2010 HOH HOH A . B 2 HOH 11 2011 2011 HOH HOH A . B 2 HOH 12 2012 2012 HOH HOH A . B 2 HOH 13 2013 2013 HOH HOH A . B 2 HOH 14 2014 2014 HOH HOH A . B 2 HOH 15 2015 2015 HOH HOH A . B 2 HOH 16 2016 2016 HOH HOH A . B 2 HOH 17 2017 2017 HOH HOH A . B 2 HOH 18 2018 2018 HOH HOH A . B 2 HOH 19 2019 2019 HOH HOH A . B 2 HOH 20 2020 2020 HOH HOH A . B 2 HOH 21 2021 2021 HOH HOH A . B 2 HOH 22 2022 2022 HOH HOH A . B 2 HOH 23 2023 2023 HOH HOH A . B 2 HOH 24 2024 2024 HOH HOH A . B 2 HOH 25 2025 2025 HOH HOH A . B 2 HOH 26 2026 2026 HOH HOH A . B 2 HOH 27 2027 2027 HOH HOH A . B 2 HOH 28 2028 2028 HOH HOH A . B 2 HOH 29 2029 2029 HOH HOH A . B 2 HOH 30 2030 2030 HOH HOH A . B 2 HOH 31 2031 2031 HOH HOH A . B 2 HOH 32 2032 2032 HOH HOH A . B 2 HOH 33 2033 2033 HOH HOH A . B 2 HOH 34 2034 2034 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_555 x,x-y,-z+1/2 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 34.3525000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-01-22 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.1.24 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SOLVE phasing . ? 4 MLPHARE phasing . ? 5 AMoRE phasing . ? 6 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 41 ? ? CG A ASP 41 ? ? OD2 A ASP 41 ? ? 123.82 118.30 5.52 0.90 N 2 1 CB A ASP 140 ? ? CG A ASP 140 ? ? OD2 A ASP 140 ? ? 123.76 118.30 5.46 0.90 N 3 1 CB A ASP 173 ? ? CG A ASP 173 ? ? OD2 A ASP 173 ? ? 124.01 118.30 5.71 0.90 N 4 1 CB A ASP 223 ? ? CG A ASP 223 ? ? OD2 A ASP 223 ? ? 124.44 118.30 6.14 0.90 N 5 1 CB A ASP 238 ? ? CG A ASP 238 ? ? OD2 A ASP 238 ? ? 124.93 118.30 6.63 0.90 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id THR _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 94 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -74.76 _pdbx_validate_torsion.psi 27.32 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 2001 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.04 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A GLN 5 ? A GLN 5 6 1 Y 1 A SER 6 ? A SER 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A PHE 8 ? A PHE 8 9 1 Y 1 A GLU 97 ? A GLU 97 10 1 Y 1 A LYS 98 ? A LYS 98 11 1 Y 1 A GLY 99 ? A GLY 99 12 1 Y 1 A ALA 100 ? A ALA 100 13 1 Y 1 A HIS 120 ? A HIS 120 14 1 Y 1 A ALA 121 ? A ALA 121 15 1 Y 1 A LYS 122 ? A LYS 122 16 1 Y 1 A SER 123 ? A SER 123 17 1 Y 1 A THR 124 ? A THR 124 18 1 Y 1 A ALA 125 ? A ALA 125 19 1 Y 1 A ALA 126 ? A ALA 126 20 1 Y 1 A SER 127 ? A SER 127 21 1 Y 1 A GLY 128 ? A GLY 128 22 1 Y 1 A GLN 129 ? A GLN 129 23 1 Y 1 A ARG 130 ? A ARG 130 24 1 Y 1 A THR 131 ? A THR 131 25 1 Y 1 A ASN 132 ? A ASN 132 26 1 Y 1 A GLY 133 ? A GLY 133 27 1 Y 1 A GLY 134 ? A GLY 134 28 1 Y 1 A ASP 135 ? A ASP 135 29 1 Y 1 A GLY 136 ? A GLY 136 30 1 Y 1 A ASP 137 ? A ASP 137 31 1 Y 1 A GLY 138 ? A GLY 138 32 1 Y 1 A ASP 139 ? A ASP 139 33 1 Y 1 A LEU 279 ? A LEU 279 34 1 Y 1 A ASP 280 ? A ASP 280 35 1 Y 1 A GLY 281 ? A GLY 281 36 1 Y 1 A LYS 282 ? A LYS 282 37 1 Y 1 A GLY 283 ? A GLY 283 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #