data_1OO3 # _entry.id 1OO3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1OO3 RCSB RCSB018490 WWPDB D_1000018490 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1OO4 _pdbx_database_related.details 'The same protein complexed to a peptide derived from PDGFr' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1OO3 _pdbx_database_status.recvd_initial_deposition_date 2003-03-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Guenther, U.L.' 1 'Weyrauch, B.' 2 'Schaffhausen, B.' 3 # _citation.id primary _citation.title ;Nuclear magnetic resonance structure of the P395S mutant of the N-SH2 domain of the p85 subunit of PI3 kinase: an SH2 domain with altered specificity ; _citation.journal_abbrev Biochemistry _citation.journal_volume 42 _citation.page_first 11120 _citation.page_last 11127 _citation.year 2003 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14503862 _citation.pdbx_database_id_DOI 10.1021/bi034353x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Guenther, U.L.' 1 primary 'Weyrauch, B.' 2 primary 'Zhang, X.' 3 primary 'Schaffhausen, B.' 4 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Phosphatidylinositol 3-kinase regulatory alpha subunit' _entity.formula_weight 12860.347 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation P395S _entity.pdbx_fragment 'p85 N-SH2' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PI3-kinase p85-alpha subunit' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKSIKIFHRDGKYGFSDSLTFNS VVELINHYRNESLAQYNPKLDVKLLYPVSKY ; _entity_poly.pdbx_seq_one_letter_code_can ;GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKSIKIFHRDGKYGFSDSLTFNS VVELINHYRNESLAQYNPKLDVKLLYPVSKY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 ASN n 1 4 ASN n 1 5 ASN n 1 6 MET n 1 7 SER n 1 8 LEU n 1 9 GLN n 1 10 ASP n 1 11 ALA n 1 12 GLU n 1 13 TRP n 1 14 TYR n 1 15 TRP n 1 16 GLY n 1 17 ASP n 1 18 ILE n 1 19 SER n 1 20 ARG n 1 21 GLU n 1 22 GLU n 1 23 VAL n 1 24 ASN n 1 25 GLU n 1 26 LYS n 1 27 LEU n 1 28 ARG n 1 29 ASP n 1 30 THR n 1 31 ALA n 1 32 ASP n 1 33 GLY n 1 34 THR n 1 35 PHE n 1 36 LEU n 1 37 VAL n 1 38 ARG n 1 39 ASP n 1 40 ALA n 1 41 SER n 1 42 THR n 1 43 LYS n 1 44 MET n 1 45 HIS n 1 46 GLY n 1 47 ASP n 1 48 TYR n 1 49 THR n 1 50 LEU n 1 51 THR n 1 52 LEU n 1 53 ARG n 1 54 LYS n 1 55 GLY n 1 56 GLY n 1 57 ASN n 1 58 ASN n 1 59 LYS n 1 60 SER n 1 61 ILE n 1 62 LYS n 1 63 ILE n 1 64 PHE n 1 65 HIS n 1 66 ARG n 1 67 ASP n 1 68 GLY n 1 69 LYS n 1 70 TYR n 1 71 GLY n 1 72 PHE n 1 73 SER n 1 74 ASP n 1 75 SER n 1 76 LEU n 1 77 THR n 1 78 PHE n 1 79 ASN n 1 80 SER n 1 81 VAL n 1 82 VAL n 1 83 GLU n 1 84 LEU n 1 85 ILE n 1 86 ASN n 1 87 HIS n 1 88 TYR n 1 89 ARG n 1 90 ASN n 1 91 GLU n 1 92 SER n 1 93 LEU n 1 94 ALA n 1 95 GLN n 1 96 TYR n 1 97 ASN n 1 98 PRO n 1 99 LYS n 1 100 LEU n 1 101 ASP n 1 102 VAL n 1 103 LYS n 1 104 LEU n 1 105 LEU n 1 106 TYR n 1 107 PRO n 1 108 VAL n 1 109 SER n 1 110 LYS n 1 111 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P85A_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNS VVELINHYRNESLAQYNPKLDVKLLYPVSKY ; _struct_ref.pdbx_align_begin 321 _struct_ref.pdbx_db_accession P23727 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1OO3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 111 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P23727 _struct_ref_seq.db_align_beg 321 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 431 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 111 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1OO3 SER A 60 ? UNP P23727 LEU 380 CONFLICT 60 1 1 1OO3 SER A 75 ? UNP P23727 PRO 395 ENGINEERED 75 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 HNCA-J 4 1 1 'HN(CO)CA' 5 1 1 'HCC(CO)NH' 6 1 1 'CC(CO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength '0.1M KCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.5mM P395S-15N,13C, 0.1M KCl' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AMX 500 2 ? Bruker DMX 600 3 ? Bruker DRX 800 # _pdbx_nmr_refine.entry_id 1OO3 _pdbx_nmr_refine.method 'distance geometry, simulated annealing' _pdbx_nmr_refine.details '1113 NOE-derived, distance constraints, 85 dihedral angle restraints' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1OO3 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1OO3 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1OO3 _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.5 'structure solution' Guentert 1 XWINNMR 2.5 collection BRUKER 2 DISCOVER 97.0 refinement 'MSI Inc.' 3 'Pronto 3D' 19990506 'data analysis' Kjaer 4 TALOS 1999.019.15.47 'structure solution' 'Cornilescu, Bax' 5 NMR2ST 1.1 'data analysis' Pristovsek 6 # _exptl.entry_id 1OO3 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1OO3 _struct.title 'P395S mutant of the p85 regulatory subunit of the N-terminal src homology 2 domain of PI3-Kinase' _struct.pdbx_descriptor 'Phosphatidylinositol 3-kinase regulatory alpha subunit' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1OO3 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'src homology 2 domain p85 regulatory subunit mutant, protein binding' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 24 ? THR A 30 ? ASN A 24 THR A 30 1 ? 7 HELX_P HELX_P2 2 SER A 92 ? TYR A 96 ? SER A 92 TYR A 96 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 34 ? VAL A 37 ? THR A 34 VAL A 37 A 2 LEU A 50 ? ARG A 53 ? LEU A 50 ARG A 53 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 36 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 36 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id THR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 51 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id THR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 51 # _database_PDB_matrix.entry_id 1OO3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1OO3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 TYR 111 111 111 TYR TYR A . n # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-03-25 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG1 A THR 34 ? ? O A TYR 106 ? ? 1.49 2 1 O A LEU 50 ? ? HG A SER 60 ? ? 1.52 3 1 O A LEU 76 ? ? HG1 A THR 77 ? ? 1.54 4 1 HG A SER 80 ? ? OE1 A GLU 83 ? ? 1.56 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.366 1.252 0.114 0.011 N 2 1 CD A GLU 21 ? ? OE2 A GLU 21 ? ? 1.365 1.252 0.113 0.011 N 3 1 CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.368 1.252 0.116 0.011 N 4 1 CD A GLU 25 ? ? OE2 A GLU 25 ? ? 1.368 1.252 0.116 0.011 N 5 1 CD A GLU 83 ? ? OE2 A GLU 83 ? ? 1.362 1.252 0.110 0.011 N 6 1 CD A GLU 91 ? ? OE2 A GLU 91 ? ? 1.364 1.252 0.112 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 10 ? ? CG A ASP 10 ? ? OD1 A ASP 10 ? ? 124.46 118.30 6.16 0.90 N 2 1 CB A ASP 10 ? ? CG A ASP 10 ? ? OD2 A ASP 10 ? ? 111.74 118.30 -6.56 0.90 N 3 1 CB A ASP 17 ? ? CG A ASP 17 ? ? OD1 A ASP 17 ? ? 124.76 118.30 6.46 0.90 N 4 1 CB A ASP 17 ? ? CG A ASP 17 ? ? OD2 A ASP 17 ? ? 111.82 118.30 -6.48 0.90 N 5 1 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH1 A ARG 20 ? ? 124.22 120.30 3.92 0.50 N 6 1 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH2 A ARG 20 ? ? 116.82 120.30 -3.48 0.50 N 7 1 NE A ARG 28 ? ? CZ A ARG 28 ? ? NH1 A ARG 28 ? ? 124.24 120.30 3.94 0.50 N 8 1 NE A ARG 28 ? ? CZ A ARG 28 ? ? NH2 A ARG 28 ? ? 116.96 120.30 -3.34 0.50 N 9 1 CB A ASP 29 ? ? CG A ASP 29 ? ? OD2 A ASP 29 ? ? 112.65 118.30 -5.65 0.90 N 10 1 NE A ARG 38 ? ? CZ A ARG 38 ? ? NH1 A ARG 38 ? ? 124.01 120.30 3.71 0.50 N 11 1 NE A ARG 38 ? ? CZ A ARG 38 ? ? NH2 A ARG 38 ? ? 116.94 120.30 -3.36 0.50 N 12 1 CB A ASP 39 ? ? CG A ASP 39 ? ? OD1 A ASP 39 ? ? 124.04 118.30 5.74 0.90 N 13 1 CB A ASP 39 ? ? CG A ASP 39 ? ? OD2 A ASP 39 ? ? 112.26 118.30 -6.04 0.90 N 14 1 ND1 A HIS 45 ? ? CE1 A HIS 45 ? ? NE2 A HIS 45 ? ? 120.09 111.50 8.59 1.30 N 15 1 NE A ARG 53 ? ? CZ A ARG 53 ? ? NH1 A ARG 53 ? ? 124.55 120.30 4.25 0.50 N 16 1 ND1 A HIS 65 ? ? CE1 A HIS 65 ? ? NE2 A HIS 65 ? ? 119.93 111.50 8.43 1.30 N 17 1 NE A ARG 66 ? ? CZ A ARG 66 ? ? NH1 A ARG 66 ? ? 124.30 120.30 4.00 0.50 N 18 1 NE A ARG 66 ? ? CZ A ARG 66 ? ? NH2 A ARG 66 ? ? 117.11 120.30 -3.19 0.50 N 19 1 CB A ASP 67 ? ? CG A ASP 67 ? ? OD2 A ASP 67 ? ? 112.58 118.30 -5.72 0.90 N 20 1 CB A ASP 74 ? ? CG A ASP 74 ? ? OD2 A ASP 74 ? ? 112.64 118.30 -5.66 0.90 N 21 1 ND1 A HIS 87 ? ? CE1 A HIS 87 ? ? NE2 A HIS 87 ? ? 119.95 111.50 8.45 1.30 N 22 1 NE A ARG 89 ? ? CZ A ARG 89 ? ? NH1 A ARG 89 ? ? 124.34 120.30 4.04 0.50 N 23 1 NE A ARG 89 ? ? CZ A ARG 89 ? ? NH2 A ARG 89 ? ? 116.83 120.30 -3.47 0.50 N 24 1 CB A ASP 101 ? ? CG A ASP 101 ? ? OD2 A ASP 101 ? ? 112.81 118.30 -5.49 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 7 ? ? -82.81 46.95 2 1 TRP A 13 ? ? -59.53 -2.71 3 1 ASP A 17 ? ? -160.69 89.87 4 1 ARG A 20 ? ? 71.04 -51.88 5 1 GLU A 21 ? ? -63.37 21.94 6 1 GLU A 22 ? ? 177.96 -53.16 7 1 LEU A 27 ? ? -36.97 -39.66 8 1 ALA A 31 ? ? 72.57 -106.35 9 1 LEU A 36 ? ? -164.68 112.98 10 1 MET A 44 ? ? -151.42 -78.94 11 1 HIS A 45 ? ? -152.03 -130.05 12 1 PHE A 64 ? ? 70.47 -179.53 13 1 ARG A 66 ? ? 25.22 55.88 14 1 ASP A 67 ? ? 69.51 -41.71 15 1 ASP A 74 ? ? -130.84 -116.32 16 1 THR A 77 ? ? 79.65 -51.98 17 1 ASN A 79 ? ? -154.01 -67.80 18 1 VAL A 82 ? ? -141.35 -44.61 19 1 ASN A 86 ? ? -169.55 97.62 20 1 TYR A 88 ? ? 67.80 -53.71 21 1 ALA A 94 ? ? -62.07 4.04 22 1 TYR A 96 ? ? -98.59 -60.89 23 1 ASP A 101 ? ? 50.95 178.53 24 1 VAL A 102 ? ? -135.47 -96.34 25 1 LEU A 104 ? ? -161.20 35.92 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 LEU A 8 ? ? GLN A 9 ? ? -146.12 2 1 TRP A 15 ? ? GLY A 16 ? ? -143.73 3 1 LYS A 26 ? ? LEU A 27 ? ? 147.48 #