data_1P1A # _entry.id 1P1A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1P1A pdb_00001p1a 10.2210/pdb1p1a/pdb RCSB RCSB018890 ? ? WWPDB D_1000018890 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1P1A _pdbx_database_status.recvd_initial_deposition_date 2003-04-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ryu, K.S.' 1 'Lee, K.J.' 2 'Bae, S.H.' 3 'Kim, B.K.' 4 'Kim, K.A.' 5 'Choi, B.S.' 6 # _citation.id primary _citation.title 'Binding surface mapping of intra- and interdomain interactions among hHR23B, ubiquitin, and polyubiquitin binding site 2 of S5a' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 278 _citation.page_first 36621 _citation.page_last 36627 _citation.year 2003 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12832454 _citation.pdbx_database_id_DOI 10.1074/jbc.M304628200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ryu, K.S.' 1 ? primary 'Lee, K.J.' 2 ? primary 'Bae, S.H.' 3 ? primary 'Kim, B.K.' 4 ? primary 'Kim, K.A.' 5 ? primary 'Choi, B.S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'UV excision repair protein RAD23 homolog B' _entity.formula_weight 9524.032 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Ubiquitin-like domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RAD23, hHR23B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKP KAVST ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKP KAVST ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLN n 1 6 VAL n 1 7 THR n 1 8 LEU n 1 9 LYS n 1 10 THR n 1 11 LEU n 1 12 GLN n 1 13 GLN n 1 14 GLN n 1 15 THR n 1 16 PHE n 1 17 LYS n 1 18 ILE n 1 19 ASP n 1 20 ILE n 1 21 ASP n 1 22 PRO n 1 23 GLU n 1 24 GLU n 1 25 THR n 1 26 VAL n 1 27 LYS n 1 28 ALA n 1 29 LEU n 1 30 LYS n 1 31 GLU n 1 32 LYS n 1 33 ILE n 1 34 GLU n 1 35 SER n 1 36 GLU n 1 37 LYS n 1 38 GLY n 1 39 LYS n 1 40 ASP n 1 41 ALA n 1 42 PHE n 1 43 PRO n 1 44 VAL n 1 45 ALA n 1 46 GLY n 1 47 GLN n 1 48 LYS n 1 49 LEU n 1 50 ILE n 1 51 TYR n 1 52 ALA n 1 53 GLY n 1 54 LYS n 1 55 ILE n 1 56 LEU n 1 57 ASN n 1 58 ASP n 1 59 ASP n 1 60 THR n 1 61 ALA n 1 62 LEU n 1 63 LYS n 1 64 GLU n 1 65 TYR n 1 66 LYS n 1 67 ILE n 1 68 ASP n 1 69 GLU n 1 70 LYS n 1 71 ASN n 1 72 PHE n 1 73 VAL n 1 74 VAL n 1 75 VAL n 1 76 MET n 1 77 VAL n 1 78 THR n 1 79 LYS n 1 80 PRO n 1 81 LYS n 1 82 ALA n 1 83 VAL n 1 84 SER n 1 85 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene hHR23B _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RD23B_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAV ST ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P54727 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1P1A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P54727 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 82 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 85 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1P1A GLY A 1 ? UNP P54727 ? ? 'cloning artifact' 1 1 1 1P1A SER A 2 ? UNP P54727 ? ? 'cloning artifact' 2 2 1 1P1A HIS A 3 ? UNP P54727 ? ? 'cloning artifact' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 'CBCACONH, HNCACB, CCC-TOC-NNH, HCC-TOC-NNH, HNCO' 2 2 1 '3D_15N-separated_TOCSY, Intensity-modulated 15N HSQC' 3 3 1 '2D NOESY' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 303 ambient 6.0 '50mM sodium phosphate + 100mM sodium chloride' ? K 2 303 ambient 6.0 '50mM sodium phosphate + 100mM sodium chloride' ? K 3 303 ambient 6.0 '50mM sodium phosphate + 100mM sodium chloride' ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2mM UbL domain 15N,13C; 50mM Sodium Phosphate Buffer with 100mM NaCl' '92.5% H2O, 7.5% D2O' 2 '2mM UbL domain 15N; 50mM Sodium Phosphate Buffer with 100mM NaCl' '92.5% H2O, 7.5% D2O' 3 '2mM UbL domain non-labeled; 50mM Sodium Phosphate Buffer with 100mM NaCl' '100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1P1A _pdbx_nmr_refine.method 'Cyana-Automated NOE assignment, Torsion angle dynamics; Amber-Simulated annealing, Cyana output is the initial structure' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1P1A _pdbx_nmr_details.text ;Distance Restraints From 2D D2O-NOESY, 3D 15N-NOESY-HSQC, Angle Restaints From Intensity-modulated 15N HSQC and Talos Chemical shift analysis ; # _pdbx_nmr_ensemble.entry_id 1P1A _pdbx_nmr_ensemble.conformers_calculated_total_number 60 _pdbx_nmr_ensemble.conformers_submitted_total_number 14 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1P1A _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal CYANA 1.0.6 'structure solution' ? 1 Amber 7 refinement ? 2 # _exptl.entry_id 1P1A _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1P1A _struct.title 'NMR structure of ubiquitin-like domain of hHR23B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1P1A _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'UBIQUITIN-LIKE, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 25 ? GLY A 38 ? THR A 25 GLY A 38 1 ? 14 HELX_P HELX_P2 2 PRO A 43 ? ALA A 45 ? PRO A 43 ALA A 45 5 ? 3 HELX_P HELX_P3 3 ALA A 61 ? LYS A 66 ? ALA A 61 LYS A 66 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LYS 79 A . ? LYS 79 A PRO 80 A ? PRO 80 A 1 -11.20 2 THR 78 A . ? THR 78 A LYS 79 A ? LYS 79 A 4 -12.04 3 LYS 79 A . ? LYS 79 A PRO 80 A ? PRO 80 A 4 -6.56 4 SER 84 A . ? SER 84 A THR 85 A ? THR 85 A 13 -6.21 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 15 ? ILE A 20 ? THR A 15 ILE A 20 A 2 MET A 4 ? THR A 10 ? MET A 4 THR A 10 A 3 PHE A 72 ? VAL A 77 ? PHE A 72 VAL A 77 A 4 GLN A 47 ? TYR A 51 ? GLN A 47 TYR A 51 A 5 LYS A 54 ? ILE A 55 ? LYS A 54 ILE A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 20 ? O ILE A 20 N MET A 4 ? N MET A 4 A 2 3 N LYS A 9 ? N LYS A 9 O VAL A 73 ? O VAL A 73 A 3 4 O VAL A 74 ? O VAL A 74 N ILE A 50 ? N ILE A 50 A 4 5 N TYR A 51 ? N TYR A 51 O LYS A 54 ? O LYS A 54 # _database_PDB_matrix.entry_id 1P1A _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1P1A _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 THR 85 85 85 THR THR A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-07-13 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 11 ? ? -62.77 1.99 2 1 TYR A 51 ? ? -102.49 78.88 3 1 LYS A 79 ? ? 112.67 -43.14 4 2 SER A 2 ? ? -142.99 39.58 5 2 ALA A 52 ? ? 49.96 23.72 6 4 HIS A 3 ? ? 60.26 163.21 7 4 LYS A 79 ? ? -149.06 -34.33 8 4 LYS A 81 ? ? 58.67 -43.65 9 5 LEU A 11 ? ? -59.46 0.97 10 5 ALA A 52 ? ? 49.51 25.37 11 5 LYS A 79 ? ? -12.14 112.99 12 6 ALA A 52 ? ? 56.17 15.27 13 7 LYS A 79 ? ? -131.85 -47.17 14 8 SER A 2 ? ? -150.33 2.63 15 8 LEU A 11 ? ? -66.81 1.94 16 8 VAL A 83 ? ? -140.13 -11.26 17 9 ALA A 52 ? ? 49.40 26.22 18 9 VAL A 83 ? ? -140.12 -1.94 19 10 LEU A 11 ? ? -63.37 7.30 20 10 ALA A 82 ? ? -68.41 99.93 21 10 VAL A 83 ? ? -140.59 -33.19 22 11 SER A 2 ? ? -158.61 -23.77 23 11 HIS A 3 ? ? 58.55 146.95 24 11 ALA A 82 ? ? -69.13 99.69 25 12 ALA A 41 ? ? -131.69 -36.84 26 12 LYS A 79 ? ? -145.14 -44.32 27 13 TYR A 51 ? ? -99.72 -61.20 28 13 ALA A 52 ? ? -140.93 25.24 29 14 ALA A 52 ? ? 55.92 12.49 #