data_1P36 # _entry.id 1P36 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.376 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1P36 pdb_00001p36 10.2210/pdb1p36/pdb RCSB RCSB018951 ? ? WWPDB D_1000018951 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1P2L _pdbx_database_related.details 'T4 Lysozyme Core Repacking Mutant V87I/TA' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1P36 _pdbx_database_status.recvd_initial_deposition_date 2003-04-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mooers, B.H.' 1 'Datta, D.' 2 'Baase, W.A.' 3 'Zollars, E.S.' 4 'Mayo, S.L.' 5 'Matthews, B.W.' 6 # _citation.id primary _citation.title 'Repacking the Core of T4 lysozyme by automated design' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 332 _citation.page_first 741 _citation.page_last 756 _citation.year 2003 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12963380 _citation.pdbx_database_id_DOI '10.1016/S0022-2836(03)00856-8' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mooers, B.H.' 1 ? primary 'Datta, D.' 2 ? primary 'Baase, W.A.' 3 ? primary 'Zollars, E.S.' 4 ? primary 'Mayo, S.L.' 5 ? primary 'Matthews, B.W.' 6 ? # _cell.entry_id 1P36 _cell.length_a 59.843 _cell.length_b 59.843 _cell.length_c 95.579 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1P36 _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man LYSOZYME 18614.336 1 3.2.1.17 'C54T, C97A, I100V' ? ? 2 non-polymer syn 'POTASSIUM ION' 39.098 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 4 non-polymer syn BETA-MERCAPTOETHANOL 78.133 1 ? ? ? ? 5 water nat water 18.015 212 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Lysis protein, Muramidase, Endolysin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRAALVNMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA YKNL ; _entity_poly.pdbx_seq_one_letter_code_can ;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRAALVNMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA YKNL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 ILE n 1 4 PHE n 1 5 GLU n 1 6 MET n 1 7 LEU n 1 8 ARG n 1 9 ILE n 1 10 ASP n 1 11 GLU n 1 12 GLY n 1 13 LEU n 1 14 ARG n 1 15 LEU n 1 16 LYS n 1 17 ILE n 1 18 TYR n 1 19 LYS n 1 20 ASP n 1 21 THR n 1 22 GLU n 1 23 GLY n 1 24 TYR n 1 25 TYR n 1 26 THR n 1 27 ILE n 1 28 GLY n 1 29 ILE n 1 30 GLY n 1 31 HIS n 1 32 LEU n 1 33 LEU n 1 34 THR n 1 35 LYS n 1 36 SER n 1 37 PRO n 1 38 SER n 1 39 LEU n 1 40 ASN n 1 41 ALA n 1 42 ALA n 1 43 LYS n 1 44 SER n 1 45 GLU n 1 46 LEU n 1 47 ASP n 1 48 LYS n 1 49 ALA n 1 50 ILE n 1 51 GLY n 1 52 ARG n 1 53 ASN n 1 54 THR n 1 55 ASN n 1 56 GLY n 1 57 VAL n 1 58 ILE n 1 59 THR n 1 60 LYS n 1 61 ASP n 1 62 GLU n 1 63 ALA n 1 64 GLU n 1 65 LYS n 1 66 LEU n 1 67 PHE n 1 68 ASN n 1 69 GLN n 1 70 ASP n 1 71 VAL n 1 72 ASP n 1 73 ALA n 1 74 ALA n 1 75 VAL n 1 76 ARG n 1 77 GLY n 1 78 ILE n 1 79 LEU n 1 80 ARG n 1 81 ASN n 1 82 ALA n 1 83 LYS n 1 84 LEU n 1 85 LYS n 1 86 PRO n 1 87 VAL n 1 88 TYR n 1 89 ASP n 1 90 SER n 1 91 LEU n 1 92 ASP n 1 93 ALA n 1 94 VAL n 1 95 ARG n 1 96 ARG n 1 97 ALA n 1 98 ALA n 1 99 LEU n 1 100 VAL n 1 101 ASN n 1 102 MET n 1 103 VAL n 1 104 PHE n 1 105 GLN n 1 106 MET n 1 107 GLY n 1 108 GLU n 1 109 THR n 1 110 GLY n 1 111 VAL n 1 112 ALA n 1 113 GLY n 1 114 PHE n 1 115 THR n 1 116 ASN n 1 117 SER n 1 118 LEU n 1 119 ARG n 1 120 MET n 1 121 LEU n 1 122 GLN n 1 123 GLN n 1 124 LYS n 1 125 ARG n 1 126 TRP n 1 127 ASP n 1 128 GLU n 1 129 ALA n 1 130 ALA n 1 131 VAL n 1 132 ASN n 1 133 LEU n 1 134 ALA n 1 135 LYS n 1 136 SER n 1 137 ARG n 1 138 TRP n 1 139 TYR n 1 140 ASN n 1 141 GLN n 1 142 THR n 1 143 PRO n 1 144 ASN n 1 145 ARG n 1 146 ALA n 1 147 LYS n 1 148 ARG n 1 149 VAL n 1 150 ILE n 1 151 THR n 1 152 THR n 1 153 PHE n 1 154 ARG n 1 155 THR n 1 156 GLY n 1 157 THR n 1 158 TRP n 1 159 ASP n 1 160 ALA n 1 161 TYR n 1 162 LYS n 1 163 ASN n 1 164 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'T4-like viruses' _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Enterobacteria phage T4 sensu lato' _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage T4' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10665 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain RR1 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PHS1403 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LYS_BPT4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA YKNL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P00720 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1P36 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 164 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00720 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 164 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 164 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1P36 THR A 54 ? UNP P00720 CYS 54 'engineered mutation' 54 1 1 1P36 ALA A 97 ? UNP P00720 CYS 97 'engineered mutation' 97 2 1 1P36 VAL A 100 ? UNP P00720 ILE 100 'engineered mutation' 100 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BME non-polymer . BETA-MERCAPTOETHANOL ? 'C2 H6 O S' 78.133 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1P36 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.69 _exptl_crystal.density_percent_sol 53.8 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.7 _exptl_crystal_grow.pdbx_details 'Potassium PHOSPHATE, Sodium Phosphate, NaCl, BME, pH 6.7, VAPOR DIFFUSION, HANGING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 2001-03-14 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 1P36 _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_sigma_I 0.0 _reflns.d_resolution_high 1.45 _reflns.d_resolution_low 27.11 _reflns.number_all 35041 _reflns.number_obs 35041 _reflns.percent_possible_obs 97.9 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value 0.06 _reflns.pdbx_netI_over_sigmaI 8.1 _reflns.B_iso_Wilson_estimate 15.7 _reflns.pdbx_redundancy 7.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.45 _reflns_shell.d_res_low 1.53 _reflns_shell.percent_possible_all 85.8 _reflns_shell.Rmerge_I_obs 0.238 _reflns_shell.pdbx_Rsym_value 0.238 _reflns_shell.meanI_over_sigI_obs 3.1 _reflns_shell.pdbx_redundancy 2.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 4398 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1P36 _refine.ls_d_res_high 1.45 _refine.ls_d_res_low 27 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_I 0.0 _refine.ls_number_reflns_all 33265 _refine.ls_number_reflns_obs 33265 _refine.ls_number_reflns_R_free 1746 _refine.ls_percent_reflns_obs 98. _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.189 _refine.ls_R_factor_R_work 0.187 _refine.ls_R_factor_R_free 0.226 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free 5 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB ENTRY 1L63' _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values TNT _refine.solvent_model_details TNT _refine.solvent_model_param_bsol 194.60 _refine.solvent_model_param_ksol .87 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model TNT _refine.B_iso_mean ? _refine.aniso_B[1][1] 0.75 _refine.aniso_B[1][2] 0.75 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.75 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -1.50 _refine.details ;The working set and test set were not combined in the last cycles of refinement. The overall anisotropic B values are as follows: B11 = 0.75, B12 = 0.75, B13 = 0.00, B22 = 0.75, B23 = 0.00, B33 = -1.50 ; _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1314 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 219 _refine_hist.number_atoms_total 1540 _refine_hist.d_res_high 1.45 _refine_hist.d_res_low 27 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_angle_deg 2.428 ? ? ? 'X-RAY DIFFRACTION' ? t_bond_d 0.015 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1P36 _struct.title 'T4 LYOSZYME CORE REPACKING MUTANT I100V/TA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1P36 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;HYDROLASE (O-GLYCOSYL), T4 LYSOZYME, DESIGNED CORE MUTANT, AUTOMATED PROTEIN DESIGN, PROTEIN ENGINEERING, PROTEIN FOLDING, PROTEIN STABILITY, CORE REPACKING, BACK REVERTANT, DEAD-END ELIMINATION THEOREM, SIDE-CHAIN PACKING, OPTIMIZED ROTAMER COMBINATIONS, ORBIT, HYDROLASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 2 ? GLY A 12 ? ASN A 2 GLY A 12 1 ? 11 HELX_P HELX_P2 2 SER A 38 ? GLY A 51 ? SER A 38 GLY A 51 1 ? 14 HELX_P HELX_P3 3 THR A 59 ? ARG A 80 ? THR A 59 ARG A 80 1 ? 22 HELX_P HELX_P4 4 LEU A 84 ? LEU A 91 ? LEU A 84 LEU A 91 1 ? 8 HELX_P HELX_P5 5 ASP A 92 ? GLY A 113 ? ASP A 92 GLY A 113 1 ? 22 HELX_P HELX_P6 6 PHE A 114 ? GLN A 123 ? PHE A 114 GLN A 123 1 ? 10 HELX_P HELX_P7 7 ARG A 125 ? ALA A 134 ? ARG A 125 ALA A 134 1 ? 10 HELX_P HELX_P8 8 SER A 136 ? THR A 142 ? SER A 136 THR A 142 1 ? 7 HELX_P HELX_P9 9 THR A 142 ? GLY A 156 ? THR A 142 GLY A 156 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 11 O ? ? ? 1_555 B K . K ? ? A GLU 11 A K 972 1_555 ? ? ? ? ? ? ? 2.933 ? ? metalc2 metalc ? ? A GLU 11 OE2 ? ? ? 1_555 B K . K ? ? A GLU 11 A K 972 1_555 ? ? ? ? ? ? ? 3.047 ? ? metalc3 metalc ? ? A TYR 18 OH ? ? ? 1_555 B K . K ? ? A TYR 18 A K 972 1_555 ? ? ? ? ? ? ? 2.995 ? ? metalc4 metalc ? ? F HOH . O ? ? ? 1_555 B K . K ? ? A HOH 204 A K 972 1_555 ? ? ? ? ? ? ? 2.957 ? ? metalc5 metalc ? ? F HOH . O ? ? ? 1_555 B K . K ? ? A HOH 207 A K 972 1_555 ? ? ? ? ? ? ? 2.977 ? ? metalc6 metalc ? ? F HOH . O ? ? ? 1_555 B K . K ? ? A HOH 304 A K 972 1_555 ? ? ? ? ? ? ? 2.955 ? ? metalc7 metalc ? ? F HOH . O ? ? ? 1_555 B K . K ? ? A HOH 405 A K 972 1_555 ? ? ? ? ? ? ? 3.398 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 14 ? LYS A 19 ? ARG A 14 LYS A 19 A 2 TYR A 25 ? GLY A 28 ? TYR A 25 GLY A 28 A 3 HIS A 31 ? LEU A 32 ? HIS A 31 LEU A 32 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 18 ? N TYR A 18 O THR A 26 ? O THR A 26 A 2 3 N ILE A 27 ? N ILE A 27 O HIS A 31 ? O HIS A 31 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A K 972 ? 5 'BINDING SITE FOR RESIDUE K A 972' AC2 Software A CL 973 ? 6 'BINDING SITE FOR RESIDUE CL A 973' AC3 Software A CL 978 ? 3 'BINDING SITE FOR RESIDUE CL A 978' AC4 Software A BME 966 ? 2 'BINDING SITE FOR RESIDUE BME A 966' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLU A 11 ? GLU A 11 . ? 1_555 ? 2 AC1 5 TYR A 18 ? TYR A 18 . ? 1_555 ? 3 AC1 5 HOH F . ? HOH A 204 . ? 1_555 ? 4 AC1 5 HOH F . ? HOH A 207 . ? 1_555 ? 5 AC1 5 HOH F . ? HOH A 304 . ? 1_555 ? 6 AC2 6 LYS A 124 ? LYS A 124 . ? 4_655 ? 7 AC2 6 THR A 142 ? THR A 142 . ? 1_555 ? 8 AC2 6 ASN A 144 ? ASN A 144 . ? 1_555 ? 9 AC2 6 ARG A 145 ? ARG A 145 . ? 1_555 ? 10 AC2 6 HOH F . ? HOH A 209 . ? 1_555 ? 11 AC2 6 HOH F . ? HOH A 291 . ? 1_555 ? 12 AC3 3 HIS A 31 ? HIS A 31 . ? 1_555 ? 13 AC3 3 LYS A 135 ? LYS A 135 . ? 3_665 ? 14 AC3 3 HOH F . ? HOH A 220 . ? 3_665 ? 15 AC4 2 ILE A 3 ? ILE A 3 . ? 5_555 ? 16 AC4 2 HOH F . ? HOH A 500 . ? 5_555 ? # _database_PDB_matrix.entry_id 1P36 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1P36 _atom_sites.fract_transf_matrix[1][1] 0.016710 _atom_sites.fract_transf_matrix[1][2] 0.009648 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019295 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010463 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL K N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 TRP 138 138 138 TRP TRP A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 TRP 158 158 158 TRP TRP A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 ASN 163 163 163 ASN ASN A . n A 1 164 LEU 164 164 164 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 K 1 972 972 K K A . C 3 CL 1 973 973 CL CL A . D 3 CL 1 978 978 CL CL A . E 4 BME 1 966 966 BME BME A . F 5 HOH 1 171 171 HOH HOH A . F 5 HOH 2 172 172 HOH HOH A . F 5 HOH 3 174 174 HOH HOH A . F 5 HOH 4 175 175 HOH HOH A . F 5 HOH 5 177 177 HOH HOH A . F 5 HOH 6 179 179 HOH HOH A . F 5 HOH 7 180 180 HOH HOH A . F 5 HOH 8 181 181 HOH HOH A . F 5 HOH 9 182 182 HOH HOH A . F 5 HOH 10 183 183 HOH HOH A . F 5 HOH 11 184 184 HOH HOH A . F 5 HOH 12 185 185 HOH HOH A . F 5 HOH 13 186 186 HOH HOH A . F 5 HOH 14 187 187 HOH HOH A . F 5 HOH 15 188 188 HOH HOH A . F 5 HOH 16 189 189 HOH HOH A . F 5 HOH 17 190 190 HOH HOH A . F 5 HOH 18 191 191 HOH HOH A . F 5 HOH 19 192 192 HOH HOH A . F 5 HOH 20 193 193 HOH HOH A . F 5 HOH 21 194 194 HOH HOH A . F 5 HOH 22 195 195 HOH HOH A . F 5 HOH 23 196 196 HOH HOH A . F 5 HOH 24 197 197 HOH HOH A . F 5 HOH 25 200 200 HOH HOH A . F 5 HOH 26 202 202 HOH HOH A . F 5 HOH 27 204 204 HOH HOH A . F 5 HOH 28 206 206 HOH HOH A . F 5 HOH 29 207 207 HOH HOH A . F 5 HOH 30 208 208 HOH HOH A . F 5 HOH 31 209 209 HOH HOH A . F 5 HOH 32 211 211 HOH HOH A . F 5 HOH 33 213 213 HOH HOH A . F 5 HOH 34 214 214 HOH HOH A . F 5 HOH 35 215 215 HOH HOH A . F 5 HOH 36 216 216 HOH HOH A . F 5 HOH 37 217 217 HOH HOH A . F 5 HOH 38 218 218 HOH HOH A . F 5 HOH 39 219 219 HOH HOH A . F 5 HOH 40 220 220 HOH HOH A . F 5 HOH 41 221 221 HOH HOH A . F 5 HOH 42 222 222 HOH HOH A . F 5 HOH 43 224 224 HOH HOH A . F 5 HOH 44 225 225 HOH HOH A . F 5 HOH 45 226 226 HOH HOH A . F 5 HOH 46 227 227 HOH HOH A . F 5 HOH 47 228 228 HOH HOH A . F 5 HOH 48 230 230 HOH HOH A . F 5 HOH 49 231 231 HOH HOH A . F 5 HOH 50 232 232 HOH HOH A . F 5 HOH 51 233 233 HOH HOH A . F 5 HOH 52 234 234 HOH HOH A . F 5 HOH 53 236 236 HOH HOH A . F 5 HOH 54 237 237 HOH HOH A . F 5 HOH 55 238 238 HOH HOH A . F 5 HOH 56 240 240 HOH HOH A . F 5 HOH 57 242 242 HOH HOH A . F 5 HOH 58 244 244 HOH HOH A . F 5 HOH 59 245 245 HOH HOH A . F 5 HOH 60 246 246 HOH HOH A . F 5 HOH 61 247 247 HOH HOH A . F 5 HOH 62 249 249 HOH HOH A . F 5 HOH 63 250 250 HOH HOH A . F 5 HOH 64 251 251 HOH HOH A . F 5 HOH 65 253 253 HOH HOH A . F 5 HOH 66 254 254 HOH HOH A . F 5 HOH 67 256 256 HOH HOH A . F 5 HOH 68 257 257 HOH HOH A . F 5 HOH 69 258 258 HOH HOH A . F 5 HOH 70 259 259 HOH HOH A . F 5 HOH 71 260 260 HOH HOH A . F 5 HOH 72 261 261 HOH HOH A . F 5 HOH 73 266 266 HOH HOH A . F 5 HOH 74 269 269 HOH HOH A . F 5 HOH 75 270 270 HOH HOH A . F 5 HOH 76 272 272 HOH HOH A . F 5 HOH 77 273 273 HOH HOH A . F 5 HOH 78 274 274 HOH HOH A . F 5 HOH 79 276 276 HOH HOH A . F 5 HOH 80 278 278 HOH HOH A . F 5 HOH 81 279 279 HOH HOH A . F 5 HOH 82 281 281 HOH HOH A . F 5 HOH 83 282 282 HOH HOH A . F 5 HOH 84 283 283 HOH HOH A . F 5 HOH 85 284 284 HOH HOH A . F 5 HOH 86 286 286 HOH HOH A . F 5 HOH 87 288 288 HOH HOH A . F 5 HOH 88 291 291 HOH HOH A . F 5 HOH 89 292 292 HOH HOH A . F 5 HOH 90 294 294 HOH HOH A . F 5 HOH 91 295 295 HOH HOH A . F 5 HOH 92 296 296 HOH HOH A . F 5 HOH 93 297 297 HOH HOH A . F 5 HOH 94 299 299 HOH HOH A . F 5 HOH 95 301 301 HOH HOH A . F 5 HOH 96 304 304 HOH HOH A . F 5 HOH 97 306 306 HOH HOH A . F 5 HOH 98 308 308 HOH HOH A . F 5 HOH 99 311 311 HOH HOH A . F 5 HOH 100 312 312 HOH HOH A . F 5 HOH 101 313 313 HOH HOH A . F 5 HOH 102 314 314 HOH HOH A . F 5 HOH 103 315 315 HOH HOH A . F 5 HOH 104 317 317 HOH HOH A . F 5 HOH 105 319 319 HOH HOH A . F 5 HOH 106 320 320 HOH HOH A . F 5 HOH 107 322 322 HOH HOH A . F 5 HOH 108 401 401 HOH HOH A . F 5 HOH 109 402 402 HOH HOH A . F 5 HOH 110 405 405 HOH HOH A . F 5 HOH 111 406 406 HOH HOH A . F 5 HOH 112 407 407 HOH HOH A . F 5 HOH 113 408 408 HOH HOH A . F 5 HOH 114 409 409 HOH HOH A . F 5 HOH 115 410 410 HOH HOH A . F 5 HOH 116 411 411 HOH HOH A . F 5 HOH 117 412 412 HOH HOH A . F 5 HOH 118 413 413 HOH HOH A . F 5 HOH 119 414 414 HOH HOH A . F 5 HOH 120 415 415 HOH HOH A . F 5 HOH 121 417 417 HOH HOH A . F 5 HOH 122 418 418 HOH HOH A . F 5 HOH 123 419 419 HOH HOH A . F 5 HOH 124 420 420 HOH HOH A . F 5 HOH 125 422 422 HOH HOH A . F 5 HOH 126 424 424 HOH HOH A . F 5 HOH 127 425 425 HOH HOH A . F 5 HOH 128 426 426 HOH HOH A . F 5 HOH 129 427 427 HOH HOH A . F 5 HOH 130 428 428 HOH HOH A . F 5 HOH 131 429 429 HOH HOH A . F 5 HOH 132 430 430 HOH HOH A . F 5 HOH 133 431 431 HOH HOH A . F 5 HOH 134 432 432 HOH HOH A . F 5 HOH 135 433 433 HOH HOH A . F 5 HOH 136 434 434 HOH HOH A . F 5 HOH 137 435 435 HOH HOH A . F 5 HOH 138 436 436 HOH HOH A . F 5 HOH 139 437 437 HOH HOH A . F 5 HOH 140 440 440 HOH HOH A . F 5 HOH 141 441 441 HOH HOH A . F 5 HOH 142 442 442 HOH HOH A . F 5 HOH 143 443 443 HOH HOH A . F 5 HOH 144 444 444 HOH HOH A . F 5 HOH 145 445 445 HOH HOH A . F 5 HOH 146 449 449 HOH HOH A . F 5 HOH 147 450 450 HOH HOH A . F 5 HOH 148 451 451 HOH HOH A . F 5 HOH 149 454 454 HOH HOH A . F 5 HOH 150 456 456 HOH HOH A . F 5 HOH 151 457 457 HOH HOH A . F 5 HOH 152 458 458 HOH HOH A . F 5 HOH 153 459 459 HOH HOH A . F 5 HOH 154 461 461 HOH HOH A . F 5 HOH 155 462 462 HOH HOH A . F 5 HOH 156 463 463 HOH HOH A . F 5 HOH 157 466 466 HOH HOH A . F 5 HOH 158 467 467 HOH HOH A . F 5 HOH 159 468 468 HOH HOH A . F 5 HOH 160 469 469 HOH HOH A . F 5 HOH 161 473 473 HOH HOH A . F 5 HOH 162 474 474 HOH HOH A . F 5 HOH 163 475 475 HOH HOH A . F 5 HOH 164 477 477 HOH HOH A . F 5 HOH 165 491 491 HOH HOH A . F 5 HOH 166 494 494 HOH HOH A . F 5 HOH 167 495 495 HOH HOH A . F 5 HOH 168 496 496 HOH HOH A . F 5 HOH 169 497 497 HOH HOH A . F 5 HOH 170 498 498 HOH HOH A . F 5 HOH 171 499 499 HOH HOH A . F 5 HOH 172 500 500 HOH HOH A . F 5 HOH 173 501 501 HOH HOH A . F 5 HOH 174 503 503 HOH HOH A . F 5 HOH 175 504 504 HOH HOH A . F 5 HOH 176 505 505 HOH HOH A . F 5 HOH 177 507 507 HOH HOH A . F 5 HOH 178 508 508 HOH HOH A . F 5 HOH 179 509 509 HOH HOH A . F 5 HOH 180 510 510 HOH HOH A . F 5 HOH 181 512 512 HOH HOH A . F 5 HOH 182 513 513 HOH HOH A . F 5 HOH 183 514 514 HOH HOH A . F 5 HOH 184 515 515 HOH HOH A . F 5 HOH 185 516 516 HOH HOH A . F 5 HOH 186 517 517 HOH HOH A . F 5 HOH 187 518 518 HOH HOH A . F 5 HOH 188 519 519 HOH HOH A . F 5 HOH 189 521 521 HOH HOH A . F 5 HOH 190 522 522 HOH HOH A . F 5 HOH 191 523 523 HOH HOH A . F 5 HOH 192 524 524 HOH HOH A . F 5 HOH 193 525 525 HOH HOH A . F 5 HOH 194 526 526 HOH HOH A . F 5 HOH 195 527 527 HOH HOH A . F 5 HOH 196 529 529 HOH HOH A . F 5 HOH 197 531 531 HOH HOH A . F 5 HOH 198 533 533 HOH HOH A . F 5 HOH 199 534 534 HOH HOH A . F 5 HOH 200 535 535 HOH HOH A . F 5 HOH 201 536 536 HOH HOH A . F 5 HOH 202 537 537 HOH HOH A . F 5 HOH 203 538 538 HOH HOH A . F 5 HOH 204 542 542 HOH HOH A . F 5 HOH 205 543 543 HOH HOH A . F 5 HOH 206 544 544 HOH HOH A . F 5 HOH 207 546 546 HOH HOH A . F 5 HOH 208 552 552 HOH HOH A . F 5 HOH 209 553 553 HOH HOH A . F 5 HOH 210 554 554 HOH HOH A . F 5 HOH 211 555 555 HOH HOH A . F 5 HOH 212 558 558 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 OE2 ? A GLU 11 ? A GLU 11 ? 1_555 86.0 ? 2 O ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 OH ? A TYR 18 ? A TYR 18 ? 1_555 83.6 ? 3 OE2 ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 OH ? A TYR 18 ? A TYR 18 ? 1_555 115.0 ? 4 O ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 204 ? 1_555 130.6 ? 5 OE2 ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 204 ? 1_555 58.4 ? 6 OH ? A TYR 18 ? A TYR 18 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 204 ? 1_555 82.5 ? 7 O ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 207 ? 1_555 80.9 ? 8 OE2 ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 207 ? 1_555 75.1 ? 9 OH ? A TYR 18 ? A TYR 18 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 207 ? 1_555 160.9 ? 10 O ? F HOH . ? A HOH 204 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 207 ? 1_555 116.2 ? 11 O ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 304 ? 1_555 125.0 ? 12 OE2 ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 304 ? 1_555 122.0 ? 13 OH ? A TYR 18 ? A TYR 18 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 304 ? 1_555 116.1 ? 14 O ? F HOH . ? A HOH 204 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 304 ? 1_555 103.6 ? 15 O ? F HOH . ? A HOH 207 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 304 ? 1_555 65.5 ? 16 O ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 120.2 ? 17 OE2 ? A GLU 11 ? A GLU 11 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 50.7 ? 18 OH ? A TYR 18 ? A TYR 18 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 146.5 ? 19 O ? F HOH . ? A HOH 204 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 64.2 ? 20 O ? F HOH . ? A HOH 207 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 52.6 ? 21 O ? F HOH . ? A HOH 304 ? 1_555 K ? B K . ? A K 972 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 71.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-10-07 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 5 'Structure model' 1 4 2023-08-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_conn_angle 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif 5 4 'Structure model' struct_site 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_ref_seq_dif.details' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOSFLM 'data reduction' . ? 1 SCALA 'data scaling' . ? 2 TNT refinement . ? 3 CCP4 'data scaling' '(SCALA)' ? 4 TNT phasing . ? 5 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 47 ? ? CG A ASP 47 ? ? OD1 A ASP 47 ? ? 123.98 118.30 5.68 0.90 N 2 1 CB A ASP 47 ? ? CG A ASP 47 ? ? OD2 A ASP 47 ? ? 112.02 118.30 -6.28 0.90 N 3 1 O A THR 54 ? ? C A THR 54 ? ? N A ASN 55 ? ? 111.47 122.70 -11.23 1.60 Y 4 1 C A THR 54 ? ? N A ASN 55 ? ? CA A ASN 55 ? ? 103.25 121.70 -18.45 2.50 Y 5 1 N A ASN 55 ? ? CA A ASN 55 ? ? CB A ASN 55 ? ? 121.86 110.60 11.26 1.80 N 6 1 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 123.93 120.30 3.63 0.50 N 7 1 NE A ARG 119 ? ? CZ A ARG 119 ? ? NH1 A ARG 119 ? ? 127.48 120.30 7.18 0.50 N 8 1 NE A ARG 119 ? ? CZ A ARG 119 ? ? NH2 A ARG 119 ? ? 115.23 120.30 -5.07 0.50 N 9 1 CB A ASP 127 ? ? CG A ASP 127 ? ? OD1 A ASP 127 ? ? 125.57 118.30 7.27 0.90 N 10 1 NE A ARG 145 ? ? CZ A ARG 145 ? ? NH1 A ARG 145 ? ? 124.32 120.30 4.02 0.50 N 11 1 NE A ARG 145 ? ? CZ A ARG 145 ? ? NH2 A ARG 145 ? ? 117.23 120.30 -3.07 0.50 N 12 1 NE A ARG 154 ? ? CZ A ARG 154 ? ? NH1 A ARG 154 ? ? 123.48 120.30 3.18 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 20 ? ? -76.60 -169.26 2 1 ILE A 29 ? ? -103.06 76.07 3 1 ASN A 163 ? ? 80.82 31.19 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id CA _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id ASN _pdbx_validate_chiral.auth_seq_id 55 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details PLANAR _pdbx_validate_chiral.omega . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BME C1 C N N 74 BME C2 C N N 75 BME O1 O N N 76 BME S2 S N N 77 BME H11 H N N 78 BME H12 H N N 79 BME H21 H N N 80 BME H22 H N N 81 BME HO1 H N N 82 BME HS2 H N N 83 CL CL CL N N 84 CYS N N N N 85 CYS CA C N R 86 CYS C C N N 87 CYS O O N N 88 CYS CB C N N 89 CYS SG S N N 90 CYS OXT O N N 91 CYS H H N N 92 CYS H2 H N N 93 CYS HA H N N 94 CYS HB2 H N N 95 CYS HB3 H N N 96 CYS HG H N N 97 CYS HXT H N N 98 GLN N N N N 99 GLN CA C N S 100 GLN C C N N 101 GLN O O N N 102 GLN CB C N N 103 GLN CG C N N 104 GLN CD C N N 105 GLN OE1 O N N 106 GLN NE2 N N N 107 GLN OXT O N N 108 GLN H H N N 109 GLN H2 H N N 110 GLN HA H N N 111 GLN HB2 H N N 112 GLN HB3 H N N 113 GLN HG2 H N N 114 GLN HG3 H N N 115 GLN HE21 H N N 116 GLN HE22 H N N 117 GLN HXT H N N 118 GLU N N N N 119 GLU CA C N S 120 GLU C C N N 121 GLU O O N N 122 GLU CB C N N 123 GLU CG C N N 124 GLU CD C N N 125 GLU OE1 O N N 126 GLU OE2 O N N 127 GLU OXT O N N 128 GLU H H N N 129 GLU H2 H N N 130 GLU HA H N N 131 GLU HB2 H N N 132 GLU HB3 H N N 133 GLU HG2 H N N 134 GLU HG3 H N N 135 GLU HE2 H N N 136 GLU HXT H N N 137 GLY N N N N 138 GLY CA C N N 139 GLY C C N N 140 GLY O O N N 141 GLY OXT O N N 142 GLY H H N N 143 GLY H2 H N N 144 GLY HA2 H N N 145 GLY HA3 H N N 146 GLY HXT H N N 147 HIS N N N N 148 HIS CA C N S 149 HIS C C N N 150 HIS O O N N 151 HIS CB C N N 152 HIS CG C Y N 153 HIS ND1 N Y N 154 HIS CD2 C Y N 155 HIS CE1 C Y N 156 HIS NE2 N Y N 157 HIS OXT O N N 158 HIS H H N N 159 HIS H2 H N N 160 HIS HA H N N 161 HIS HB2 H N N 162 HIS HB3 H N N 163 HIS HD1 H N N 164 HIS HD2 H N N 165 HIS HE1 H N N 166 HIS HE2 H N N 167 HIS HXT H N N 168 HOH O O N N 169 HOH H1 H N N 170 HOH H2 H N N 171 ILE N N N N 172 ILE CA C N S 173 ILE C C N N 174 ILE O O N N 175 ILE CB C N S 176 ILE CG1 C N N 177 ILE CG2 C N N 178 ILE CD1 C N N 179 ILE OXT O N N 180 ILE H H N N 181 ILE H2 H N N 182 ILE HA H N N 183 ILE HB H N N 184 ILE HG12 H N N 185 ILE HG13 H N N 186 ILE HG21 H N N 187 ILE HG22 H N N 188 ILE HG23 H N N 189 ILE HD11 H N N 190 ILE HD12 H N N 191 ILE HD13 H N N 192 ILE HXT H N N 193 K K K N N 194 LEU N N N N 195 LEU CA C N S 196 LEU C C N N 197 LEU O O N N 198 LEU CB C N N 199 LEU CG C N N 200 LEU CD1 C N N 201 LEU CD2 C N N 202 LEU OXT O N N 203 LEU H H N N 204 LEU H2 H N N 205 LEU HA H N N 206 LEU HB2 H N N 207 LEU HB3 H N N 208 LEU HG H N N 209 LEU HD11 H N N 210 LEU HD12 H N N 211 LEU HD13 H N N 212 LEU HD21 H N N 213 LEU HD22 H N N 214 LEU HD23 H N N 215 LEU HXT H N N 216 LYS N N N N 217 LYS CA C N S 218 LYS C C N N 219 LYS O O N N 220 LYS CB C N N 221 LYS CG C N N 222 LYS CD C N N 223 LYS CE C N N 224 LYS NZ N N N 225 LYS OXT O N N 226 LYS H H N N 227 LYS H2 H N N 228 LYS HA H N N 229 LYS HB2 H N N 230 LYS HB3 H N N 231 LYS HG2 H N N 232 LYS HG3 H N N 233 LYS HD2 H N N 234 LYS HD3 H N N 235 LYS HE2 H N N 236 LYS HE3 H N N 237 LYS HZ1 H N N 238 LYS HZ2 H N N 239 LYS HZ3 H N N 240 LYS HXT H N N 241 MET N N N N 242 MET CA C N S 243 MET C C N N 244 MET O O N N 245 MET CB C N N 246 MET CG C N N 247 MET SD S N N 248 MET CE C N N 249 MET OXT O N N 250 MET H H N N 251 MET H2 H N N 252 MET HA H N N 253 MET HB2 H N N 254 MET HB3 H N N 255 MET HG2 H N N 256 MET HG3 H N N 257 MET HE1 H N N 258 MET HE2 H N N 259 MET HE3 H N N 260 MET HXT H N N 261 PHE N N N N 262 PHE CA C N S 263 PHE C C N N 264 PHE O O N N 265 PHE CB C N N 266 PHE CG C Y N 267 PHE CD1 C Y N 268 PHE CD2 C Y N 269 PHE CE1 C Y N 270 PHE CE2 C Y N 271 PHE CZ C Y N 272 PHE OXT O N N 273 PHE H H N N 274 PHE H2 H N N 275 PHE HA H N N 276 PHE HB2 H N N 277 PHE HB3 H N N 278 PHE HD1 H N N 279 PHE HD2 H N N 280 PHE HE1 H N N 281 PHE HE2 H N N 282 PHE HZ H N N 283 PHE HXT H N N 284 PRO N N N N 285 PRO CA C N S 286 PRO C C N N 287 PRO O O N N 288 PRO CB C N N 289 PRO CG C N N 290 PRO CD C N N 291 PRO OXT O N N 292 PRO H H N N 293 PRO HA H N N 294 PRO HB2 H N N 295 PRO HB3 H N N 296 PRO HG2 H N N 297 PRO HG3 H N N 298 PRO HD2 H N N 299 PRO HD3 H N N 300 PRO HXT H N N 301 SER N N N N 302 SER CA C N S 303 SER C C N N 304 SER O O N N 305 SER CB C N N 306 SER OG O N N 307 SER OXT O N N 308 SER H H N N 309 SER H2 H N N 310 SER HA H N N 311 SER HB2 H N N 312 SER HB3 H N N 313 SER HG H N N 314 SER HXT H N N 315 THR N N N N 316 THR CA C N S 317 THR C C N N 318 THR O O N N 319 THR CB C N R 320 THR OG1 O N N 321 THR CG2 C N N 322 THR OXT O N N 323 THR H H N N 324 THR H2 H N N 325 THR HA H N N 326 THR HB H N N 327 THR HG1 H N N 328 THR HG21 H N N 329 THR HG22 H N N 330 THR HG23 H N N 331 THR HXT H N N 332 TRP N N N N 333 TRP CA C N S 334 TRP C C N N 335 TRP O O N N 336 TRP CB C N N 337 TRP CG C Y N 338 TRP CD1 C Y N 339 TRP CD2 C Y N 340 TRP NE1 N Y N 341 TRP CE2 C Y N 342 TRP CE3 C Y N 343 TRP CZ2 C Y N 344 TRP CZ3 C Y N 345 TRP CH2 C Y N 346 TRP OXT O N N 347 TRP H H N N 348 TRP H2 H N N 349 TRP HA H N N 350 TRP HB2 H N N 351 TRP HB3 H N N 352 TRP HD1 H N N 353 TRP HE1 H N N 354 TRP HE3 H N N 355 TRP HZ2 H N N 356 TRP HZ3 H N N 357 TRP HH2 H N N 358 TRP HXT H N N 359 TYR N N N N 360 TYR CA C N S 361 TYR C C N N 362 TYR O O N N 363 TYR CB C N N 364 TYR CG C Y N 365 TYR CD1 C Y N 366 TYR CD2 C Y N 367 TYR CE1 C Y N 368 TYR CE2 C Y N 369 TYR CZ C Y N 370 TYR OH O N N 371 TYR OXT O N N 372 TYR H H N N 373 TYR H2 H N N 374 TYR HA H N N 375 TYR HB2 H N N 376 TYR HB3 H N N 377 TYR HD1 H N N 378 TYR HD2 H N N 379 TYR HE1 H N N 380 TYR HE2 H N N 381 TYR HH H N N 382 TYR HXT H N N 383 VAL N N N N 384 VAL CA C N S 385 VAL C C N N 386 VAL O O N N 387 VAL CB C N N 388 VAL CG1 C N N 389 VAL CG2 C N N 390 VAL OXT O N N 391 VAL H H N N 392 VAL H2 H N N 393 VAL HA H N N 394 VAL HB H N N 395 VAL HG11 H N N 396 VAL HG12 H N N 397 VAL HG13 H N N 398 VAL HG21 H N N 399 VAL HG22 H N N 400 VAL HG23 H N N 401 VAL HXT H N N 402 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BME C1 C2 sing N N 70 BME C1 O1 sing N N 71 BME C1 H11 sing N N 72 BME C1 H12 sing N N 73 BME C2 S2 sing N N 74 BME C2 H21 sing N N 75 BME C2 H22 sing N N 76 BME O1 HO1 sing N N 77 BME S2 HS2 sing N N 78 CYS N CA sing N N 79 CYS N H sing N N 80 CYS N H2 sing N N 81 CYS CA C sing N N 82 CYS CA CB sing N N 83 CYS CA HA sing N N 84 CYS C O doub N N 85 CYS C OXT sing N N 86 CYS CB SG sing N N 87 CYS CB HB2 sing N N 88 CYS CB HB3 sing N N 89 CYS SG HG sing N N 90 CYS OXT HXT sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TRP N CA sing N N 315 TRP N H sing N N 316 TRP N H2 sing N N 317 TRP CA C sing N N 318 TRP CA CB sing N N 319 TRP CA HA sing N N 320 TRP C O doub N N 321 TRP C OXT sing N N 322 TRP CB CG sing N N 323 TRP CB HB2 sing N N 324 TRP CB HB3 sing N N 325 TRP CG CD1 doub Y N 326 TRP CG CD2 sing Y N 327 TRP CD1 NE1 sing Y N 328 TRP CD1 HD1 sing N N 329 TRP CD2 CE2 doub Y N 330 TRP CD2 CE3 sing Y N 331 TRP NE1 CE2 sing Y N 332 TRP NE1 HE1 sing N N 333 TRP CE2 CZ2 sing Y N 334 TRP CE3 CZ3 doub Y N 335 TRP CE3 HE3 sing N N 336 TRP CZ2 CH2 doub Y N 337 TRP CZ2 HZ2 sing N N 338 TRP CZ3 CH2 sing Y N 339 TRP CZ3 HZ3 sing N N 340 TRP CH2 HH2 sing N N 341 TRP OXT HXT sing N N 342 TYR N CA sing N N 343 TYR N H sing N N 344 TYR N H2 sing N N 345 TYR CA C sing N N 346 TYR CA CB sing N N 347 TYR CA HA sing N N 348 TYR C O doub N N 349 TYR C OXT sing N N 350 TYR CB CG sing N N 351 TYR CB HB2 sing N N 352 TYR CB HB3 sing N N 353 TYR CG CD1 doub Y N 354 TYR CG CD2 sing Y N 355 TYR CD1 CE1 sing Y N 356 TYR CD1 HD1 sing N N 357 TYR CD2 CE2 doub Y N 358 TYR CD2 HD2 sing N N 359 TYR CE1 CZ doub Y N 360 TYR CE1 HE1 sing N N 361 TYR CE2 CZ sing Y N 362 TYR CE2 HE2 sing N N 363 TYR CZ OH sing N N 364 TYR OH HH sing N N 365 TYR OXT HXT sing N N 366 VAL N CA sing N N 367 VAL N H sing N N 368 VAL N H2 sing N N 369 VAL CA C sing N N 370 VAL CA CB sing N N 371 VAL CA HA sing N N 372 VAL C O doub N N 373 VAL C OXT sing N N 374 VAL CB CG1 sing N N 375 VAL CB CG2 sing N N 376 VAL CB HB sing N N 377 VAL CG1 HG11 sing N N 378 VAL CG1 HG12 sing N N 379 VAL CG1 HG13 sing N N 380 VAL CG2 HG21 sing N N 381 VAL CG2 HG22 sing N N 382 VAL CG2 HG23 sing N N 383 VAL OXT HXT sing N N 384 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'POTASSIUM ION' K 3 'CHLORIDE ION' CL 4 BETA-MERCAPTOETHANOL BME 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1L63 _pdbx_initial_refinement_model.details 'PDB ENTRY 1L63' #